BOC Sciences provides a wide range of research chemicals and biochemicals including inhibitors, building blocks, GMP Products, impurities and metabolites, APIs for Veterinary, Natural Compounds, ADCs, Stem Cell Molecule and chiral compounds.
| Product | Description | |
|---|---|---|
| gp100 (154-162) | Gp100 (154-162) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Alternative Names: Melanocyte Protein PMEL 17 (154-162). |  |
| gp100 (17-25) | Gp100 (17-25) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Alternative Names: H-Ala-Leu-Leu-Ala-Val-Gly-Ala-Thr-Lys-OH; Melanocyte Protein PMEL 17 (17-25). Grades: >95%. CAS No. 184297-65-2. Molecular formula: C38H70N10O11. Mole weight: 843.02. | |
| gp100 (174-190) | Gp100 (174-190) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Alternative Names: Melanocyte Protein PMEL 17 (174-190). | |
| gp100 (175-189) | Gp100 (175-189) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Alternative Names: Melanocyte Protein PMEL 17 (175-189). | |
| gp100 (177(8)-186) | Gp100 (177(8)-186) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Alternative Names: Melanocyte Protein PMEL 17 (177(8)-186). | |
| gp100 (182-191) | Gp100 (182-191) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Alternative Names: Melanocyte Protein PMEL 17 (182-191). | |
| Gp100 (25-33) (human) | Gp100 (25-33) is an amino acid fragment of human melanoma antigen. Grades: >98%. CAS No. 212370-40-6. Molecular formula: C52H82N16O14. Mole weight: 1155.31. | |
| Gp100 (25-33), mouse | Gp100 (25-33) is a tumor antigen glycoprotein fragment. CAS No. 212370-36-0. Molecular formula: C46H69N15O17. Mole weight: 1104.13. | |
| gp100 (420-437) | Gp100 (420-437) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Alternative Names: Melanocyte Protein PMEL 17 (420-437). | |
| gp100 (457-466) | Gp100 (457-466) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Alternative Names: Melanocyte Protein PMEL 17 (457-466). | |
| gp100 (471-480) | Gp100 (471-480) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Alternative Names: Melanocyte Protein PMEL 17 (471-480). | |
| gp100 (476-485) | Gp100 (476-485) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Alternative Names: Melanocyte Protein PMEL 17 (476-485). Mole weight: 1190.4000000000001. | |
| gp100 (529-537) | Gp100 (529-537) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Alternative Names: Melanocyte Protein PMEL 17 (529-537). | |
| gp100 (570-579) | Gp100 (570-579) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Alternative Names: Melanocyte Protein PMEL 17 (570-579). | |
| gp100 (614-622) | Gp100 (614-622) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Alternative Names: Melanocyte Protein PMEL 17 (614-622). | |
| gp100 (619-627) | Gp100 (619-627) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Alternative Names: Melanocyte Protein PMEL 17 (619-627). | |
| Gp100 619-627 | Gp100 619-627 is the 619-627 amino acid fragment of human melanoma antigen glycoprotein 100 (GP100). GP100 has been widely studied as a target for melanoma immunotherapy. Alternative Names: L-Valine, L-arginyl-L-leucyl-L-methionyl-L-lysyl-L-glutaminyl-L-α-aspartyl-L-phenylalanyl-L-seryl-; Arg-Leu-Met-Lys-Gln-Asp-Phe-Ser-Val. Grades: ≥95%. CAS No. 187987-68-4. Molecular formula: C49H82N14O14S. Mole weight: 1123.33. | |
| gp100 (630-638) | Gp100 (630-638) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Alternative Names: Melanocyte Protein PMEL 17 (630-638). | |
| gp100 (639-647) | Gp100 (639-647) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Alternative Names: Melanocyte Protein PMEL 17 (639-647). | |
| gp100 (71-78) | Gp100 (71-78) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Alternative Names: Melanocyte Protein PMEL 17 (71-78). | |
| gp100 (86-95) | Gp100 (86-95) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Alternative Names: Melanocyte Protein PMEL 17 (86-95). | |
| gp100 (87-95) | Gp100 (87-95) is a peptide derived from Melanocyte Protein PMEL 17, a 100 kDa type I transmembrane glycoprotein that is expressed primarily in pigment cells of the skin and eye. Alternative Names: Melanocyte Protein PMEL 17 (87-95). | |
| GP (33-41) | GP(33-41), a 9-aa-long peptide, is the optimal sequence of the GP1 epitope of lymphocytic choriomeningitis virus. Alternative Names: H-Lys-Ala-Val-Tyr-Asn-Phe-Ala-Thr-Cys-OH; L-lysyl-L-alanyl-L-valyl-L-tyrosyl-L-asparaginyl-L-phenylalanyl-L-alanyl-L-threonyl-L-cysteine. Grades: ≥95%. CAS No. 161928-86-5. Molecular formula: C46H69N11O13S. Mole weight: 1016.18. | |
| gp91 ds-tat | gp91 ds-tat is composed of gp91phox sequence linked to the human immunodeficiency virus-tat peptide. It acts as a NADPH oxidase inhibitor. Alternative Names: H-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Cys-Ser-Thr-Arg-Ile-Arg-Arg-Gln-Leu-NH2. CAS No. 329902-61-6. Molecular formula: C98H190N50O22S. Mole weight: 2452.94. | |
| GPLGIAGQ | GPLGIAGQ, is an MMP2-cleaved polypeptide that is used as a stimulus-sensitive connector in both liposomes and micelle nanoceroses for targeted therapy of tumors triggered by MMP2. Alternative Names: L-Glutamine, glycyl-L-prolyl-L-leucylglycyl-L-isoleucyl-L-alanylglycyl-; Gly-Pro-Leu-Gly-Ile-Ala-Gly-Gln. Grades: ≥97% by HPLC. CAS No. 109053-09-0. Molecular formula: C31H53N9O10. Mole weight: 711.81. | |
| G-Protein antagonist peptide | G-Protein antagonist peptide is a competitive and reversible inhibitor of M2 muscarinic cholinergic receptors. G-Protein antagonist peptide inhibits M2 muscarinic receptor activation of Gi or Go and suppresses Gs activation by β-adrenoceptors. Alternative Names: GPAnt-2; G Protein Antagonist. Grades: >98%. CAS No. 143675-79-0. Molecular formula: C57H64N12O9S. Mole weight: 1093.27. | |
| G-protein coupled receptor 143 (126-134) | G-protein coupled receptor 143 (126-134) is a 9-aa peptide. G-protein coupled receptor 143 is a receptor for tyrosine, L-DOPA and dopamine. Its activity is mediated by G proteins which activate the phosphoinositide signaling pathway. Alternative Names: Ocular albinism type 1 protein (126-134). | |
| GPRP | GPRP is an inhibitor of fibrin polymerization. It binds to fibrinogen (Ki = 400 mM). Alternative Names: Gly-pro-arg-pro; L-Proline,glycyl-L-prolyl-L-arginyl-; (S)-1-((S)-2-((S)-1-(2-aminoacetyl)pyrrolidine-2-carboxamido)-5-guanidinopentanoyl)pyrrolidine-2-carboxylic acid. CAS No. 67869-62-9. Molecular formula: C18H31N7O5. Mole weight: 425.48. | |
| GPRP acetate | GPRP acetate, a fibrinogen-related peptide, inhibits the interaction of fibrinogen with the platelet membrane glycoprotein IIb / IIIa complex (GPIIb / IIIa). Alternative Names: Pefa 6003; Pefabloc FG; GPRP.CH3CO2H; glycyl-L-prolyl-L-arginyl-L-proline acetic acid; (S)-1-((S)-2-((S)-1-(2-aminoacetyl)pyrrolidine-2-carboxamido)-5-guanidinopentanoyl)pyrrolidine-2-carboxylic acid acetate; H-Gly-Pro-Arg-Pro-OH acetate. Grades: ≥95%. CAS No. 157009-81-9. Molecular formula: C18H31N7O5.C2H4O2. Mole weight: 485.53. | |
| GR 231118 | GR 231118 is a potent neuropeptide Y (NPY) Y1 receptor antagonist (pA2 = 10 and 10.5 at rY1 and hY1 receptors, respectively) and an NPY Y4 receptor agonist (pEC50 = 6.0, 8.6 and 6.1 for rY2, hY4 and rY5 receptors, respectively). GR 231118 inhibits food intake in rats in vivo. Alternative Names: GR-231118; GR 231118; GR231118. Grades: >99%. CAS No. 158859-98-4. Molecular formula: C110H170N34O24. Mole weight: 2352.77. | |
| GR 64349 | GR 64349 is a potent and selective agonist of tachykinin NK2 receptor (EC50 = 3.7 nM in rat colon). Alternative Names: GR 64349; GR64349; GR-64349; LYS-ASP-SER-PHE-VAL-GLY-R-GAMMA-LACTAM-LEU-MET-NH2; [LYS3, GLY8-R-GAMMA-LACTAM-LEU9]NEUROKININ A (3-10); L-Lys-L-Asp-L-Ser-L-Phe-L-Val-N-[(3R)-1-[(R)-1-[[[(S)-1-(Aminocarbonyl)-3-(methylthio)propyl]amino]carbonyl]-3-methylbutyl]-2-oxo-3α-pyrrolidi. Grades: >98%. CAS No. 137593-52-3. Molecular formula: C42H68N10O11S. Mole weight: 921.12. | |
| GR 73632 | GR 73632 is a potent and selective tachykinin NK1 receptor agonist (EC50 = 2 nM in guinea pig vas deferens). GR 73632 is able to be used in the treatment of asthma and gastrointestinal disorders. Alternative Names: GR-73632; GR 73632; GR73632. Delta-Aminovaleryl-9-pro-10-meleu-substance P (7-10); Substance P (7-10), delta-aminovaleryl-pro(9)-N-meleu(10)-; Substance P (7-10), delta-aminovaleryl-prolyl(9)-N-methylleucine(10)-. CAS No. 133156-06-6. Molecular formula: C40H59N7O6S. Mole weight: 766.01. | |
| GR 82334 | GR 82334 is a tachykinin NK1 receptor antagonist. Alternative Names: GR-82334; GR 82334; GR82334; Physalaemin(1-11), D-pro(9)(spiro-gamma-lactam)leu(10)-trp(11)-; Physalemin, 9-deglycine-10-((5S)-6-oxo-L-alpha-(2-methylpropyl)-1,7-diazaspiro(4.4)nonane-7-acetic acid)-11-L-tryptophanamide-. Grades: >98%. CAS No. 129623-01-4. Molecular formula: C69H91N15O16. Mole weight: 1386.57. | |
| GR 94800 | GR 94800 is a potent and selective tachykinin NK2 receptor antagonist (pKB = 9.6, 6.4 and 6.0 for NK2, NK1 and NK3 receptors, respectively). Alternative Names: N-Benzoyl-L-alanyl-L-alanyl-D-tryptophyl-L-phenylalanyl-D-prolyl-L-prolyl-L-norleucinamide. Grades: >98%. CAS No. 141636-65-9. Molecular formula: C49H61N9O8. Mole weight: 904.08. | |
| Gramicidin A | It is produced by the strain of Bacillus brevis. It mainly has anti-gram-positive bacterial activity, and also has effects on Naisseria. LD50 is 0.017 mg/kg (mice, intravenous injection). Alternative Names: Valinegramicidin A; Valyl gramicidin A; 1-L-Valinegramicidin A; L-Tryptophanamide, N-formyl-L-valylglycyl-L-alanyl-D-leucyl-L-alanyl-D-valyl-L-valyl-D-valyl-L-tryptophyl-D-leucyl-L-tryptophyl-D-leucyl-L-tryptophyl-D-leucyl-N-(2-hydroxyethyl)-. Grades: ≥90%. CAS No. 11029-61-1. Molecular formula: C99H140N20O17. Mole weight: 1882.29. | |
| Gramicidin B | Gramicidin B is a part of the collective Gramicidin D that is an antibiotic obtained from a soil microbe-Bacillus brevis. Molecular formula: C97H139N19O17. Mole weight: 1843.25. | |
| Gramicidin C | Gramicidin C is a naturally occuring polypeptide antibiotic isolated from B. brevis var. G.B. Alternative Names: Gramicidin C; NCGC00095992-01; Spectrum_000833; Spectrum2_001076; Spectrum3_001749; Spectrum4_000106; Spectrum5_001779; BSPBio_003458; KBioGR_000432; KBioSS_001313; SPECTRUM1500319; SPBio_001092; KBio2_001313; KBio2_003881; KBio2_006449; KBio3_002678; HMS2091H19; Pharmakon1600-01500319; CCG-39758; NSC757043; STK177209; AKOS005410749; NSC-757043; NCGC00095992-02; SBI-0051395.P003; FT-0775150; G05080; cyclo(leucylphenylalanylprolylvalylornithylleucylphenylalanylprolylvalylornithyl). Grades: >90% by HPLC. CAS No. 9062-61-7. Molecular formula: C60H92N12O10. Mole weight: 1141.4. | |
| Grammistin GsA | Grammistin GsA has antibacterial activity. The source of Grammistin GsA is Grammistes sexlineatus [Sixline soapfish]. Grades: >95% by HPLC. | |
| Grammistin Gs B | Grammistin Gs B has antibacterial activity with a broad spectrum against various species of bacteria including both Gram-positive and Gram-negative groups. | |
| Grammistin GsC | Grammistins Gs C exhibited antibacterial activity with a broad spectrum against nine species of bacteria in common with the other grammistins but had no hemolytic activity differing from the other grammistins. | |
| Grammistin GsE | Grammistin GsE is isolated from Grammistes sexlineatus and has antibacterial activity. | |
| Grammistin GsF | Grammistin GsF has antibacterial activity with a broad spectrum against various species of bacteria including both Gram-positive and Gram-negative groups. It also has ichthyotoxic activity. Grades: >98% by HPLC. Molecular formula: C130H210N36O32. Mole weight: 2789.27. | |
| Grammistin Pp2a | Grammistin Pp2a has antibacterial activity. The source of Grammistin Pp2a is Pogonoperca punctata [Clown grouper]. Alternative Names: Grammistin Pp2a. Grades: >95% by HPLC. Molecular formula: C73H122N16O14. Mole weight: 1447.84. | |
| Grammistin Pp3 | Grammistin Pp3 has antibacterial activity. The source of Grammistin Pp3 is Pogonoperca punctata [Clown grouper]. Grades: >95% by HPLC. Molecular formula: C118H192N32O33. Mole weight: 2586.97. | |
| Grammistin Pp4a | Grammistin Pp4a with both hemolytic and ichthyotoxic activities is isolated from the skin secretion of the soapfish Pogonoperca punctata. | |
| Grammistin Pp4b | Grammistin Pp4b with both hemolytic and ichthyotoxic activities is isolated from the skin secretion of the soapfish Pogonoperca punctata by gel filtration and reverse-phase high performance liquid chromatography. | |
| Granulosusin-C1 antimicrobial peptide precursor | Granulosusin-C1 antimicrobial peptide precursor is isolated from Amolops granulosus. | |
| Granulosusin-D1 antimicrobial peptide precursor | Granulosusin-D1 antimicrobial peptide precursor is isolated from Amolops granulosus. | |
| Granulosusin-D2 antimicrobial peptide precursor | Granulosusin-D2 antimicrobial peptide precursor is isolated from Amolops granulosus. | |
| Granulosusin-E1 antimicrobial peptide precursor | Granulosusin-E1 antimicrobial peptide precursor was found in Amolops granulosus. Grades: >97% by HPLC. | |
| Gratisin analogue | Gratisin analogue is a novel polycationic analogue of Gratisin with antibiotic activity against both Gram-positive and Gram-negative bacteria. | |
| GRF (1-29) amide (rat) | GRF (1-29) amide (rat). Alternative Names: H-His-Ala-Asp-Ala-Ile-Phe-Thr-Ser-Ser-Tyr-Arg-Arg-Ile-Leu-Gly-Gln-Leu-Tyr-Ala-Arg-Lys-Leu-Leu-His-Glu-Ile-Met-Asn-Arg-NH2. Grades: 95%. CAS No. 91826-20-9. Molecular formula: C155H251N49O40S. Mole weight: 3473.02. | |
| GRGDS acetate | GRGDS acetate, a synthetic integrin antagonist, is a cell-binding protein domain derived from the cell-binding region of fibronectin. Alternative Names: Gly-Arg-Gly-Asp-SerGRGDS acetate; H-Gly-Arg-Gly-Asp-Ser-OH.CH3CO2H; GRGDS.CH3CO2H; glycyl-L-arginyl-glycyl-L-alpha-aspartyl-L-serine acetate. Grades: ≥95%. Molecular formula: C19H34N8O11. Mole weight: 550.52. | |
| GRGDSP acetate | GRGDSP acetate, a synthetic linear RGD peptide, is an integrin inhibitor that can be used to modify the surface of cardiovascular implants such as vascular grafts to promote endothelialization. Alternative Names: H-Gly-Arg-Gly-Asp-Ser-Pro-OH.CH3CO2H; Glycyl-L-arginylglycyl-L-α-aspartyl-L-seryl-L-proline acetic acid; L-Proline, 1-[N-[N-[N-(N2-glycyl-L-arginyl)glycyl]-L-α-aspartyl]-L-seryl]-, acetate. Grades: ≥95%. Molecular formula: C24H41N9O12. Mole weight: 647.64. | |
| GRGDSPC | GRGDSPC, a 7-amino acid peptide, is a thiolated cell adhesion peptide. Alternative Names: H-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH; glycyl-L-arginyl-glycyl-L-alpha-aspartyl-L-seryl-L-prolyl-L-cysteine; (S)-3-(2-((S)-2-(2-aminoacetamido)-5-guanidinopentanamido)acetamido)-4-((S)-1-((S)-2-((R)-1-carboxy-2-mercaptoethylcarbamoyl)pyrrolidin-1-yl)-3-hydroxy-1-oxopropan-2-ylamino)-4-oxobutanoic acid. Grades: 95%. CAS No. 91575-26-7. Molecular formula: C25H42N10O11S. Mole weight: 690.73. | |
| GRGDSPK | GRGDSPK is a competitive and reversible inhibitory peptide for RGD-mediated adhesion between integrin and extracellular matrix molecules. Alternative Names: EMD 56574; H-Gly-Arg-Gly-Asp-Ser-Pro-Lys-OH; glycyl-L-arginyl-glycyl-L-alpha-aspartyl-L-seryl-L-prolyl-L-lysine; N2-(1-(N-(N-(N-(N2-Glycyl-L-arginyl)glycyl)-L-alpha-aspartyl)-L-seryl)-L-prolyl)-L-lysine. Grades: 95%. CAS No. 111119-28-9. Molecular formula: C28H49N11O11. Mole weight: 715.76. | |
| GRGDSP TFA | GRGDSP TFA, a synthetic linear RGD peptide, is an integrin inhibitor which can be used to modify the surface of cardiovascular implants such as vascular grafts to promote endothelialization. Alternative Names: H-Gly-Arg-Gly-Asp-Ser-Pro-OH.TFA; glycyl-L-arginyl-glycyl-L-alpha-aspartyl-L-seryl-L-proline trifluoroacetic acid. Grades: ≥98%. Molecular formula: C22H37N9O10.C2HF3O2. Mole weight: 701.61. | |
| GRGDTP | GRGDTP. Alternative Names: Gly-Arg-Gly-Asp-Thr-Pro. Grades: 95%. CAS No. 108682-58-2. Molecular formula: C23H39N9O10. Mole weight: 601.61. | |
| GRK2i | GRK2i is a polypeptide inhibitor of GRK2 that specifically inhibits Gβγ activation of GRK2. GRK2i corresponds to the Gβγ-binding domain and acts as a cellular Gβγ antagonist. Grades: >98%. CAS No. 148505-03-7. Molecular formula: C153H256N50O41S. Mole weight: 3484.08. | |
| GroES mobile loop | GroES mobile loop is a highly flexible free GroES region that binds to GroES via residues at the tip of the loop. Alternative Names: Glu-Thr-Lys-Ser-Ala-Gly-Gly-Ile-Val-Leu-Thr-Gly-Ser. Grades: ≥95%. Molecular formula: C51H90N14O20. Mole weight: 1219.36. | |
| Growth arrest-specific protein 7 (281-290) | Growth arrest-specific protein 7 (281-290) is a peptide derived from Growth arrest-specific protein 7. Growth arrest-specific protein 7 plays a role in promoting maturation and morphological differentiation of cerebellar neurons. Alternative Names: GAS-7 (281-290). | |
| GRP (14-27) (human, porcine, canine) | GRP (14-27) (human, porcine, canine). Alternative Names: C-Terminal peptide bombesin; Gastrin releasing peptide (14-27); H-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2. CAS No. 81608-29-9. Molecular formula: C75H110N24O16S2. Mole weight: 1667.98. | |
| GRPP (human) | GRPP (human) is a synthetic analogue of a cleavage product resulting from proglucagon processing in pancreatic α- and intestinal L-cells. Alternative Names: Preproglucagon (21-50) (human); H-Arg-Ser-Leu-Gln-Asp-Thr-Glu-Glu-Lys-Ser-Arg-Ser-Phe-Ser-Ala-Ser-Gln-Ala-Asp-Pro-Leu-Ser-Asp-Pro-Asp-Gln-Met-Asn-Glu-Asp-OH; glicentin-related polypeptide (human); L-arginyl-L-seryl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-threonyl-L-alpha-glutamyl-L-alpha-glutamyl-L-lysyl-L-seryl-L-arginyl-L-seryl-L-phenylalanyl-L-seryl-L-alanyl-L-seryl-L-glutaminyl-L-alanyl-L-alpha-aspartyl-L-prolyl-L-leucyl-L-seryl-L-alpha-aspartyl-L-prolyl-L-alpha-aspartyl-L-glutaminyl-L-methionyl-L-asparagyl-L-alpha-glutamyl-L-aspartic acid. Grades: ≥95%. CAS No. 1132745-52-8. Molecular formula: C136H215N41O58S. Mole weight: 3384.47. | |
| GRPSp | GRPSp was found in the mud crab Scylla paramamosain. It is active against Gram-positive A. viridans, M. Luteus, (MIC=6-25 μg/ml). Grades: >97% by HPLC. | |
| GsMTx4 | GsMTx4 is a mechanosensitive and stretch-activated ion channel inhibitor. It is used as a tool for identifying the role of these excitatory MSCs in normal physiology and pathology. Grades: >98%. CAS No. 1209500-46-8. Molecular formula: C185H273N49O45S6. Mole weight: 4095.86. | |
| GsMTx4 TFA | GsMTx4 is a TRPC1 and TRPC6 blocker, and also blocks stretch-activated cation channels in astrocytes, cardiac cells, and skeletal muscle cells. Alternative Names: H-Gly-Cys-Leu-Glu-Phe-Trp-Trp-Lys-Cys-Asn-Pro-Asn-Asp-Asp-Lys-Cys-Cys-Arg-Pro-Lys-Leu-Lys-Cys-Ser-Lys-Leu-Phe-Lys-Leu-Cys-Asn-Phe-Ser-Phe-OH.TFA; glycyl-L-cysteinyl-L-leucyl-L-alpha-glutamyl-L-phenylalanyl-L-tryptophyl-L-tryptophyl-L-lysyl-L-cysteinyl-L-asparagyl-L-prolyl-L-asparagyl-L-alpha-aspartyl-L-alpha-aspartyl-L-lysyl-L-cysteinyl-L-cysteinyl-L-arginyl-L-prolyl-L-lysyl-L-leucyl-L-lysyl-L-cysteinyl-L-seryl-L-lysyl-L-leucyl-L-phenylalanyl-L-lysyl-L-leucyl-L-cysteinyl-L-asparagyl-L-phenylalanyl-L-seryl-L-phenylalanine trifluoroacetic acid. Molecular formula: C185H278N48O46S6. Mole weight: 4103. | |
| GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | It is a derivative of Exendin-4 peptide. Alternative Names: Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser. Grades: ≥95%. Molecular formula: C170H262N44O56S. Mole weight: 3850.28. | |
| GTPase KRas (7-15) | GTPase KRas (7-15) is a 9-aa peptide. The K-Ras protein is a GTPase, which means it converts a molecule called GTP into another molecule called GDP. In this way the K-Ras protein acts like a switch that is turned on and off by the GTP and GDP molecules. Alternative Names: K-Ras 2 (7-15). | |
| GTPase NRas (55-64) | GTPase NRas (55-64) is a bioactive peptide of GTPase NRas. Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Alternative Names: Transforming protein N-Ras (55-64). | |
| Guanylin (human) | Guanylin (human) secreted by the gastrointestinal mucosa is an endogenous peptide activator of intestinal guanylyl cyclase. It modulates water and electrolyte transport in intestinal and renal epithelia. Alternative Names: L-prolyl-glycyl-L-threonyl-L-cysteinyl-L-alpha-glutamyl-L-isoleucyl-L-cysteinyl-L-alanyl-L-tyrosyl-L-alanyl-L-alanyl-L-cysteinyl-L-threonyl-glycyl-L-cysteine (4->12),(7->15)-bis(disulfide); H-Pro-Gly-Thr-Cys-Glu-Ile-Cys-Ala-Tyr-Ala-Ala-Cys-Thr-Gly-Cys-OH (Disulfide bridge: Cys4-Cys12, Cys7-Cys15). Grades: ≥95%. CAS No. 183200-12-6. Molecular formula: C58H87N15O21S4. Mole weight: 1458.65. | |
Our database is helping our users find suppliers everyday.
