BOC Sciences provides a wide range of research chemicals and biochemicals including inhibitors, building blocks, GMP Products, impurities and metabolites, APIs for Veterinary, Natural Compounds, ADCs, Stem Cell Molecule and chiral compounds.
| Product | Description | |
|---|---|---|
| Maculatin 1.2 | Maculatin 1.2, which has two more residues at its C-terminus than maculatin 1.1, has markedly reduced activity compared with maculatin 1.1. |  |
| Maculatin 1.3 | The peptide is HIV inhibitory (EC50=4 μM). The source of Maculatin 1.3 is Litoria eucnemis, Australia area. Grades: >96% by HPLC. Molecular formula: C98H160N26O23. Mole weight: 2070.47. | |
| Maculatin 1.4 | Maculatin 1.4 has antimicrobial activity. Maculatin 1.4 was found in Litoria eucnemis, Australia. Grades: >98% by HPLC. Molecular formula: C98H167N27O25. Mole weight: 2123.53. | |
| Maculatin 2.1 | Maculatin 2.1 was found in Litoria genimaculate, Litoria eucnemis, Australia. Maculatin 2.1 shows antibacterial activity against B.cereus, L.innocua, M.luteus, S.aureus, S.epidermidis and S.uberis. Grades: >95% by HPLC. Molecular formula: C88H143N21O24. Mole weight: 1879.20. | |
| Maculatin 3.1 | Maculatin 3.1 was found in Litoria genimaculate, Australia. Maculatin 3.1 shows antibacterial activity against S.uberis. Grades: >95% by HPLC. Molecular formula: C121H214N32O38. Mole weight: 2725.18. | |
| MAG 3 | MAG 3. Alternative Names: Mertiatide; Technescan mag3; 99mTc-MAG3; Technescan MAG3; Technetium 99m MAG3. Grades: 95%. CAS No. 66516-09-4. Molecular formula: C8H13N3O5S. Mole weight: 263.27. | |
| Magainin 1 acetate | Magainin 1 acetate is a peptide antibiotic with antibacterial and antiparasitic activities, originally extracted from the skin of Xenopus laevis. It has a broad spectrum of non-specific activity against a variety of microorganisms, including viruses, gram-positive and gram-negative bacteria, protozoa, yeast and fungi, and may also have hemolytic and cytotoxicity to cancer cells. Magainin 1 is a fungicide. Magainin 1 has an inhibitory effect on herpes simplex virus type 1 (HSV-1) and HSV-2. Alternative Names: Magainin I acetate; Magainin 1 (Xenopus laevis laevis) acetate; Magainin 1 (Xenopus laevis sudanensis) acetate; Magainin 1 (Xenopus laevis victorianus) acetate; Magainin 1 (Xenopus petersII) acetate; Magainin-I peptide acetate; H-Gly-Ile-Gly-Lys-Phe-Leu-His-Ser-Ala-Gly-Lys-Phe-Gly-Lys-Ala-Phe-Val-Gly-Glu-Ile-Met-Lys-Ser-OH.CH3CO2H; glycyl-L-isoleucyl-glycyl-L-lysyl-L-phenylalanyl-L-leucyl-L-histidyl-L-seryl-L-alanyl-glycyl-L-lysyl-L-phenylalanyl-glycyl-L-lysyl-L-alanyl-L-phenylalanyl-L-valyl-glycyl-L-alpha-glutamyl-L-isoleucyl-L-methionyl-L-lysyl-L-serine acetate. Grades: ≥95%. Molecular formula: C114H181N29O30S. Mole weight: 2469.90. | |
| Magainin-AM2 | Magainin-AM2, an amphibian host-defense peptide, stimulates insulin- and glucagon-like peptide-1-release in vitro. | |
| Magainin-St1 | Magainin-St1 is isolated from the African clawed frog Silurana tropicalis and has anti Gram-positive and Gram-negative activities. | |
| MAGE-10 (254-262) | MAGE-10 (254-262) is a peptide derived from MAGE-10. MAGE-10 is a highly immunogenic member of the MAGE-A family of cancer / testis tumor-associated antigens (C/T TAAs). MAGE-10 is frequently expressed in high percentages of tumor cells in lung, skin and urothelial malignancies. Alternative Names: Cancer / testis antigen 1.10 (254-262); MAGE-10 antigen (254-262); Melanoma-associated antigen 10 (254-262). | |
| MAGE-10 (290-298) | MAGE-10 (290-298) is a peptide derived from MAGE-10. MAGE-10 is a highly immunogenic member of the MAGE-A family of cancer / testis tumor-associated antigens (C/T TAAs). MAGE-10 is frequently expressed in high percentages of tumor cells in lung, skin and urothelial malignancies. Alternative Names: Cancer / testis antigen 1.10 (290-298); MAGE-10 antigen (290-298); Melanoma-associated antigen 10 (290-298). | |
| MAGE-1 (102-112) | MAGE-1 (102-112) is a truncated fragment of MAGE-1 which is a gene that encodes an antigen on a melanoma cell line. MAGE-1 is expressed by melanoma tissue from all stages of disease, but not melanocytes, nevus tissue, or any normal diploid cell line tested. Alternative Names: Melanoma-associated antigen 1 (102-112); MAGEA1 (102-112). | |
| MAGE-12 (114-127) | MAGE-12 (114-127) is a bioactive peptide of MAGE-12 which is frequently expressed in malignant melanoma. Alternative Names: Melanoma-associated antigen 12 (114-127); Cancer / testis antigen 1.12 (114-127). | |
| MAGE-12 (127-141) | MAGE-12 (127-141) is a bioactive peptide of MAGE-12 which is frequently expressed in malignant melanoma. Alternative Names: Melanoma-associated antigen 12 (127-141); Cancer / testis antigen 1.12 (127-141). | |
| MAGE-12 (170-178) | MAGE-12 (170-178) is a bioactive peptide of MAGE-12 which is frequently expressed in malignant melanoma. Alternative Names: Melanoma-associated antigen 12 (170-178); Cancer / testis antigen 1.12 (170-178). | |
| MAGE-1 (222-231) | MAGE-1 (222-231) is a truncated fragment of MAGE-1 which is a gene that encodes an antigen on a melanoma cell line. MAGE-1 is expressed by melanoma tissue from all stages of disease, but not melanocytes, nevus tissue, or any normal diploid cell line tested. Alternative Names: Melanoma-associated antigen 1 (222-231); MAGEA1 (222-231). | |
| MAGE-1 (230-238) | MAGE-1 (230-238) is a truncated fragment of MAGE-1 which is a gene that encodes an antigen on a melanoma cell line. MAGE-1 is expressed by melanoma tissue from all stages of disease, but not melanocytes, nevus tissue, or any normal diploid cell line tested. Alternative Names: Melanoma-associated antigen 1 (230-238); MAGEA1 (230-238). | |
| MAGE-1 (268-282) | MAGE-1 (268-282) is a truncated fragment of MAGE-1 which is a gene that encodes an antigen on a melanoma cell line. MAGE-1 is expressed by melanoma tissue from all stages of disease, but not melanocytes, nevus tissue, or any normal diploid cell line tested. Alternative Names: Melanoma-associated antigen 1 (268-282); MAGEA1 (268-282). | |
| MAGE-1 (278-286) | MAGE-1 (278-286) is a truncated fragment of MAGE-1 which is a gene that encodes an antigen on a melanoma cell line. MAGE-1 is expressed by melanoma tissue from all stages of disease, but not melanocytes, nevus tissue, or any normal diploid cell line tested. Alternative Names: Melanoma-associated antigen 1 (278-286); MAGEA1 (278-286). | |
| MAGE-1 (281-292) | MAGE-1 (281-292) is a truncated fragment of MAGE-1 which is a gene that encodes an antigen on a melanoma cell line. MAGE-1 is expressed by melanoma tissue from all stages of disease, but not melanocytes, nevus tissue, or any normal diploid cell line tested. Alternative Names: Melanoma-associated antigen 1 (281-292); MAGEA1 (281-292). | |
| MAGE-1 (289-298) | MAGE-1 (289-298) is a truncated fragment of MAGE-1 which is a gene that encodes an antigen on a melanoma cell line. MAGE-1 is expressed by melanoma tissue from all stages of disease, but not melanocytes, nevus tissue, or any normal diploid cell line tested. Alternative Names: Melanoma-associated antigen 1 (289-298); MAGEA1 (289-298). | |
| MAGE-1 (62-70) | MAGE-1 (62-70) is a truncated fragment of MAGE-1 which is a gene that encodes an antigen on a melanoma cell line. MAGE-1 is expressed by melanoma tissue from all stages of disease, but not melanocytes, nevus tissue, or any normal diploid cell line tested. Alternative Names: Melanoma-associated antigen 1 (62-70); MAGEA1 (62-70). | |
| MAGE-1 (90-104) | MAGE-1 (90-104) is a truncated fragment of MAGE-1 which is a gene that encodes an antigen on a melanoma cell line. MAGE-1 is expressed by melanoma tissue from all stages of disease, but not melanocytes, nevus tissue, or any normal diploid cell line tested. Alternative Names: Melanoma-associated antigen 1 (90-104); MAGEA1 (90-104). | |
| MAGE-1 (96-104) | MAGE-1 (96-104) is a truncated fragment of MAGE-1 which is a gene that encodes an antigen on a melanoma cell line. MAGE-1 is expressed by melanoma tissue from all stages of disease, but not melanocytes, nevus tissue, or any normal diploid cell line tested. Alternative Names: Melanoma-associated antigen 1 (96-104); MAGEA1 (96-104). | |
| MAGE-1 Antigen (161-169) (human) | MAGE-1 Antigen (161-169) (human) is a truncated fragment of MAGE-1 which is a gene that encodes an antigen on a melanoma cell line. MAGE-1 is expressed by melanoma tissue from all stages of disease, but not melanocytes, nevus tissue, or any normal diploid cell line tested. Alternative Names: Glu-Ala-Asp-Pro-Thr-Gly-His-Ser-Tyr; H2N-EADPTGHSY-OH; Melanoma-associated antigen 1 (161-169). CAS No. 144449-86-5. Molecular formula: C41H57N11O17. Mole weight: 975.95. | |
| MAGE-2 (127-136) | MAGE-2 is an antigen recognized on a melanoma by autologous cytolytic T-lymphocytes. It reduces p53/TP53 transactivation function through recruitment of HDAC3 to p53/TP53 transcription sites. Alternative Names: Melanoma-associated antigen 2 (127-136); MAGEA2 (127-136); Cancer / testis antigen 1.2 (127-136). | |
| MAGE-2 (156-164) | MAGE-2 is an antigen recognized on a melanoma by autologous cytolytic T-lymphocytes. It reduces p53/TP53 transactivation function through recruitment of HDAC3 to p53/TP53 transcription sites. Alternative Names: Melanoma-associated antigen 2 (156-164); MAGEA2 (156-164); Cancer / testis antigen 1.2 (156-164). | |
| MAGE-2 (157-166) | MAGE-2 is an antigen recognized on a melanoma by autologous cytolytic T-lymphocytes. It reduces p53/TP53 transactivation function through recruitment of HDAC3 to p53/TP53 transcription sites. Alternative Names: Melanoma-associated antigen 2 (157-166); MAGEA2 (157-166); Cancer / testis antigen 1.2 (157-166). | |
| MAGE-2 (212-220) | MAGE-2 is an antigen recognized on a melanoma by autologous cytolytic T-lymphocytes. It reduces p53/TP53 transactivation function through recruitment of HDAC3 to p53/TP53 transcription sites. Alternative Names: Melanoma-associated antigen 2 (212-220); MAGEA2 (212-220); Cancer / testis antigen 1.2 (212-220). | |
| MAGE-3 (111-125) | A peptide fragment of MAGE-3. Melanoma-associated antigen 3 (MAGE-A3) protein is a member of cancer-testis antigens (CTAs), and has been identified on many tumors including melanoma, non-small cell lung cancer, hematologic malignancies, among others. Alternative Names: Melanoma-associated antigen 3 (111-125); MAGE-A3 (111-125). | |
| MAGE-3 (111-126) | A peptide fragment of MAGE-3. Melanoma-associated antigen 3 (MAGE-A3) protein is a member of cancer-testis antigens (CTAs), and has been identified on many tumors including melanoma, non-small cell lung cancer, hematologic malignancies, among others. Alternative Names: Melanoma-associated antigen 3 (111-126); MAGE-A3 (111-126). | |
| MAGE-3 (112-120) | A peptide fragment of MAGE-3. Melanoma-associated antigen 3 (MAGE-A3) protein is a member of cancer-testis antigens (CTAs), and has been identified on many tumors including melanoma, non-small cell lung cancer, hematologic malignancies, among others. Alternative Names: Melanoma-associated antigen 3 (112-120); MAGE-A3 (112-120). | |
| MAGE-3 (113-121) | A peptide fragment of MAGE-3. Melanoma-associated antigen 3 (MAGE-A3) protein is a member of cancer-testis antigens (CTAs), and has been identified on many tumors including melanoma, non-small cell lung cancer, hematologic malignancies, among others. Alternative Names: Melanoma-associated antigen 3 (113-121); MAGE-A3 (113-121). | |
| MAGE-3 (114-122) | A peptide fragment of MAGE-3. Melanoma-associated antigen 3 (MAGE-A3) protein is a member of cancer-testis antigens (CTAs), and has been identified on many tumors including melanoma, non-small cell lung cancer, hematologic malignancies, among others. Alternative Names: Melanoma-associated antigen 3 (114-122); MAGE-A3 (114-122). | |
| MAGE-3 (119-134) | A peptide fragment of MAGE-3. Melanoma-associated antigen 3 (MAGE-A3) protein is a member of cancer-testis antigens (CTAs), and has been identified on many tumors including melanoma, non-small cell lung cancer, hematologic malignancies, among others. Alternative Names: Melanoma-associated antigen 3 (119-134); MAGE-A3 (119-134). | |
| MAGE-3 (143-151) | A peptide fragment of MAGE-3. Melanoma-associated antigen 3 (MAGE-A3) protein is a member of cancer-testis antigens (CTAs), and has been identified on many tumors including melanoma, non-small cell lung cancer, hematologic malignancies, among others. Alternative Names: Melanoma-associated antigen 3 (143-151); MAGE-A3 (143-151). | |
| MAGE-3 (149-160) | A peptide fragment of MAGE-3. Melanoma-associated antigen 3 (MAGE-A3) protein is a member of cancer-testis antigens (CTAs), and has been identified on many tumors including melanoma, non-small cell lung cancer, hematologic malignancies, among others. Alternative Names: Melanoma-associated antigen 3 (149-160); MAGE-A3 (149-160). | |
| MAGE-3 (161-175) | A peptide fragment of MAGE-3. Melanoma-associated antigen 3 (MAGE-A3) protein is a member of cancer-testis antigens (CTAs), and has been identified on many tumors including melanoma, non-small cell lung cancer, hematologic malignancies, among others. Alternative Names: Melanoma-associated antigen 3 (161-175); MAGE-A3 (161-175). | |
| MAGE-3 (167-176) | A peptide fragment of MAGE-3. Melanoma-associated antigen 3 (MAGE-A3) protein is a member of cancer-testis antigens (CTAs), and has been identified on many tumors including melanoma, non-small cell lung cancer, hematologic malignancies, among others. Alternative Names: Melanoma-associated antigen 3 (167-176); MAGE-A3 (167-176). | |
| MAGE-3 (168-176) | A peptide fragment of MAGE-3. Melanoma-associated antigen 3 (MAGE-A3) protein is a member of cancer-testis antigens (CTAs), and has been identified on many tumors including melanoma, non-small cell lung cancer, hematologic malignancies, among others. Alternative Names: Melanoma-associated antigen 3 (168-176); MAGE-A3 (168-176). | |
| MAGE-3 (191-205) | A peptide fragment of MAGE-3. Melanoma-associated antigen 3 (MAGE-A3) protein is a member of cancer-testis antigens (CTAs), and has been identified on many tumors including melanoma, non-small cell lung cancer, hematologic malignancies, among others. Alternative Names: Melanoma-associated antigen 3 (191-205); MAGE-A3 (191-205). | |
| MAGE-3 (243-258) | A peptide fragment of MAGE-3. Melanoma-associated antigen 3 (MAGE-A3) protein is a member of cancer-testis antigens (CTAs), and has been identified on many tumors including melanoma, non-small cell lung cancer, hematologic malignancies, among others. Alternative Names: Melanoma-associated antigen 3 (243-258); MAGE-A3 (243-258). | |
| MAGE-3 (267-282) | A peptide fragment of MAGE-3. Melanoma-associated antigen 3 (MAGE-A3) protein is a member of cancer-testis antigens (CTAs), and has been identified on many tumors including melanoma, non-small cell lung cancer, hematologic malignancies, among others. Alternative Names: Melanoma-associated antigen 3 (267-282); MAGE-A3 (267-282). | |
| MAGE-3 (281-295) | A peptide fragment of MAGE-3. Melanoma-associated antigen 3 (MAGE-A3) protein is a member of cancer-testis antigens (CTAs), and has been identified on many tumors including melanoma, non-small cell lung cancer, hematologic malignancies, among others. Alternative Names: Melanoma-associated antigen 3 (281-295); MAGE-A3 (281-295). | |
| MAGE-3 (97-105) | A peptide fragment of MAGE-3. Melanoma-associated antigen 3 (MAGE-A3) protein is a member of cancer-testis antigens (CTAs), and has been identified on many tumors including melanoma, non-small cell lung cancer, hematologic malignancies, among others. Alternative Names: Melanoma-associated antigen 3 (97-105); MAGE-A3 (97-105). | |
| MAGE-3 Antigen (271-279) (human) | MAGE-3 Antigen (271-279) (human) is a fragment of MAGE-3 Antigen, a HLA-A restricted peptide derived from melanoma antigens encoded by MAGE-3. Alternative Names: H-Phe-Leu-Trp-Gly-Pro-Arg-Ala-Leu-Val-OH; MAGE-3 (271-279). Grades: ≥98%. CAS No. 160295-81-8. Molecular formula: C53H79N13O10. Mole weight: 1058.28. | |
| MAGE-4 (143-151) | MAGE-4 (143-151) is a bioactive peptide of MAGE-4. The Melanoma-Associated Antigen A4 (MAGE-A4) protein is a target for cancer therapy. It may play a role in embryonal development and tumor transformation or aspects of tumor progression. Alternative Names: Melanoma-Associated Antigen 4 (143-151); MAGEA4 (143-151). | |
| MAGE-4 (156-163) | MAGE-4 (156-163) is a bioactive peptide of MAGE-4. The Melanoma-Associated Antigen A4 (MAGE-A4) protein is a target for cancer therapy. It may play a role in embryonal development and tumor transformation or aspects of tumor progression. Alternative Names: Melanoma-Associated Antigen 4 (156-163); MAGEA4 (156-163). | |
| MAGE-4 (169-177) | MAGE-4 (169-177) is a bioactive peptide of MAGE-4. The Melanoma-Associated Antigen A4 (MAGE-A4) protein is a target for cancer therapy. It may play a role in embryonal development and tumor transformation or aspects of tumor progression. Alternative Names: Melanoma-Associated Antigen 4 (169-177); MAGEA4 (169-177). | |
| MAGE-4 (230-239) | MAGE-4 (230-239) is a bioactive peptide of MAGE-4. The Melanoma-Associated Antigen A4 (MAGE-A4) protein is a target for cancer therapy. It may play a role in embryonal development and tumor transformation or aspects of tumor progression. Alternative Names: Melanoma-Associated Antigen 4 (230-239); MAGEA4 (230-239). | |
| MAGE-5 (5-12) | MAGE-5 (5-12) is a bioactive peptide of MAGE-5. It may play a role in embryonal development and tumor transformation or aspects of tumor progression. Alternative Names: Melanoma-Associated Antigen 5 (5-12); Cancer / Testis Antigen 1.5 (5-12). | |
| MAGE-6 (121-134) | MAGE-6 (121-134) is a peptide corresponding to residues 121-134 of MAGE-6. MAGE-6 functions in tumor transformation or aspects of tumor progression. It promotes cell viability in melanoma cell lines in vitro. Alternative Names: Melanoma-Associated Antigen 6 (121-134); Cancer / Testis Antigen 1.6 (121-134). | |
| MAGE-6 (168-176) | MAGE-6 (168-176) is a peptide corresponding to residues 168-176 of MAGE-6. MAGE-6 functions in tumor transformation or aspects of tumor progression. It promotes cell viability in melanoma cell lines in vitro. Alternative Names: Melanoma-Associated Antigen 6 (168-176); Cancer / Testis Antigen 1.6 (168-176). | |
| MAGE-6 (290-298) | MAGE-6 (290-298) is a peptide corresponding to residues 290-298 of MAGE-6. MAGE-6 functions in tumor transformation or aspects of tumor progression. It promotes cell viability in melanoma cell lines in vitro. Alternative Names: Melanoma-Associated Antigen 6 (290-298); Cancer / Testis Antigen 1.6 (290-298). | |
| MAGE-6 (293-301) | MAGE-6 (293-301) is a peptide corresponding to residues 293-301 of MAGE-6. MAGE-6 functions in tumor transformation or aspects of tumor progression. It promotes cell viability in melanoma cell lines in vitro. Alternative Names: Melanoma-Associated Antigen 6 (293-301); Cancer / Testis Antigen 1.6 (293-301). | |
| MAGE-9 (223-231) | MAGE-9 (223-231) is a bioactive peptide of MAGE-9. MAGE-A9 is a particular member in the context of the MAGE-A gene family and was defined as presenting prognostic relevance in certain type of human cancer. Alternative Names: Melanoma-Associated Antigen 9 (223-231); Cancer / Testis Antigen Family 1, Member 9 (223-231). | |
| MAGE-A10 | MAGE-A10 is a member of the MAGE-A family of cancer / testis tumor-associated antigens (C/T TAAs). MAGE-A10 could be used as a potential target for tumor immunotherapy. Alternative Names: Val-Ile-Trp-Glu-Ala-Leu-Asn-Met-Met-Gly-Leu-Tyr-Asp-Gly-Met-Glu-His-Leu-Ile-Tyr-Gly-Glu-Pro-Arg-Lys-Leu-Leu-Thr-Gln-Asp. Molecular formula: C159H247N39O46S3. Mole weight: 3537.32. | |
| MAGE-A3 | MAGE-A3 is a member of the MAGE-A family of cancer / testis tumor-associated antigens (C/T TAAs). MAGE-A3 could be used as a potential target for tumor immunotherapy. Alternative Names: Ser-Arg-Lys-Val-Ala-Glu-Leu-Val-His-Phe-Leu-Leu-Leu-Lys-Tyr-Arg-Ala-Arg-Glu-Pro-Val-Thr-Lys-Ala-Glu-Met-Leu-Gly-Ser-Val-Val. Molecular formula: C161H271N45O42S. Mole weight: 3451.43. | |
| MAGE-A3 (195-203) | MAGE-A3 (195-203) is a human leukocyte antigen (HLA)-A24 molecules epitope encoded by melanoma antigen gene (MAGE). Alternative Names: H-Ile-Met-Pro-Lys-Ala-Gly-Leu-Leu-Ile-OH; L-isoleucyl-L-methionyl-L-prolyl-L-lysyl-L-alanyl-glycyl-L-leucyl-L-leucyl-L-isoleucine. Grades: ≥95%. CAS No. 171066-85-6. Molecular formula: C45H82N10O10S. Mole weight: 955.26. | |
| Malantide | Malantide, a highly specific substrate for PKA, is a synthetic dodecapeptide derived from the site phosphorylated by cAMP-dependent protein kinase (PKA) on the β-subunit of phosphorylase kinase. Alternative Names: H-Arg-Thr-Lys-Arg-Ser-Gly-Ser-Val-Tyr-Glu-Pro-Leu-Lys-Ile-OH; L-arginyl-L-threonyl-L-lysyl-L-arginyl-L-seryl-glycyl-L-seryl-L-valyl-L-tyrosyl-L-alpha-glutamyl-L-prolyl-L-leucyl-L-lysyl-L-isoleucine. Grades: ≥95%. CAS No. 86555-35-3. Molecular formula: C72H124N22O21. Mole weight: 1633.89. | |
| Malantide acetate | Malantide acetate, a highly specific substrate for PKA, is a synthetic dodecapeptide derived from the site phosphorylated by cAMP-dependent protein kinase (PKA) on the β-subunit of phosphorylase kinase. Alternative Names: H-Arg-Thr-Lys-Arg-Ser-Gly-Ser-Val-Tyr-Glu-Pro-Leu-Lys-Ile-OH.CH3CO2H; L-arginyl-L-threonyl-L-lysyl-L-arginyl-L-seryl-glycyl-L-seryl-L-valyl-L-tyrosyl-L-alpha-glutamyl-L-prolyl-L-leucyl-L-lysyl-L-isoleucine acetic acid. Grades: ≥95%. Molecular formula: C74H128N22O23. Mole weight: 1693.97. | |
| Mambalgin 1 | Mambalgin 1, a toxin isolated from black mamba venom, is a disulfide-rich polypeptide consisting of 57 amino acids and belongs to the family of three-finger toxins. Mambalgin 1 is a selective ASIC1a inhibitor (IC50= 192 and 72 nM for human ASIC1a and ASIC1a/1b dimer, respectively), and binds to closed / inactive channel. Alternative Names: LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK. Grades: >98%. CAS No. 1609937-15-6. Molecular formula: C272H429N85O84S10. Mole weight: 6554.51. | |
| Mammaglobin-A (23-31) | Mammaglobin-A (23-31) is a truncated fragment of Mammaglobin-A. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
| Mammaglobin-A precursor (2-10) | A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
| Mammaglobin-A precursor (32-40) | A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
| Mammaglobin-A precursor (4-12) | A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
| Mammaglobin-A precursor (66-74) | A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
| Mammaglobin-A precursor (83-92) | A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
| Manduca Sexta Moricin | Manduca Sexta Moricin exhibited potent antimicrobial activities against a broad spectrum of Gram-positive and Gram-negative bacteria with a minimum inhibitory concentration of 1.4 μm. | |
| MAP | Multiple Antigenic peptides (MAPs) are artificially branched peptides with lysine residues as the scaffold core, supporting the formation ≤8 branches with varying or the same peptide sequences. MAPs have been used to produce antibodies for immunological research. MAPs have a high molar ratio of peptide antigen to core molecule and does not require carrier protein to elicit antibody response. Alternative Names: H-Lys-Leu-Ala-Leu-Lys-Leu-Ala-Leu-His-Ala-Leu-Lys-Ala-Ala-Leu-Lys-Leu-Ala-Lys-Leu-Ala-Leu-Lys-Leu-Ala-Leu-Lys-Ala-Leu-Lys-Ala-Ala-Leu-Lys-Leu-Ala-OH. Grades: >98%. Molecular formula: C180H331N47O37. Mole weight: 3745.92. | |
Our database is helping our users find suppliers everyday.
