BOC Sciences provides a wide range of research chemicals and biochemicals including inhibitors, building blocks, GMP Products, impurities and metabolites, APIs for Veterinary, Natural Compounds, ADCs, Stem Cell Molecule and chiral compounds.
| Product | Description | |
|---|---|---|
| Formylpolystyrene | Resins for solid phase organic synthesis. Alternative Names: Polystyrene aldehyde. |  |
| Fowlicidin-2 | Fowlicidin-2, which is composed of 31 amino acids, is widely expressed in the majority of tissues in chickens and has an important role in innate immunity. | |
| Fowlicidin 3 | Fowlicidin-3 is an alpha-helical cationic host defense peptide with potent antibacterial and lipopolysaccharide-neutralizing activities. It is highly potent against a broad range of Gram-negative and Gram-positive bacteria in vitro, including antibiotic-resistant strains, with minimum inhibitory concentrations in the range 1-2 microM. | |
| Fox04 | FOXO4 is a peptide antagonist intended to reverse ageing effects in animal subjects through selective induction of apoptosis of senescent cells. Grades: 95.2%. Molecular formula: C228H388N86O64. Mole weight: 5358.05. | |
| Foxy-5 | A Wnt5a peptide mimetic. It has been undergoing clinical trials for the treatment of prostate cancer, colorectal cancer, metastatic colon cancer, metastatic breast cancer, and metastatic prostate cancer. Alternative Names: Foxy 5; Foxy5; (2S)-2-[[(2S)-4-carboxy-2-[[(2R)-2-[[2-[[(2S)-3-carboxy-2-[[(2S)-2-formamido-4-methylsulfanylbutanoyl]amino]propanoyl]amino]acetyl]amino]-3-sulfanylpropanoyl]amino]butanoyl]amino]-4-methylpentanoic acid. Grades: >95%. CAS No. 881188-51-8. Molecular formula: C26H42N6O12S2. Mole weight: 694.8. | |
| FR 179642 | FR 179642 is an impurity of Micafungin, which is an antifungal agent. Alternative Names: FR-179642; FR179642; Pneumocandin M1; 1-[(4R,5R)-4,5-Dihydroxy-L-ornithine]-4-[(4S)-4-hydroxy-4-[4-hydroxy-3-(sulfooxy)phenyl]-L-threonine]pneumocandin A0; 1-[(4R,5R)-4,5-Dihydroxy-L-ornithine]-4-[(S)-4-hydroxy-4-[4-hydroxy-3-(sulfooxy)phenyl]-L-threonine]pneumocandin A0; CMICA; FR 133303. Grades: ≥95%. CAS No. 168110-44-9. Molecular formula: C35H52N8O20S. Mole weight: 936.89. | |
| FR 901379 | FR 901379 is an impurity of Micafungin, a lipopeptide compound that acts as an antifungal agent with activity against Aspergillus and Candida species. FR901379 is an echinocandin-like antifungal lipopeptide with inhibitory activity against C. albicans, C. krusei, C. tropicalis, C. utilis, A. fumigatus, and A. niger fungi (IC50s = <0.003-1.9 μg/ml). FR 901379 has a protective effect against C. albicans infection in mice (ED50 = 1.1 mg/kg). It also reduces the number of lung cysts and trophozoites in a mouse model of Plasmodium carinii infection. Alternative Names: 1-[(4R,5R)-4,5-Dihydroxy-N2-(1-oxohexadecyl)-L-ornithine]-4-[(4S)-4-hydroxy-4-[4-hydroxy-3-(sulfooxy)phenyl]-L-threonine]pneumocandin A0; (2α,3β,4β)-(4R,5R)-4,5-Dihydroxy-N2-(1-oxohexadecyl)-L-ornithyl-L-threonyl-trans-4-hydroxy-L-prolyl-(S)-4-hydroxy-4-[4-hydroxy-3-(sulfooxy)phenyl]-L-threonyl-3-hydroxy-L-glutaminyl-3-hydroxy-4-methyl-L-Proline Cyclic (6→1)-Peptide; 1H-Dipyrrolo[2,1-c:2',1'-l][1,4,7,10,13,16]hexaazacycloheneicosine Cyclic Peptide Deriv. Grades: ≥90%. CAS No. 144371-88-0. Molecular formula: C51H82N8O21S. Mole weight: 1175.30. | |
| Frenatin-1 | Frenatin-1 is an antimicrobial peptide with selective activity. Frenatin-1 is only active against Micrococcus luteus (MIC=25 μg/ml) and not against Bacillus cereus, Escherichia coli, Leuconostoc mesenteroides, Micrococcus luteus, Pastewella haemolytica, Staphylococcus aureus, Streptococcus faecalis and Streptococcus uberis. | |
| Frenatin-2 | Frenatin-2 is an antimicrobial peptide with selective activity. Frenatin-2 is only active against Micrococcus luteus (MIMC=50 μg/ml) and not against Bacillus cereus, Escherichia coli, Leuconostoc mesenteroides, Micrococcus luteus, Pastewella haemolytica, Staphylococcus aureus, Streptococcus faecalis and Streptococcus uberis. | |
| Frenatin 3 | Frenatin 3 inhibits the production of nitric oxide by the enzyme neuronal nitric oxide synthase at a micromolar concentration by binding to its regulatory protein, Ca2+ calmodulin, a protein known to recognize and bind amphipathic alpha-helices. Grades: >95% by HPLC. Molecular formula: C88H146N24O24S. Mole weight: 1956.31. | |
| Frenatin-3 | The peptide frenatin 3 is a major component of the skin secretion of the Australian giant tree frog, Litoria infrafrenata. | |
| Frenatin-4 | Frenatin-4 is a very weak antimicrobial peptide since it does not show activity below 100 μg/ml against Bacillus cereus, Escherichia coli, Leuconostoc mesenteroides, Micrococcus luteus, Pastewella haemolytica, Staphylococcus aureus, Streptococcus faecalis and Streptococcus uberis. | |
| FRETS-VWF73 | FRETS-VWF73 is a synthetic 73-amino-acid peptide that can be used as a fluorogenic substrate for ADAMTS13 assay. Alternative Names: H-Asp-Arg-Glu-{Dap(Nma)}-Ala-Pro-Asn-Leu-Val-Tyr-Met-Val-Thr-Gly-{Dap(Dnp)}-Pro-Ala-Ser-Asp-Glu-Ile-Lys-Arg-Leu-Pro-Gly-Asp-Ile-Gln-Val-Val-Pro-Ile-Gly-Val-Gly-Pro-Asn-Ala-Asn-Val-Gln-Glu-Leu-Glu-Arg-Ile-Gly-Trp-Pro-Asn-Ala-Pro-Ile-Leu-Ile-Gln-Asp-Phe-Glu-Thr-Leu-Pro-Arg-Glu-Ala-Pro-Asp-Leu-Val-Leu-Gln-Arg-OH. Molecular formula: C370H583N103O113S. Mole weight: 8314.28. | |
| Fromyl-L-Valine | An intermediate of gramicidin A biosynthesis. Alternative Names: For-L-Val-OH; N-Formyl-L-valine; FOR-VAL-OH; N-Formyl-valin; 2-formamido-3-methyl-butanoic acid; FORMYL-L-VALINE. Grades: ≥ 98% (HPLC). CAS No. 4289-97-8. Molecular formula: C6H11NO3. Mole weight: 145.16. | |
| Fructose-bisphosphate aldolase A isoform 2 (207-222) | A peptide fragment of Fructose-bisphosphate aldolase A isoform 2. Fructose-bisphosphate aldolase A plays a key role in glycolysis and gluconeogenesis. In addition, it may also function as scaffolding protein (By similarity). Alternative Names: Lung cancer antigen NY-LU-1 isoform 2 (207-222). | |
| Fructose-bisphosphate aldolase A isoform 2 (326-338) | A peptide fragment of Fructose-bisphosphate aldolase A isoform 2. Fructose-bisphosphate aldolase A plays a key role in glycolysis and gluconeogenesis. In addition, it may also function as scaffolding protein (By similarity). Alternative Names: Lung cancer antigen NY-LU-1 isoform 2 (326-338). | |
| FSL-1-FLAG | Lipopeptide FSL-1, synthesized on the basis of the N-terminal structure of M. salivarium lipoprotein, can induce ICAM-1 expression on the surface of human gingival fibroblasts. In addition, it induces the production of monocyte chemoattractant protein 1, interleukin-6 (IL-6), and IL-8. It activates macrophages to produce tumor necrosis factor-alpha. Alternative Names: Fibroblast Stimulating Lipopeptide 1 FLAG-tag; H-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Gly-Asp-Pro-Lys-His-Pro-Lys-Ser-Phe-Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys-OH; L-Lysine, S-[2,3-bis[(1-oxohexadecyl)oxy]propyl]-L-cysteinylglycyl-L-α-aspartyl-L-prolyl-L-lysyl-L-histidyl-L-prolyl-L-lysyl-L-seryl-L-phenylalanyl-L-α-aspartyl-L-tyrosyl-L-lysyl-L-α-aspartyl-L-α-aspartyl-L-α-aspartyl-L-α-aspartyl-. Grades: ≥95%. CAS No. 2243206-97-3. Molecular formula: C125H198N24O37S. Mole weight: 2661.15. | |
| FSLLRY-NH2 | FSLLRY-NH2 is a selective PAR2 peptide antagonist. It reverses taxol-induced mechanical allodynia, heat hyperalgesia and PKC activation in ICR mice, also suppresses ERK activation and collagen production in isolated cardiac fibroblasts. Alternative Names: [Phe1,Ser2,Tyr6]-PAR-1 (1-6) amide (human). CAS No. 245329-02-6. Molecular formula: C39H60N10O8. Mole weight: 796.97. | |
| FSLLRY-NH2 TFA | FSLLRY-NH2 TFA is a selective PAR2 peptide antagonist. It reverses taxol-induced mechanical allodynia, heat hyperalgesia and PKC activation in ICR mice, and also suppresses ERK activation and collagen production in isolated cardiac fibroblasts. Alternative Names: H-Phe-Ser-Leu-Leu-Arg-Tyr-NH2.TFA; L-phenylalanyl-L-seryl-L-leucyl-L-leucyl-L-arginyl-L-tyrosinamide trifluoroacetic acid. Grades: ≥95%. Molecular formula: C41H61F3N10O10. Mole weight: 910.99. | |
| FTase Inhibitor I | FTase inhibitor I is a potent and selective farnesyltransferase (FTase) inhibitor with an IC50 of 21 nM, which is 30-fold higher for FTase over geranylgeranyl transferase (GGTase; IC50 = 790 nM). Alternative Names: Farnesyltransferase Inhibitor I; B581; N-[(2S)-2-[[(2R)-2-amino-3-mercaptopropyl]amino]-3-methylbutyl]-L-phenylalanyl-L-methionine. Grades: ≥95%. CAS No. 149759-96-6. Molecular formula: C22H38N4O3S2. Mole weight: 470.69. | |
| FTase Inhibitor II | FTase Inhibitor II is a cell-permeable analog of farnesyl pyrophosphate (FPP) that potently inhibits FTase with an IC50 of 50-75 nM, and it does not inhibit geranylgeranyl transferase at similar concentrations (IC50 > 100 μM). FTase Inhibitor II is a possible cancer therapeutic agent. Alternative Names: Farnesyltransferase Inhibitor II; FTI-II; N-[4-[[(2R)-2-amino-3-mercapto-1-oxopropyl]amino]benzoyl]-L-methionine. Grades: ≥80%. CAS No. 156707-43-6. Molecular formula: C15H21N3O4S2. Mole weight: 371.47. | |
| FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | It is a derivative of Exendin-4 peptide. Alternative Names: Phe-Thr-Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser. Grades: ≥95%. Molecular formula: C164H252N42O53S. Mole weight: 3692.12. | |
| Furo(3,2-b)pyridin-2-ylmethanol | Furo(3,2-b)pyridin-2-ylmethanol (CAS# 162537-61-3) is a useful research chemical. Alternative Names: Furo[3,2-b]pyridine-2-methanol. CAS No. 162537-61-3. Molecular formula: C8H7NO2. Mole weight: 149.15. | |
| Fusaricidin B | Fusaricidins B, a new depsipeptide antibiotic, has been isolated as a minor component from the culture broth of Bacillus polymyxa KT-8 which was obtained from the rhizosphere of garlic suffering from the basal rot caused by Fusarium oxysporum. Fusaricidins B is active against fungi and Gram-positive bacteria almost as well as fusaricidin A. Molecular formula: C42H76N10O11. Mole weight: 897.11. | |
| Fusaricidin C | Fusaricidins C, a new depsipeptide antibiotic, has been isolated as a minor component from the culture broth of Bacillus polymyxa KT-8 which was obtained from the rhizosphere of garlic suffering from the basal rot caused by Fusarium oxysporum. Fusaricidins C is active against fungi and Gram-positive bacteria almost as well as fusaricidin A. Molecular formula: C45H74N10O12. Mole weight: 947.13. | |
| Fusaricidin D | Fusaricidins D, a new depsipeptide antibiotic, has been isolated as a minor component from the culture broth of Bacillus polymyxa KT-8 which was obtained from the rhizosphere of garlic suffering from the basal rot caused by Fusarium oxysporum. Fusaricidins D is active against fungi and Gram-positive bacteria almost as well as fusaricidin A. Molecular formula: C46H76N10O12. Mole weight: 961.15. | |
| Fz7-21 | Fz7-21, a peptide antagonist of Frizzled 7 receptor, selectively binds to Frizzled 7 CRD subclass. Alternative Names: FZD7 binding peptide; Ac-Leu-Pro-Ser-Asp-Asp-Leu-Glu-Phe-Trp-Cys-His-Val-Met-Tyr-NH2. Grades: ≥97% by HPLC. CAS No. 2247635-23-8. Molecular formula: C83H114N18O23S2. Mole weight: 1796.05. | |
| G1/S-specific cyclin-D1 (101-109) | G1/S-specific cyclin-D1 (101-109) is a truncated fragment of G1/S-specific cyclin-D1. G1/S-specific cyclin-D1 is a regulatory component of the cyclin D1-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G1/S transition. Alternative Names: B-cell lymphoma 1 protein (101-109); BCL-1 oncogene (101-109); PRAD1 oncogene (101-109). | |
| G1/S-specific cyclin-D1 (198-212) | G1/S-specific cyclin-D1 (198-212) is a truncated fragment of G1/S-specific cyclin-D1. G1/S-specific cyclin-D1 is a regulatory component of the cyclin D1-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G1/S transition. Alternative Names: B-cell lymphoma 1 protein (198-212); BCL-1 oncogene (198-212); PRAD1 oncogene (198-212). | |
| G280-9 | G280-9 is a natural epitope peptide containing 9 amino acids and is also a relevant target for melanoma expression. Alternative Names: 95 kDa Melanocyte-Specific Secreted Glycoprotein (256-264) (human, bovine, mouse); Melanocyte Lineage-Specific Antigen GP100 (256-264) (human, bovine, mouse); ME20-M/ME20-S (256-264) (human, bovine, mouse); H-Tyr-Leu-Glu-Pro-Gly-Pro-Val-Thr-Ala-OH; L-tyrosyl-L-leucyl-L-alpha-glutamyl-L-prolyl-glycyl-L-prolyl-L-valyl-L-threonyl-L-alanine; Melanocyte Protein PMEL 17 (256-264) (human, bovine, mouse). Grades: ≥95%. CAS No. 156761-76-1. Molecular formula: C44H67N9O14. Mole weight: 946.05. | |
| G280-9 acetate | G280-9 acetate is a natural epitope peptide containing 9 amino acids and is a relevant target for melanoma expression. It is a common melanoma gp100 epitope that is restricted by MHC-associated HLA-A2. Alternative Names: H-Tyr-Leu-Glu-Pro-Gly-Pro-Val-Thr-Ala-OH.CH3CO2H; L-tyrosyl-L-leucyl-L-alpha-glutamyl-L-prolyl-glycyl-L-prolyl-L-valyl-L-threonyl-L-alanine acetic acid. Grades: ≥95%. Molecular formula: C46H71N9O16. Mole weight: 1006.12. | |
| G3335 | G3335 is a cell-permeable dipeptide that selectively and reversibly antagonizes PPARγ with a Kd value of 8.34 μM. G3335 reversiblyand competitively blocks activation of PPARγ by rosiglitazone. Alternative Names: tryptophanyl-glutamic acid; Tryptophyl-Glutamate; L-Trp-L-Glu; L-tryptophyl-L-glutamic acid; N-L-Tryptophyl-L-glutamic acid; (S)-2-[(S)-2-Amino-3-(1H-indol-3-yl)-propionylamino]-pentanedioic acid. Grades: ≥98%. CAS No. 36099-95-3. Molecular formula: C16H19N3O5. Mole weight: 333.34. | |
| G3335 acetate | G3335 acetate is a cell-permeable dipeptide that selectively and reversibly antagonizes PPARγ with a Kd of 8.34 μM. G3335 reversibly and competitively blocks activation of PPARγ by rosiglitazone. Alternative Names: H-Trp-Glu-OH.CH3CO2H; WE acetate; L-tryptophyl-L-glutamic acid acetic acid; Acetic acid, compd. with L-tryptophyl-yl L-Glutamate (1:1). Grades: ≥95%. CAS No. 2760881-52-3. Molecular formula: C18H23N3O7. Mole weight: 393.39. | |
| G3-C12 | G3-C12 is a peptide that can bind to Galectin-3 and has anti-cancer activity. Grades: ≥97% by HPLC. CAS No. 848301-94-0. Molecular formula: C74H115N23O23S2. Mole weight: 1759. | |
| G3-C12 TFA | G3-C12 TFA is a galectin-3 binding peptide, with Kd of 88 nM, and has anticancer activity. Alternative Names: L-Arginine, L-alanyl-L-asparaginyl-L-threonyl-L-prolyl-L-cysteinylglycyl-L-prolyl-L-tyrosyl-L-threonyl-L-histidyl-L-α-aspartyl-L-cysteinyl-L-prolyl-L-valyl-L-lysyl-, trifluoroacetic acid; H-Ala-Asn-Thr-Pro-Cys-Gly-Pro-Tyr-Thr-His-Asp-Cys-Pro-Val-Lys-Arg-OH.TFA. Grades: ≥98%. Molecular formula: C74H115N23O23S2.C2HF3O2. Mole weight: 1873.00. | |
| Gaegurin-1 | The source is Glandirana rugosa. Gaegurin-1 has a non-hemolytic activity. It has a broad spectrum of activity against both Gram-positive and Gram-negative bacteria, fungi and protozoa. Alternative Names: GGN1. | |
| Gaegurin-2 | The source is Glandirana rugosa. Gaegurin-2 has a non-hemolytic activity. It has a broad spectrum of activity against both Gram-positive and Gram-negative bacteria, fungi and protozoa. Alternative Names: GGN2. | |
| Gaegurin-3 | The source is Glandirana rugosa. Gaegurin-3 has a non-hemolytic activity. It has a broad spectrum of activity against both Gram-positive and Gram-negative bacteria, fungi and protozoa. Alternative Names: GGN3. | |
| Gaegurin-4 | Gaegurin 4 is a 37-residue antimicrobial peptide isolated from the skin of a Korean frog, Rana rugosa. This peptide shows a broad range of activity against prokaryotic cells but shows very little hemolytic activity against human red blood cells. Alternative Names: GGN4. | |
| Gaegurin-5 | Gaegurin 5 is a 24-residue, membrane-active antimicrobial peptide isolated from the skin of an Asian frog, Rana rugosa. Alternative Names: GGN5. | |
| Gaegurin-6 | Gaegurin-6, an antimicrobial peptide that belongs to the alpha-helix family, was isolated from the skin of Rana rugosa. Alternative Names: GGN6. | |
| Gaegurin-6-RA peptide precursor | Gaegurin-6-RA peptide precursor, an antimicrobial peptide that belongs to the alpha-helix family, was isolated from the skin of Rana rugosa. | |
| Gaegurin-6-RN antimicrobial peptide | Gaegurin-6-RN antimicrobial peptide is an antimicrobial peptide that is isolated from Sylvirana nigrovittata. | |
| Gaegurin-LK1 | Gaegurin-LK1 has antimicrobial activity against Gram-positive bacteria S.aureus, S.aureus and B.subtilis (MIC=20.0 μM), against Gram-negative bacteria E.coli ML-35P (MIC=50.0 μM), P.aeruginosa PA01 (MIC=10.0 μM) and P.aeruginosa and against fungus C.albicans. | |
| Gaegurin-LK2 | Gaegurin-LK2 has antimicrobial activity against Gram-positive bacteria S.aureus, S.aureus and B.subtilis (MIC=20.0 μM), against Gram-negative bacteria E.coli ML-35P (MIC=50.0 μM), P.aeruginosa PA01 (MIC=10.0 μM) and P.aeruginosa and against fungus C.albicans. | |
| Gaegurin-RN1 | Gaegurin-RN1 has active activity against Staphylococcus aureus ATCC25923 (MIC=2.34 microg/ml), Staphylococcus aureus ATCC43300 (MIC=9.38 microg/ml), Bacillus subtilis (MIC=4.69 microg/ml), Candida albicans ATCC2002 (MIC=4.69 microg/ml), and Escherichia coli ML-35P (MIC=18.75 microg/ml). | |
| Gaegurin-RN4 | Gaegurin-RN4 has active activity against Staphylococcus aureus ATCC25923 (MIC=1.17 microg/ml), Staphylococcus aureus ATCC43300 (MIC=9.38 microg/ml), Bacillus subtilis (MIC=2.34 microg/ml), and Candida albicans ATCC2002 (MIC=2.34 microg/ml). | |
| Gaegurin-RN5 | Gaegurin-RN5 is isolated from Rana nigrovittata with antibacterial and antifungal activities. | |
| Gal 3 | Gal 3 is an antimicrobial peptide found in Gallus gallus. Alternative Names: Galectin-3. | |
| Gal 9 | Gal 9 is an antimicrobial peptide found in Gallus gallus. Galectin-9 is known to enhance the expansion of myeloid-derived suppressor cells (MDSCs) in murine models. Alternative Names: Galectin-9. | |
| Galanin (1-13)-Bradykinin (2-9) amide | Galanin (1-13)-Bradykinin (2-9) amide is a high affinity ligand and antagonist of galanin receptor. Alternative Names: M35; Galanin Receptor Ligand M35; H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg-NH2; glycyl-L-tryptophyl-L-threonyl-L-leucyl-L-asparagyl-L-seryl-L-alanyl-glycyl-L-tyrosyl-L-leucyl-L-leucyl-glycyl-L-prolyl-L-prolyl-L-prolyl-glycyl-L-phenylalanyl-L-seryl-L-prolyl-L-phenylalanyl-L-argininamide; M35 Peptide. Grades: ≥95%. CAS No. 142846-71-7. Molecular formula: C107H153N27O26. Mole weight: 2233.52. | |
| Galanin (1-13)-Neuropeptide Y (25-36) amide | The chimeric peptide M32 is a high affinity galanin receptor antagonist (IC50= 0.1 nM in rat hypothalamus membranes and Kd= 0.01 nM in rat spinal cord membranes). Alternative Names: H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-D-Arg-Tyr-NH2; M32; M 88 peptide; galanin-NPY chimeric peptide M88. Grades: 95%. CAS No. 147138-51-0. Molecular formula: C136H209N41O34. Mole weight: 2962.37. | |
| Galanin (1-16), mouse, porcine, rat | Galanin (1-16), mouse, porcine, rat is an agonist of the hippocampal galanin receptor with Kd of 3 nM. Alternative Names: H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-OH; glycyl-L-tryptophyl-L-threonyl-L-leucyl-L-asparagyl-L-seryl-L-alanyl-glycyl-L-tyrosyl-L-leucyl-L-leucyl-glycyl-L-prolyl-L-histidyl-L-alanyl-L-isoleucine; Galanin (1-16) (porcine, rat); Galanin Fragment 1-16, porcine, rat. Grades: 95%. CAS No. 125118-77-6. Molecular formula: C78H116N20O21. Mole weight: 1669.88. | |
| Galanin (1-16), mouse, porcine, rat TFA | Galanin (1-16), mouse, porcine, rat TFA is an agonist of the hippocampal galanin receptor with Kd of 3 nM. Alternative Names: H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-OH.TFA; glycyl-L-tryptophyl-L-threonyl-L-leucyl-L-asparagyl-L-seryl-L-alanyl-glycyl-L-tyrosyl-L-leucyl-L-leucyl-glycyl-L-prolyl-L-histidyl-L-alanyl-L-isoleucine trifluoroacetic acid; Galanin (1-16) (porcine, rat) trifluoroacetic acid. Grades: ≥98%. Molecular formula: C78H116N20O21.C2HF3O2. Mole weight: 1783.90. | |
| Galanin (1-19), human | Galanin (1-19), human is the 1-19 fragment of human galanin. Galanin (GAL) is a neuropeptide that can regulate hormone release, resist inoculation and change feeding behavior. Alternative Names: H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-OH; glycyl-L-tryptophyl-L-threonyl-L-leucyl-L-asparagyl-L-seryl-L-alanyl-glycyl-L-tyrosyl-L-leucyl-L-leucyl-glycyl-L-prolyl-L-histidyl-L-alanyl-L-valyl-glycyl-L-asparagyl-L-histidine; 1-19-Galanin (human). Grades: 95%. CAS No. 136005-51-1. Molecular formula: C89H130N26O25. Mole weight: 1964.14. | |
| Galanin (1-29) (rat, Mouse) | Galanin (1-29) (rat, mouse) is a non-selective galanin receptor agonist (Ki = 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3, respectively) with anticonvulsant activity. Alternative Names: Galanin (mouse, rat). CAS No. 114547-31-8. Molecular formula: C141H211N43O41. Mole weight: 3164.48. | |
| Galanin (1-30) (human) | Galanin (1-30) (human) is a peptide agonist of galanin receptors GalR1 and GalR2. It has an action on intestinal smooth muscle, insulin and somatostatin release, and synaptic neurotransmission. Alternative Names: Galanin human; Galanin-1-30. Grades: ≥97% by HPLC. CAS No. 119418-04-1. Molecular formula: C139H210N42O43. Mole weight: 3157.4. | |
| Galanin (2-11) (AR-M 1896) | AR-M 1896 has been found to be a galanin GAL2 receptor agonist and could be used as an antiepileptogenic agent. Alternative Names: WTLNSAGYLL-CONH2; 367518-31-8; Galanin (2-11) porcine, rat; AR-M1896; CHEMBL578710; Galanin-2-11-NH.2.; AR-M 1896; Gal(2-11)amide; Galanin(2-11)porcine,rat; HY-P1129; BDBM50307252; AKOS024457247; CS-0028038; Galanin (2-11) porcine, rat, >=97% (HPLC), lyophilized powder. Grades: ≥97% by HPLC. CAS No. 367518-31-8. Molecular formula: C54H81N13O14. Mole weight: 1136.3. | |
| Galanin-Like Peptide (human) | Galanin-Like Peptide (GALP), a neuropeptide composed of 60 amino acids, was first isolated from the hypothalamus of pigs and later discovered in rats and humans. GALP shows a higher affinity (about 18-fold) for GALR2 receptors than GALR1 receptors, while galanin is relatively non-selective. GALP is an orexigenic and anxiogenic peptide that can affect the emotional state of the central nervous system. Alternative Names: GALP (human); H-Ala-Pro-Ala-His-Arg-Gly-Arg-Gly-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Val-Leu-His-Leu-Pro-Gln-Met-Gly-Asp-Gln-Asp-Gly-Lys-Arg-Glu-Thr-Ala-Leu-Glu-Ile-Leu-Asp-Leu-Trp-Lys-Ala-Ile-Asp-Gly-Leu-Pro-Tyr-Ser-His-Pro-Pro-Gln-Pro-Ser-OH; L-alanyl-L-prolyl-L-alanyl-L-histidyl-L-arginyl-glycyl-L-arginyl-glycyl-glycyl-L-tryptophyl-L-threonyl-L-leucyl-L-asparagyl-L-seryl-L-alanyl-glycyl-L-tyrosyl-L-leucyl-L-leucyl-glycyl-L-prolyl-L-valyl-L-leucyl-L-histidyl-L-leucyl-L-prolyl-L-glutaminyl-L-methionyl-glycyl-L-alpha-aspartyl-L-glutaminyl-L-alpha-aspartyl-glycyl-L-lysyl-L-arginyl-L-alpha-glutamyl-L-threonyl-L-alanyl-L-leucyl-L-alpha-glutamyl-L-isoleucyl-L-leucyl-L-alpha-aspartyl-L-leucyl-L-tryptophyl-L-lysyl-L-alanyl-L-isoleucyl-L-alpha-aspartyl-glycyl-L-leucyl-L-prolyl-L-tyrosyl-L-seryl-L-histidyl-L-prolyl-L-prolyl-L-glutaminyl-L-prolyl-L-serine. Grades: 95%. CAS No. 245114-99-2. Molecular formula: C292H451N83O84S. Mole weight: 6500.37. | |
| Galanin-Like Peptide (porcine) | Galanin-Like Peptide (porcine) is a GALR2 (galanin receptor)-binding neuropeptide isolated from porcine hypothalamus. It is an endogenous ligand that preferentially binds to GALR2 receptors and plays a role in regulating the effects of leptin, a satiety hormone. It is a potent vasoactive peptide and is thought to be involved in inflammatory responses. Alternative Names: GALP (porcine); H-Ala-Pro-Val-His-Arg-Gly-Arg-Gly-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Val-Leu-His-Pro-Pro-Ser-Arg-Ala-Glu-Gly-Gly-Gly-Lys-Gly-Lys-Thr-Ala-Leu-Gly-Ile-Leu-Asp-Leu-Trp-Lys-Ala-Ile-Asp-Gly-Leu-Pro-Tyr-Pro-Gln-Ser-Gln-Leu-Ala-Ser-OH. Grades: 95%. CAS No. 245114-96-9. Molecular formula: C281H443N81O78. Mole weight: 6204.02. | |
| Galanin-Like Peptide (rat) | Galanin-Like Peptide (GALP), a neuropeptide composed of 60 amino acids, was first isolated from the hypothalamus of pigs and later discovered in rats and humans. GALP shows a higher affinity (about 18-fold) for GALR2 receptors than GALR1 receptors, while galanin is relatively non-selective. GALP is an orexigenic and anxiogenic peptide that can affect the emotional state of the central nervous system. Alternative Names: GALP (rat); H-Ala-Pro-Ala-His-Arg-Gly-Arg-Gly-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Val-Leu-His-Leu-Ser-Ser-Lys-Ala-Asn-Gln-Gly-Arg-Lys-Thr-Asp-Ser-Ala-Leu-Glu-Ile-Leu-Asp-Leu-Trp-Lys-Ala-Ile-Asp-Gly-Leu-Pro-Tyr-Ser-Arg-Ser-Pro-Arg-Met-Thr-OH. Grades: 95%. CAS No. 245114-97-0. Molecular formula: C288H461N87O83S. Mole weight: 6502.32. | |
| Galanin Message Associated Peptide (1-41) amide | Galanin Message Associated Peptide (1-41) amide is a compound used in the research of neurological disorders. It acts as a modulator for galanin receptors, aiding in studying Alzheimer's disease, depression and epilepsy. Alternative Names: GMAP (1-41) amide; H-Glu-Leu-Glu-Pro-Glu-Asp-Glu-Ala-Arg-Pro-Gly-Gly-Phe-Asp-Arg-Leu-Gln-Ser-Glu-Asp-Lys-Ala-Ile-Arg-Thr-Ile-Met-Glu-Phe-Leu-Ala-Phe-Leu-His-Leu-Lys-Glu-Ala-Gly-Ala-Leu-NH2; Preprogalanin (65-105), amide. Grades: ≥95%. CAS No. 132699-74-2. Molecular formula: C206H326N56O64S. Mole weight: 4643.26. | |
| Galanin (porcine) | Galanin (porcine) is an endogenous porcine galanin receptor agonist (pKi = 9.63, 9.49, 9.02, 8.98, 8.01 and 8.14 at hGAL1, rGAL1, hGAL2, rGAL2, hGAL3 and rGAL3, respectively). It causes an increase in food intake under free access conditions and also plays roles in learning and memory, anxiety and sexual behavior. CAS No. 88813-36-9. Molecular formula: C146H213N43O40. Mole weight: 3210.55. | |
| Galantide | Galantide, a neuropeptide, is a reversible and non-specific galanin receptor antagonist. Galantide showed a more than 10-fold higher affinity to the galanin receptors than did galanin. Galantide was not only the very high-affinity ligand at pancreatic and Rin m 5F cell galanin receptors but it also acted as the first galanin antagonist. Alternative Names: Galanin (1-13)-Substance P (5-11) amide; H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2; glycyl-L-tryptophyl-L-threonyl-L-leucyl-L-asparagyl-L-seryl-L-alanyl-glycyl-L-tyrosyl-L-leucyl-L-leucyl-glycyl-L-prolyl-L-glutaminyl-L-glutaminyl-L-phenylalanyl-L-phenylalanyl-glycyl-L-leucyl-L-methioninamide. Grades: ≥95%. CAS No. 138579-66-5. Molecular formula: C104H151N25O26S. Mole weight: 2199.53. | |
| GALA, Pore-Forming Peptide | GALA, Pore-Forming Peptide is a 30-amino acid peptide that interacts with membranes in a pH-sensitive manner, which is designed for intracellular drug and gene delivery. Alternative Names: pore-forming peptide GALA; H-Trp-Glu-Ala-Ala-Leu-Ala-Glu-Ala-Leu-Ala-Glu-Ala-Leu-Ala-Glu-His-Leu-Ala-Glu-Ala-Leu-Ala-Glu-Ala-Leu-Glu-Ala-Leu-Ala-Ala-OH; L-tryptophyl-L-alpha-glutamyl-L-alanyl-L-alanyl-L-leucyl-L-alanyl-L-alpha-glutamyl-L-alanyl-L-leucyl-L-alanyl-L-alpha-glutamyl-L-alanyl-L-leucyl-L-alanyl-L-alpha-glutamyl-L-histidyl-L-leucyl-L-alanyl-L-alpha-glutamyl-L-alanyl-L-leucyl-L-alanyl-L-alpha-glutamyl-L-alanyl-L-leucyl-L-alpha-glutamyl-L-alanyl-L-leucyl-L-alanyl-L-alanine. Molecular formula: C136H215N33O45. Mole weight: 3032.7. | |
| Galensin | Galensin is produced by Kassina senegalensis. It has antibacterial activity against the Gram-positive bacterium M.luteus and the Gram-negative bacterium E.coli. | |
| Galleria defensin | Galleria defensin has antibacterial activity against the Gram-positive bacterium S.lutea (MIC=1.9 μM). Galleria defensin has antifungal activity against A.niger (MIC=2.9 μM), C.albicans (MIC=2.9 μM), C.fructus (MIC=2.9 μM), C.wickerhamii (MIC=2.9 μM), P.pastoris (MIC=2.9 μM), P.stiptis (MIC=2.9 μM), P.tannophilus (MIC=2.9 μM), T.harzianum (MIC=2.9 μM), and Z.marxianus (MIC=2.9 μM), but lacks antifungal activity against C.albidus, F.oxysporum, and S.cerevisiae. | |
| Gallerimycin | Gallerimycin is a novel antifungal insect defensin from the greater wax moth Galleria mellonella which confers resistance to pathogenic fungi in tobacco. | |
| Gallin | Gallin is a 41-residue protein, first identified as a minor component of hen egg white and found to be antimicrobial against Escherichia coli. Alternative Names: Gallin; 54750-05-9; Benzoic acid,2-(3,4,5,6-tetrahydroxy-9Hxanthen- 9-yl)-; DTXSID00203211; 9-(2'-Carboxyphenyl)-3,4,5,6-tetrahydroxyxanthene; 2-(3,4,5,6-tetrahydroxy-9h-xanthen-9-yl) benzoic acid. CAS No. 54750-05-9. Molecular formula: C20H14O7. Mole weight: 366.3. | |
| Gallinacin-1 | Gallinacin-1 has bactericidal activity. It has potent activity against E.coli ML-35, L.monocytogenes EGD and C.albicans. Alternative Names: Gal-1 alpha; Antimicrobial peptide CHP2. | |
Our database is helping our users find suppliers everyday.
