BOC Sciences provides a wide range of research chemicals and biochemicals including inhibitors, building blocks, GMP Products, impurities and metabolites, APIs for Veterinary, Natural Compounds, ADCs, Stem Cell Molecule and chiral compounds.
| Product | Description | |
|---|---|---|
| MGF | Mechano growth factor (MGF) is a spliced variant of insulin-like growth factor 1 (IGF-1). IGF-1 is found in various tissues in the body including liver and muscle. Alternative Names: MGF E-domain; IGF-1 EC; Mechano Growth Factor. Grades: 98%. Molecular formula: C121H199N40O40. Mole weight: 2868.19. |  |
| MiAMP2b | MiAMP2b is isolated from Macadamia integrifolia and has antifungal activity. Alternative Names: Vicilin-like Antimicrobial peptide 2b. | |
| Micasin | Micasin is an antibacterial peptide with potent activity against both Gram-positive and Gram-negative bacteria. Alternative Names: Fungal defensin micasin; Fungal defensin-like peptide. | |
| Microbisporicin A1 | Microbisporicin A1 is isolated from Microbispora corallina and has antimicrobial activity. | |
| Microcin 7 | Microcin 7 is a small peptide produced and excreted to the culture medium by stationary-phase Escherichia coli cells harboring the pMccC7 plasmid (formerly named pRYC7). This peptide inhibited the growth of the enterobacteria phylogenetically closer to E. coli, apparently by blocking protein biosynthesis. | |
| Microcin C7 | Microcin C7 is an antibacterial peptide which is active against enterobacteria including species of Klebsiella, Salmonella, Shigella, Yersinia and Proteus, and strains of E.coli. Alternative Names: MccC7. | |
| Microcin H47 | Microcin H47 (MccH47) is an antimicrobial peptide produced by some strains of Escherichia coli that has demonstrated inhibitory activity against enteric pathogens in vivo and has been heterologously overexpressed in proof-of-concept engineered probiotic applications. Alternative Names: MccH47. | |
| Microsomal glutathione S-transferase 1 isoform a (121-132) | Microsomal glutathione S-transferase 1 isoform a (121-132) is a peptide derived from Microsomal glutathione S-transferase 1 isoform a. Microsomal glutathione S-transferase 1 is a conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. And it has a wide substrate specificity. Alternative Names: Microsomal GST-1 isoform a (121-132). | |
| Microtubule-Associated Protein (142-161) (human) | Microtubule-Associated Protein (142-161) (human). Alternative Names: C-Terminal Fragment of Microtubule Associated Protein Tau; H-Ser-Pro-Gln-Leu-Ala-Thr-Leu-Ala-Asp-Glu-Val-Ser-Ala-Ser-Leu-Ala-Lys-Gln-Gly-Leu-OH; L-Seryl-L-prolyl-L-glutaminyl-L-leucyl-L-alanyl-L-threonyl-L-leucyl-L-alanyl-L-α-aspartyl-L-α-glutamyl-L-valyl-L-seryl-L-alanyl-L-seryl-L-leucyl-L-alanyl-L-lysyl-L-glutaminylglycyl-L-leucine. Grades: ≥95%. CAS No. 565227-74-9. Molecular formula: C86H147N23O31. Mole weight: 1999.25. | |
| Microtubule-associated protein 1A (806-814) | Microtubule-associated protein 1A (806-814) is a fragment of MAP1A. Microtubule-associated protein MAP1A is expressed abundantly in mature neurons and is necessary for maintenance of neuronal morphology and localization of some molecules in association with the microtubule-based cytoskeleton. It can be used in Ovarian carcinoma research. | |
| Midasin (1471-1481) | Midasin (1471-1481) is amino acids 1471 to 1481 fragment of Midasin. Midasin is a member of the AAA(+) family of ATPases. It is a nuclear chaperone required for maturation and nuclear export of pre-60S ribosome subunits. Alternative Names: Dynein-related AAA-ATPase MDN1 (1471-1481). Grades: >98%. | |
| Midgut defensin | Midgut defensin is isolated from Haemaphysalis longicornis and has antibacterial activity. | |
| Midkine (114-122) | Midkine, a heparin-binding growth factor, contains 121 amino acid residues with 5 disulfide bonds. It promotes the growth, survival, and migration of various cells, and plays roles in neurogenesis and epithelial mesenchymal interactions during organogenesis. Restricted mainly to certain tissues in the normal adult, it is strongly induced during oncogenesis, inflammation and tissue repair. Alternative Names: MK (114-122); MDK (114-122). | |
| Midkine (13-21) | Midkine, a heparin-binding growth factor, contains 121 amino acid residues with 5 disulfide bonds. It promotes the growth, survival, and migration of various cells, and plays roles in neurogenesis and epithelial mesenchymal interactions during organogenesis. Restricted mainly to certain tissues in the normal adult, it is strongly induced during oncogenesis, inflammation and tissue repair. Alternative Names: MK (13-21); MDK (13-21). | |
| Midkine (9-23) | Midkine, a heparin-binding growth factor, contains 121 amino acid residues with 5 disulfide bonds. It promotes the growth, survival, and migration of various cells, and plays roles in neurogenesis and epithelial mesenchymal interactions during organogenesis. Restricted mainly to certain tissues in the normal adult, it is strongly induced during oncogenesis, inflammation and tissue repair. Alternative Names: MK (9-23); MDK (9-23). | |
| Milk lysozyme | Human milk contains significantly more lysozyme than bovine milk. Lysozyme can hydrolyze the bacterial cell wall, rendering the bacteria unstable. It seems to act synergistically with IgA and lactoferrin. | |
| Mimo (horse) | Mimo (horse). Alternative Names: Mimo, horse; Biotin-Gly-Gly-Ser-Cys-Thr-Glu-Val-Ser-Met-Pro-Thr-Asp-Asn-Phe-Glu-Arg-Lys-Arg-Phe-Ile-Leu-Thr-Cys (Disulfide bond Cys4/Cys23). Molecular formula: C119H187N33O38S4. Mole weight: 2816.36. | |
| Mimo (mouse) | Mimo (mouse). Alternative Names: Mimo, mouse; Biotin-Gly-Gly-Ser-Cys-Leu-Asn-Ile-Ser-Val-Pro-Gly-Asn-Thr-Asp-Glu-Ser-Tyr-Asp-Ser-Lys-Val-Phe-Val-Leu-Thr-Cys (Disulfide bond Cys4/Cys26). Molecular formula: C125H193N31O44S3. Mole weight: 2930.42. | |
| Mini Gastrin I, human | Mini Gastrin I, human, a shorter version of human gastrin 1, consists of amino acids 5-17 of the parent peptide and binds to CCK2I4SVR. Alternative Names: 22-34-Gastrin I (pig), 22-l-leucine-; Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH2; Minigastrin I (human); Gastrin-I-(5-17); L-leucyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alanyl-L-tyrosyl-glycyl-L-tryptophyl-L-methionyl-L-alpha-aspartyl-L-phenylalaninamide. Grades: ≥95%. CAS No. 54405-27-5. Molecular formula: C74H99N15O26S. Mole weight: 1646.73. | |
| Miraculin (1-20) TFA | Miraculin is a taste improver, which is a glycoprotein extracted from the fruit of Syssepalum dulcificum. Alternative Names: H-Asp-Ser-Ala-Pro-Asn-Pro-Val-Leu-Asp-Ile-Asp-Gly-Glu-Lys-Leu-Arg-Thr-Gly-Thr-Asn-OH.TFA; L-alpha-aspartyl-L-seryl-L-alanyl-L-prolyl-L-asparagyl-L-prolyl-L-valyl-L-leucyl-L-alpha-aspartyl-L-isoleucyl-L-alpha-aspartyl-glycyl-L-alpha-glutamyl-L-lysyl-L-leucyl-L-arginyl-L-threonyl-glycyl-L-threonyl-L-asparagine TFA. Molecular formula: C88H146N26O34 (free base). Mole weight: 2112.28 (free base). | |
| Misgurin | A novel antimicrobial peptide, named misgurin, was isolated and characterized from the loach (mudfish), Misgurnus anguillicaudatus. Misgurin showed a strong antimicrobial activity in vitro against a broad spectrum of microorganisms without significant hemolytic activity and was about 6 times more potent than magainin 2. Molecular formula: C106H189N41O29. Mole weight: 2501.88. | |
| Mitogenic Pentapeptide | Mitogenic Pentapeptide represents a potent activator for monocytes / macrophages and B lymphocytes. Alternative Names: Tripalmitoyl pentapeptide; Bppp-cssaa; P3C-Ssna; Pam3Cys-ser-ser-asn-ala; 2,3-Bis(palmitoyloxy)propyl-N-palmitoylpentapeptide. CAS No. 87173-03-3. Molecular formula: C67H124N6O14S. Mole weight: 1269.80. | |
| MLCK inhibitor peptide 18 | A myosin light chain kinase (MLCK) inhibitor (IC50= 50 nM), and inhibits CaM kinase IIonly at 4000-fold higher concentrations. Alternative Names: Myosin Light Chain Kinase Inhibitor Peptide 18. Grades: ≥95%. CAS No. 224579-74-2. Molecular formula: C60H105N23O11. Mole weight: 1324.64. | |
| MLCK inhibitor peptide 18 acetate | MLCK inhibitor peptide 18 acetate is a selective competitive myosin light chain kinase (MLCK) inhibitor (IC50 = 50 nM) that inhibits CaM kinase II only at 4000-fold higher concentrations. Alternative Names: H-Arg-Lys-Lys-Tyr-Lys-Tyr-Arg-Arg-Lys-NH2.CH3CO2H; L-arginyl-L-lysyl-L-lysyl-L-tyrosyl-L-lysyl-L-tyrosyl-L-arginyl-L-arginyl-L-lysinamide acetate. Grades: ≥95%. Molecular formula: C62H109N23O13. Mole weight: 1384.67. | |
| MLH3 protein, partial (135-151) | MLH3 protein, partial (135-151) is a 7-aa peptide. MLH3 is a DNA mismatch repair gene associated with mammalian microsatellite instability. | |
| mlmp3 (D81N) | mlmp3 (D81N). Alternative Names: Ala-Ala-Leu-Leu-Asn-Lys-Leu-Tyr-Ala. Molecular formula: C46H77N11O12. Mole weight: 976.23. | |
| MM-102 | MM-102, as a MLL1 mimetic, shows high binding affinities to WDR5 with IC50 of 2.9 nM and Ki of < 1 nM. Alternative Names: MM-102; MM102; MM 102; HMTase Inhibitor IX. Grades:>98%. CAS No. 1417329-24-8. Molecular formula: C35H49F2N7O4. Mole weight: 669.8. | |
| MM 54 | MM 54 is an apelin receptor antagonist with IC50 value of 93 nM. It can antagonize the inhibitory effect of [Pyr1]-Apelin-13 on forskolin-induced cAMP accumulation in CHO-K1-APJ cells. Alternative Names: MM-54; MM54; H-Cys(1)-Arg-Pro-Arg-Leu-Cys(1)-Lys-His-Cys(2)-Arg-Pro-Arg-Leu-Cys(2)-OH; L-cysteinyl-L-arginyl-L-prolyl-L-arginyl-L-leucyl-L-cysteinyl-L-lysyl-L-histidyl-L-cysteinyl-L-arginyl-L-prolyl-L-arginyl-L-leucyl-L-cysteine (1->6),(9->14)-bis(disulfide). Grades: ≥95%. CAS No. 1313027-43-8. Molecular formula: C70H121N29O15S4. Mole weight: 1737.15. | |
| MMGP1 | MMGP1 is an antifungal peptide which was found to possess potent antifungal activity against C. albicans. | |
| MMK 1 | MMK 1 is a potent and selective human formyl peptide receptor FPR2 agonist (EC50 = 1, 2 and > 10 000 nM at mFRP2, hFPR2 and hFPR1 respectively). Some findings showed that the transient rise in intracellular free calcium induced by MMK-1 involves both a release of calcium from intracellular stores and an opening of channels in the plasma membrane. Alternative Names: MMK 1; MMK1; MMK-1; (4S)-4-[[(2S)-2-amino-4-methylpentanoyl]amino]-5-[[(2S)-1-[[(2S,3S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(1S)-1-carboxy-3-methylsulfanylpropyl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-5-oxopentanoic acid. CAS No. 271246-66-3. Molecular formula: C75H123N19O18S. Mole weight: 1610.97. | |
| MMTM | MMTM. Alternative Names: 4-(4,6-Dimethoxy-1,3,5-triazin-2-yl)-4-methylmorpholinium tetrafluoroborate; MMTM; I14-3181; DMTMMT; SCHEMBL403227; KS-00000T9H; AK186617. Grades: 98%. CAS No. 293311-03-2. Molecular formula: C10H17N4O3BF4. Mole weight: 328.07. | |
| MOCAc-Ala-Pro-Ala-Lys-Phe-Phe-Arg-Leu-Lys(Dnp)-NH2 | MOCAc-Ala-Pro-Ala-Lys-Phe-Phe-Arg-Leu-Lys(Dnp)-NH2 is a fluorescence-quenching substrate for Proteinase A / Pepsin. Alternative Names: APAKFFRLX; (7-Methoxycoumarin-4-yl)acetyl-L-alanyl-L-prolyl-L-alanyl-L-lysyl-L-phenylalanyl-L-phenylalanyl-L-arginyl-L-leucyl-[Nε-(2,4-dinitrophenyl)-L-lysine] amide. CAS No. 177337-81-4. Molecular formula: C71H95N17O17. Mole weight: 1458.64. | |
| Moc-D-Pro-OH | Moc-D-Pro-OH. Alternative Names: MeOCO-D-Pro-OH; Moc D Pro OH; D-N-carbomethoxy proline. CAS No. 1344908-81-1. Molecular formula: C7H11NO4. Mole weight: 173.17. | |
| Moc-Leu-OH | Moc-Leu-OH. Alternative Names: MeOCO-Leu-OH; Moc Leu OH; N-Carbomethoxy-L-leucine. CAS No. 74761-37-8. Molecular formula: C8H15NO4. Mole weight: 189.21. | |
| Moc-Pro-OH | Moc-Pro-OH. Alternative Names: MeOCO-Pro-OH; Moc Pro OH; 1-(methoxycarbonyl)-L-proline; N-Carbomethoxy proline. CAS No. 74761-41-4. Molecular formula: C7H11NO4. Mole weight: 173.17. | |
| Moc-Val-Val-OH | Moc-Val-Val-OH. Alternative Names: Moc Val Val OH. Molecular formula: C12H22N2O5. Mole weight: 274.31. | |
| Modified defensin | Modified defensin is a synthetic construct peptide and has antibacterial activity. | |
| MOG (35-55) | (MOG) 35-55 is a minor component of CNS myelin. Produces a relapsing-remitting neurological disease with extensive plaque-like demyelination. Alternative Names: MOG35-55. Grades: >98%. CAS No. 149635-73-4. Molecular formula: C118H177N35O29S. Mole weight: 2581.95. | |
| MOG (92-106) | MOG (92-106) is the 92-106 amino acid residue of myelin oligodendrocyte glycoprotein (MOG), which is a protein located on the surface of myelin sheaths in the central nervous system. Alternative Names: H-Asp-Glu-Gly-Gly-Tyr-Thr-Cys-Phe-Phe-Arg-Asp-His-Ser-Tyr-Gln-OH; Asp-Glu-Gly-Gly-Tyr-Thr-Cys-Phe-Phe-Arg-Asp-His-Ser-Tyr-Gln. Molecular formula: C80H105N21O27S. Mole weight: 1825. | |
| Moricin-like peptide A | Moricin-like peptide A has antibacterial and antifungal activity. The source of Moricin-like peptide A is Galleria mellonella [Greater wax moth]. | |
| Moricin-like peptide B | The moricin-like peptides were particularly active against filamentous fungi, preventing the growth of Fusarium graminearum at 3 microg/ml, and were also active against yeasts, gram positive bacteria and gram negative bacteria. | |
| Moricin-like peptide C1 | The moricin-like peptides were particularly active against filamentous fungi, preventing the growth of Fusarium graminearum at 3 microg/ml, and were also active against yeasts, gram positive bacteria and gram negative bacteria. | |
| Moricin-like peptide C2 | The moricin-like peptides were particularly active against filamentous fungi, preventing the growth of Fusarium graminearum at 3 microg/ml, and were also active against yeasts, gram positive bacteria and gram negative bacteria. | |
| Moricin-like peptide C3 | The moricin-like peptides were particularly active against filamentous fungi, preventing the growth of Fusarium graminearum at 3 microg/ml, and were also active against yeasts, gram positive bacteria and gram negative bacteria. | |
| Moricin-like peptide C4 | The moricin-like peptides were particularly active against filamentous fungi, preventing the growth of Fusarium graminearum at 3 microg/ml, and were also active against yeasts, gram positive bacteria and gram negative bacteria. | |
| Moricin-like peptide D | The moricin-like peptides were particularly active against filamentous fungi, preventing the growth of Fusarium graminearum at 3 microg/ml, and were also active against yeasts, gram positive bacteria and gram negative bacteria. | |
| Moth Cytochrome C (MCC) 88-103 | Moth Cytochrome C (MCC) 88-103, derived from the carboxyl terminus of moth cytochrome C, induces positive selection of TCR transgenic thymocytes. Alternative Names: Ala-Asn-Glu-Arg-Ala-Asp-Leu-Ile-Ala-Tyr-Leu-Lys-Gln-Ala-Thr-Lys; L-alanyl-L-asparagyl-L-alpha-glutamyl-L-arginyl-L-alanyl-L-alpha-aspartyl-L-leucyl-L-isoleucyl-L-alanyl-L-tyrosyl-L-leucyl-L-lysyl-L-glutaminyl-L-alanyl-L-threonyl-L-lysine. Grades: ≥95%. CAS No. 108273-68-3. Molecular formula: C79H133N23O25. Mole weight: 1805.04. | |
| Motilin | Motilin (human, porcine) is an endogenous motilin receptor ligand (Ki = 2.3 nM, and EC50=0.3 nM in a Chinese hamster ovary cell line) that regulates gastrointestinal motor function. Uses: Gastrointestinal agents. Alternative Names: Human motilin; Motilin (human, porcine); Motilin (porcine); MOTILIN; Motilin (human); 9072-41-7; Motilin [MI]; Human motilin [MI]; 52906-92-0; h-Motilin; UNII-D85V250YSI; CHEMBL525634; D85V250YSI; Phe-Val-Pro-Ile-Phe-Thr-Tyr-Gly-Glu-Leu-Gln-Arg-Met-Gln-Glu-Lys-Glu-Arg-Asn-Lys-Gly-Gln; GTPL1458; CCA90692; Motilin porcine, >=97% (HPLC); BDBM50599720; AKOS024457017. Grades: ≥95%. CAS No. 52906-92-0. Molecular formula: C120H188N34O35S. Mole weight: 2699.1. | |
| Motilin, canine | Motilin, canine is a 22-amino acid peptide. Motilin is an effective agonist for gastrointestinal smooth muscle contraction. Alternative Names: Motilin (canine); H-Phe-Val-Pro-Ile-Phe-Thr-His-Ser-Glu-Leu-Gln-Lys-Ile-Arg-Glu-Lys-Glu-Arg-Asn-Lys-Gly-Gln-OH; L-phenylalanyl-L-valyl-L-prolyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-histidyl-L-seryl-L-alpha-glutamyl-L-leucyl-L-glutaminyl-L-lysyl-L-isoleucyl-L-arginyl-L-alpha-glutamyl-L-lysyl-L-alpha-glutamyl-L-arginyl-L-asparagyl-L-lysyl-glycyl-L-glutamine. Grades: ≥95% by HPLC. CAS No. 85490-53-5. Molecular formula: C120H194N36O34. Mole weight: 2685.05. | |
| MPGΔNLS, HIV related | It is a 27-residue peptide derived from the hydrophobic fusion peptide of HIV-1 gp41 (for efficient crossing of the cell membrane) and the hydrophilic nuclear localization sequence of SV40 large T antigen (for the nuclear addressing of the peptide). It contains a single mutation in which the second lysine in NLS has mutated to serine. Alternative Names: H-Gly-Ala-Leu-Phe-Leu-Gly-Phe-Leu-Gly-Ala-Ala-Gly-Ser-Thr-Met-Gly-Ala-Trp-Ser-Gln-Pro-Lys-Ser-Lys-Arg-Lys-Val-OH. Grades: 97%. Molecular formula: C126H201N35O33S. Mole weight: 2766.27. | |
| MPG, HIV related | MPG, a 27-AA peptide derived from the nucleotide localization sequence of SV40 large T antigen and the fusion peptide domain of HIV-1 gp41, is an effective nucleic acid and oligonucleotide carrier for wide delivery into cultured cells. Alternative Names: Gly-Ala-Leu-Phe-Leu-Gly-Phe-Leu-Gly-Ala-Ala-Gly-Ser-Thr-Met-Gly-Ala-Trp-Ser-Gln-Pro-Lys-Ser-Lys-Arg-Lys-Val; L-Valine, glycyl-L-alanyl-L-leucyl-L-phenylalanyl-L-leucylglycyl-L-phenylalanyl-L-leucylglycyl-L-alanyl-L-alanylglycyl-L-seryl-L-threonyl-L-methionylglycyl-L-alanyl-L-tryptophyl-L-seryl-L-glutaminyl-L-prolyl-L-lysyl-L-seryl-L-lysyl-L-arginyl-L-lysyl-. Grades: ≥95%. CAS No. 395069-92-8. Molecular formula: C126H201N35O33S. Mole weight: 2766.22. | |
| Mp_mastoparan MP | Mp_mastoparan MP was found in Venom, wasps, Mischocyttarusphthisicus. Mp_mastoparan MP has antimicrobial activity. | |
| Mpr-JR11 | Mpr-JR11. Alternative Names: Mpr-Cpa-(D-Cys)-[Aph(Hor)]-[D-Aph(Cbm)]-Lys-Thr-Cys-(D-Tyr)-NH2 [Disulfide bond Cys2/Cys7]; Mpr-Cpa-D-Cys-Aph(Hor)-D-Aph(Cbm)-Lys-Thr-Cys-D-Tyr-NH2 [Disulfide bond Cys2/Cys7]. Mole weight: 1391.96. | |
| MPS-Gαi3 | It is a cell penetrating peptide. Alternative Names: H-Ala-Ala-Val-Ala-Leu-Leu-Pro-Ala-Val-Leu-Leu-Ala-Leu-Leu-Ala-Lys-Asn-Asn-Leu-Lys-Glu-Cys-Gly-Leu-Tyr-OH. Grades: >95%. Molecular formula: C120H205N29O31S. Mole weight: 2582.19. | |
| MP-VB1 | MP-VB1 showed strong antimicrobial activities against bacteria and fungi and induced mast cell degranulation, but displayed almost no hemolytic activity towards human blood red cells. | |
| MQRGNFRNQRKIVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQAN | It is an HIV retrovirus NC peptide with superior cell membrane penetration activity. Alternative Names: HIV-NC peptide SEQ ID NO: 12. | |
| MR10 | MR10. | |
| Mram 8 | Mram 8 is isolated from Viola philippica which is a plant from the Violaceae family. | |
| MRX-1024 | MRX-1024 is a proprietary oral formulation of D-methionine with antioxidant and antimucositis activities. D-methionine formulation MRX-1024 may selectively protect the oral mucosa from the toxic effects of chemotherapy and radiation therapy without compromising antitumor activity. D-methionine may be converted into the L- isomer in vivo, particlualry in instances of L-methionine deprivation, both isomers have antioxidant activity which may be due, in part, to their sulfur moieties and chelating properties. L-methionine, an essential amino acid, also may help to maintain the ratio of reduced glutathione to oxidized glutathione in cells undergoing oxidative stress and may provide a source of L-cysteine for glutathione synthesis. Alternative Names: Methionine; D-Methionine; (R)-Methionine; NSC 45689; S-Methyl-D-homocysteine; H-D-Met-OH; (R)-2-amino-4-(methylthio)butanoic acid; D-2-Amino-4-(methylthio)butyric acid. Grades: ≥97%. CAS No. 348-67-4. Molecular formula: C5H11NO2S. Mole weight: 149.21. | |
| MSG 606 | MSG 606 is a potent human MC1 receptor antagonist (IC50 = 17 nM), and also partial agonist at human MC3 and MC5 receptors (EC50= 59 and 1300 nM, respectively). Alternative Names: MSG 606; MSG606; MSG-606. CAS No. 1416983-77-1. Molecular formula: C62H82N20O13S. Mole weight: 1347.51. | |
| MSI-594 | MSI-594 is a highly active AMP with a broad-spectrum of activities against bacteria, fungi, and virus. | |
| mTERT (572-580) | A peptide fragment of mTERT. Mouse telomerase reverse transcriptase (mTERT) is a gene that is expressed by cells that need to continually divide without the characteristic shortening of telomeres that accompanies DNA replication. Alternative Names: hTERT R572Y peptide; Mouse telomerase reverse transcriptase (572-580). | |
| M-theraphotoxin-Gr1a | This cationic hydrophobic peptide inhibits a lot of different channels and has an antimicrobial activity. It also exhibits antimicrobial activities against the Gram-positive bacteria B.subtilis (MIC=0.5 μM), S.aureus (MIC=2-4 μM), and S.epidermidis (MIC=4-8 μM), and Gram-negative bacteria S.typhimurium (MIC=32.64 μM), P.aeruginosa (MIC=8-16 μM), and E.coli (MIC=8-16 μM). Alternative Names: M-TRTX-Gr1a; GsMTx-4. | |
| mTRP-2 (180-188) | mTRP-2 (180-188) is a murine tyrosinase-related protein 2 (TRP-2)-derived peptide, corresponding to residues 180-188. CAS No. 219312-69-3. Molecular formula: C61H78N10O14. Mole weight: 1175.33. | |
| Mtt-Lys(Fmoc)-OH | Mtt-Lys(Fmoc)-OH. Molecular formula: C41H40N2O4. Mole weight: 624.79. | |
| MUC5AC motif peptide | MUC5AC motif peptide is a 16-amino acid fragment of mucin 5. Alternative Names: Gly-Thr-Thr-Pro-Ser-Pro-Val-Pro-Thr-Thr-Ser-Thr-Thr-Ser-Ala-Pro. Grades: ≥95%. Molecular formula: C63H104N16O26. Mole weight: 1501.62. | |
| Mucin-1 (950-958) | Mucin-1 (950-958) is a fragment of Mucin-1. The main function of MUC1 is to protect cells from infection by binding to the pathogens with oligosaccharides in the extracellular domain, which prevents the pathogens from reaching the cell surface. It is associated with multiple myeloma. Alternative Names: Breast carcinoma-associated antigen DF3 (950-958); Cancer antigen 15-3 (950-958); Carcinoma-associated mucin (950-958). | |
| Mucin-1 precursor (12-20) | Mucin-1 precursor (12-20) is a fragment of Mucin-1 precursor. The main function of MUC1 is to protect cells from infection by binding to the pathogens with oligosaccharides in the extracellular domain, which prevents the pathogens from reaching the cell surface. It is associated with multiple myeloma. Alternative Names: Breast carcinoma-associated antigen DF3 (12-20); Cancer antigen 15-3 (12-20); Carcinoma-associated mucin (12-20). | |
| Mucin-1 (repeated region) | Mucin-1 (repeated region) is a fragment of Mucin-1. The main function of MUC1 is to protect cells from infection by binding to the pathogens with oligosaccharides in the extracellular domain, which prevents the pathogens from reaching the cell surface. It is associated with multiple myeloma. Alternative Names: Breast carcinoma-associated antigen DF3 (repeated region); Cancer antigen 15-3 (repeated region); Carcinoma-associated mucin (repeated region). | |
| Mucin-5AC (716-724) | Mucin-5AC (716-724) is a 9-aa peptide. Mucin-5AC is a gel-forming glycoprotein of gastric and respiratory tract epithelia that protects the mucosa from infection and chemical damage by binding to inhaled microorganisms and particles that are subsequently removed by the mucociliary system. Alternative Names: MUC-5AC (716-724); Gastric mucin (716-724); Major airway glycoprotein (716-724). | |
Our database is helping our users find suppliers everyday.
