BOC Sciences provides a wide range of research chemicals and biochemicals including inhibitors, building blocks, GMP Products, impurities and metabolites, APIs for Veterinary, Natural Compounds, ADCs, Stem Cell Molecule and chiral compounds.
| Product | Description | |
|---|---|---|
| SDGRG | SDGRG has been used as a control peptide which does not affect integrin function, in various studies. Alternative Names: S-D-G-R-G; H-SER-ASP-GLY-ARG-GLY-OH. Grades: >95%. CAS No. 108608-63-5. Molecular formula: C17H30N8O9. Mole weight: 490.5. |  |
| (S)-Dihydroaeruginoic acid | It is a simple aromatic siderophore produced by several species of pseudomonas. It exhibits antibacterial, antifungal and antitumor activity. Alternative Names: (4S)-4,5-Dihydro-2-(2-hydroxyphenyl)-4-thiazolecarboxylic Acid; CGP 52547; (S)-4,5-Dihydro-2-(2-hydroxyphenyl)-4-thiazolecarboxylic Acid; (+)-(S)-Dihydroaeruginoic Acid; (+)-Dihydroaeruginoic acid; 4-Thiazolecarboxylic acid, 4,5-dihydro-2-(2-hydroxyphenyl)-, (S)-; 4-Thiazolecarboxylic acid, 4,5-dihydro-2-(2-hydroxyphenyl)-, (4S)-; (S)-2-(2-Hydroxyphenyl)-4,5-dihydrothiazole-4-carboxylic acid; (4S)-Dihydroaeruginoic acid. Grades: >98% by HPLC. CAS No. 143209-04-5. Molecular formula: C10H9NO3S. Mole weight: 223.25. | |
| S-Diphenylmethyl-L-cysteine | The S-diphenylmethyl group is one of the most effective S-protecting groups for cysteine. Alternative Names: L-Cys(Dpm)-OH; (R)-2-Amino-3-(Benzhydrylthio)Propanoic Acid. Grades: ≥ 99% (TLC). CAS No. 5191-80-0. Molecular formula: C16H17NO2S. Mole weight: 287.38. | |
| SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a 32-amino acid peptide. Alternative Names: Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser. Grades: >98%. Molecular formula: C151H236N40O50S. Mole weight: 3443.84. | |
| SEB Domain 144-153 | SEB Domain 144-153, the 144-153 amino acid residues of the staphylococcal enterotoxin B (SEB) domain, inhibits transcytosis of multiple staphylococcal enterotoxins, SEA, SEE and TSST-1. SEB is a toxin produced by Staphylococcus aureus. Alternative Names: Lys-Lys-Lys-Val-Thr-Ala-Gln-Glu-Leu-Asp; L-lysyl-L-lysyl-L-lysyl-L-valyl-L-threonyl-L-alanyl-L-glutaminyl-L-glutamyl-L-leucyl-L-aspartic acid. Grades: ≥95%. CAS No. 210229-94-0. Molecular formula: C50H90N14O17. Mole weight: 1159.33. | |
| Secernin-1 (196-204) | Secernin-1 (196-204) is a peptide derived from Secernin-1. Secernin-1 can regulate exocytosis in mast cells and increase both the extent of secretion and the sensitivity of mast cells to stimulation with calcium. | |
| Secretin (28-54), human | Secretin (human) is a gastrointestinal peptide hormone that stimulates pancreatic and biliary secretion. Secretin (human) is thought to play a role in the regulation of the hypothalamus-pituitary-adrenal axis. Alternative Names: Human secretin; Secretin (human); L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-glutamyl-L-leucyl-L-seryl-L-arginyl-L-leucyl-L-arginyl-L-alpha-glutamyl-glycyl-L-alanyl-L-arginyl-L-leucyl-L-glutaminyl-L-arginyl-L-leucyl-L-leucyl-L-glutaminyl-glycyl-L-leucyl-L-valinamide; His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Glu-Gly-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2. Grades: ≥97% by HPLC. CAS No. 108153-74-8. Molecular formula: C130H220N44O40. Mole weight: 3039.41. | |
| Secretin (5-27) (Porcine) | Secretin is a peptide hormone. Alternative Names: Secretin (5-27), porcine. CAS No. 19665-15-7. Molecular formula: C115H200N38O34. Mole weight: 2659.04. | |
| Secretin, canine | Secretin, canine is an endocrine hormone which stimulates the secretion of bicarbonate-rich pancreatic fluids. Secretin, canine can regulates gastric chief cell function and paracellular permeability in canine gastric monolayers by a Src kinase-dependent pathway. CAS No. 110786-77-1. Molecular formula: C131H222N44O41. Mole weight: 3069.43. | |
| Secretin (Porcine) | Secretin (porcine) is a gastrointestinal peptide hormone that stimulates pancreatic and biliary secretion. Alternative Names: Secretin (swine); Secretin (pig); L-Histidyl-L-seryl-L-α-aspartylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-glutamyl-L-leucyl-L-seryl-L-arginyl-L-leucyl-L-arginyl-L-α-aspartyl-L-seryl-L-alanyl-L-arginyl-L-leucyl-L-glutaminyl-L-arginyl-L-leucyl-L-leucyl-L-glutaminylglycyl-L-leucyl-L-valinamide; Pig secretin; Porcine secretin; SecreFlo; Secrepan; Secretin (guinea pig); Secretin (ox); Secretin-Ferring; Sekretolin; H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2. CAS No. 17034-35-4. Molecular formula: C130H220N44O41. Mole weight: 3055.41. | |
| Secretin (rat) | Secretin (rat) is a gastrointestinal peptide hormone that stimulates pancreatic and biliary secretion. Secretin (rat) is thought to play a role in the regulation of the hypothalamus-pituitary-adrenal axis. Alternative Names: Secretin (33-59), rat; 14-L-glutamine-Secretin (swine); 14-L-glutamine-Secretin (pig); Rat secretin-27; H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Gln-Asp-Ser-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2; L-Histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-glutamyl-L-leucyl-L-seryl-L-arginyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-seryl-L-alanyl-L-arginyl-L-leucyl-L-glutaminyl-L-arginyl-L-leucyl-L-leucyl-L-glutaminyl-glycyl-L-leucyl-L-valinamide. CAS No. 121028-49-7. Molecular formula: C129H216N42O42. Mole weight: 3027.35. | |
| Secretin (swine), acetate salt | A peptide hormone of about 27 amino acids from the duodenal mucosa that activates pancreatic secretion and lowers the blood sugar level. Alternative Names: Secretin (swine), acetate (salt); Secretin (porcine) acetate; Secretin (pig), acetate; Porcine secretin acetate; H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2.xCH3CO2H; L-Histidyl-L-seryl-L-α-aspartylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-glutamyl-L-leucyl-L-seryl-L-arginyl-L-leucyl-L-arginyl-L-α-aspartyl-L-seryl-L-alanyl-L-arginyl-L-leucyl-L-glutaminyl-L-arginyl-L-leucyl-L-leucyl-L-glutaminylglycyl-L-leucyl-L-valinamide) acetate salt (1:x). CAS No. 17034-34-3. Molecular formula: C130H220N44O41.xC2H4O2. Mole weight: 3055.41 (free base). | |
| Secretin (swine), monoacetate salt | Secretin is a hormone secreted by the wall of the upper part of the small intestine (the duodenum). It is released in response to acid in the small intestine to regulate gastric acid secretion and pH levels in the duodenum. Alternative Names: Secretin (swine), monoacetate (salt); Secretin (pig), monoacetate (salt); Porcine secretin monoacetate (salt); Secretin Acetate; Secretin (swine), acetate (salt); Secretin (porcine) acetate; Secretin (pig), acetate; Porcine secretin acetate; H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2.CH3CO2H; L-Histidyl-L-seryl-L-α-aspartylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-glutamyl-L-leucyl-L-seryl-L-arginyl-L-leucyl-L-arginyl-L-α-aspartyl-L-seryl-L-alanyl-L-arginyl-L-leucyl-L-glutaminyl-L-arginyl-L-leucyl-L-leucyl-L-glutaminylglycyl-L-leucyl-L-valinamide) acetate salt (1:1). Grades: 98%. CAS No. 101301-47-7. Molecular formula: C130H220N44O41.C2H4O2. Mole weight: 3115.49. | |
| Secretoneurin, rat | Secretoneurin, rat, a 33-amino acid polypeptide, is a neuropeptide generated in brain, adrenal medulla and other endocrine tissues by proteolytic processing of secretogranin II (chromogranin C). The endogenous peptide can enhance dopamine release. Alternative Names: Secretoneurin (mouse)(9CI); H-THR-ASN-GLU-ILE-VAL-GLU-GLU-GLN-TYR-THR-PRO-GLN-SER-LEU-ALA-THR-LEU-GLU-SER-VAL-PHE-GLN-GLU-LEU-GLY-LYS-LEU-THR-GLY-PRO-SER-ASN-GLN-OH. Grades: >95%. CAS No. 149146-12-3. Molecular formula: C159H252N40O58. Mole weight: 3651.94. | |
| Secretoneurin, rat acetate | Secretoneurin, rat acetate, a 33-amino acid polypeptide, is a neuropeptide generated in brain, adrenal medulla and other endocrine tissues by proteolytic processing of secretogranin II (chromogranin C). The endogenous peptide can enhance dopamine release. Alternative Names: L-Threonyl-L-asparaginyl-L-α-glutamyl-L-isoleucyl-L-valyl-L-α-glutamyl-L-α-glutamyl-L-glutaminyl-L-tyrosyl-L-threonyl-L-prolyl-L-glutaminyl-L-seryl-L-leucyl-L-alanyl-L-threonyl-L-leucyl-L-α-glutamyl-L-seryl-L-valyl-L-phenylalanyl-L-glutaminyl-L-α-glutamyl-L-leucylglycyl-L-lysyl-L-leucyl-L-threonylglycyl-L-prolyl-L-seryl-L-asparaginyl-L-glutamine acetate; Secretoneurin (mouse) acetate; H-Thr-Asn-Glu-Ile-Val-Glu-Glu-Gln-Tyr-Thr-Pro-Gln-Ser-Leu-Ala-Thr-Leu-Glu-Ser-Val-Phe-Gln-Glu-Leu-Gly-Lys-Leu-Thr-Gly-Pro-Asn-Ser-Gln-OH.CH3CO2H. Grades: ≥95%. Molecular formula: C161H256N40O60. Mole weight: 3712.04. | |
| Seed non-specific lipid transfer protein-like | Seed non-specific lipid transfer protein-like is an antibacterial peptide isolated from Raphanus sativus. It has activity against fungi. Alternative Names: Ala-Leu-Ser-Cys-Gly-Thr-Val-Asn-Ser-Asn-Leu-Ala-Ala-Cys-Ile-Gly-Tyr-Leu-Thr-Gln-Asn-Ala-Pro-Leu-Ala-Arg-Gly-Cys-Cys-Thr-Gly-Val-Thr-Asn-Leu-Asn-Asn-Met-AlaX-Thr-Thr-Pro. | |
| Seglitide acetate | Seglitide acetate is a selective sst2 somatostatin receptor agonist. Alternative Names: cyclo[N-methyl-L-alanyl-L-tyrosyl-D-tryptophyl-L-lysyl-L-valyl-L-phenylalanyl] acetic acid; Seglitide monoacetate; Cyclo(N-methyl-L-alanyl-L-tyrosyl-D-tryptophyl-L-lysyl-L-valyl-L-phenylalanyl) monoacetate (salt); MK 678 acetate salt. Grades: ≥95%. CAS No. 99248-33-6. Molecular formula: C46H60N8O9. Mole weight: 869.02. | |
| Selank acetate | Selank acetate is a synthetic analog of human tuftsin and acts as a nootropic, anxiolytic peptide. Selank acetate is a typical anti-anxiety drug with no side effects. Alternative Names: H-Thr-Lys-Pro-Arg-Pro-Gly-Pro-OH.CH3CO2H; L-Proline, 1-[N-[1-[N2-[1-(N2-L-threonyl-L-lysyl)-L-prolyl]-L-arginyl]-L-prolyl]glycyl]-, acetate salt; L-Threonyl-L-lysyl-L-prolyl-L-arginyl-L-prolylglycyl-L-proline acetate salt; Selanc acetate salt. Grades: ≥95%. CAS No. 2703745-90-6. Molecular formula: C33H57N11O9.C2H4O2. Mole weight: 811.93. | |
| Selcopintide | Selcopintide highly reproduces the in vitro effects of CPNE7 by upregulating odontoblast marker genes, DSPP, and Nestin. Selcopintide promotes dentin regeneration in dentinal defects of various degrees and that the regenerated hard tissue demonstrates the characteristics of true dentin. Alternative Names: Cpne7-DP. CAS No. 2130912-34-2. Molecular formula: C62H105N21O15. Mole weight: 1384.63. | |
| Selepressin | Selepressinis is an agonist of the vasopressin 1A receptor and can be used to treat vasodilatory hypotension in septic shock. Alternative Names: Cbz-Phe-Ala-CH2F; Z-FA-fluoromethyl ketone; Zfa-fmk; Z-Phe-Ala-fluoromethyl ketone; benzyloxycarbonyl-Phe-Ala-fluormethylketone; Cathepsin B inhibitor. Grades: ≥95%. CAS No. 876296-47-8. Molecular formula: C21H23FN2O4. Mole weight: 386.42. | |
| Semax acetate | Semax acetate is a synthetic adrenocorticotropic hormone (ACTH) (4-10) peptide analog with neuroprotective, analgesic, and anti-anxiety properties. Alternative Names: L-Proline, L-methionyl-L-α-glutamyl-L-histidyl-L-phenylalanyl-L-prolylglycyl-, acetate (1:1); H-Met-Glu-His-Phe-Pro-Gly-Pro-OH acetate; L-Methionyl-L-α-glutamyl-L-histidyl-L-phenylalanyl-L-prolylglycyl-L-proline acetate; L-Proline, 1-[N-[1-[N-[N-(N-L-methionyl-L-α-glutamyl)-L-histidyl]-L-phenylalanyl]-L-prolyl]glycyl]-, acetate. Grades: ≥95%. CAS No. 2828433-33-4. Molecular formula: C39H55N9O12S. Mole weight: 873.98. | |
| Semaxinib | Semaxinib is a quinolone derivative with potential antineoplastic activity. Semaxinib reversibly inhibits ATP binding to the tyrosine kinase domain of vascular endothelial growth factor receptor 2 (VEGFR2), which may inhibit VEGF-stimulated endothelial cell migration and proliferation and reduce the tumor microvasculature. This agent also inhibits the phosphorylation of the stem cell factor receptor tyrosine kinase c-kit, often expressed in acute myelogenous leukemia cells. Uses: Angiogenesis inhibitors. Alternative Names: SU5416; SU-5416; SU 5416; Sugen 5416; semoxind. Grades: 98%. CAS No. 204005-46-9. Molecular formula: C15H14N2O. Mole weight: 238.28. | |
| Seminalplasmin | Seminalplasmin is an antibacterial peptide isolated from Bovine Bos taurus. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Alternative Names: Ser-Asp-Glu-Lys-Ala-Ser-Pro-Asp-Lys-His-His-Arg-Phe-Ser-Leu-Ser-Arg-Tyr-Ala-Lys-Leu-Ala-Asn-Arg-Leu-Ala-Asn-Pro-Lys-Leu-Leu-Glu-Thr-Phe-Leu-Ser-Lys-Trp-Ile-Gly-Asp-Arg-Gly-Asn-Arg-Ser-Val. CAS No. 147958-06-3. Molecular formula: C76H123N17O16. Mole weight: 1530.9. | |
| Senegalin | Senegalin is an antibacterial peptide isolated from Kassina senegalensis. It has activity against gram-positive bacteria and fungi. Alternative Names: Phe-Leu-Pro-Phe-Leu-Ile-Pro-Ala-Leu-Thr-Ser-Leu-Ile-Ser-Ser-Leu. Grades: >96%. Molecular formula: C375H613N103O119S3. Mole weight: 1732.14. | |
| Senktide | Senktide is a potent tachykinin NK3 receptor agonist. It exhibits a less potent effect on the NK1 receptor (EC50 = 35 μM) and no effect on the NK2 receptor. Senktide was demonstrated the stimulation of dopamine neurons and the enhancement of dopaminergic function. Alternative Names: [Succinyl-Asp6, NMePhe8]-Substance P (6-11); N-(3-carboxy-1-oxopropyl)-L-α-aspartyl-L-phenylalanyl-N-methyl-L-phenylalanylglycyl-L-leucyl-L-methioninamide. Grades: >97%. CAS No. 106128-89-6. Molecular formula: C40H55N7O11S. Mole weight: 842. | |
| SEPTIDE | Septide is a selective agonist for the tachykinin NK-1 receptor. It is also a selective agonist for the substance P P-receptor subtype. Alternative Names: 5-Oxo-L-prolyl-L-phenylalanyl-L-phenylalanyl-L-prolyl-L-leucyl-L-methioninamide; Glp-phe-phe-pro-leu-met-NH2; (Pyr 6,Pro9)-Substance P (6-11). CAS No. 79775-19-2. Molecular formula: C39H53N7O7S. Mole weight: 763.95. | |
| Seractide acetate | ACTH (1-39) is a potent agonist of melanocortin receptor 2 (MC2R) with an EC50 value of 57 pM in HeLa cells expressing the mouse receptor. Alternative Names: 1-39-Corticotropin (human) (TFA); α(1-39) Corticotropin human (TFA); Acth, human (TFA); Adrenocorticotropic hormone, human (TFA); ACTH (1-39) (TFA); ACTH (1-39) trifluoroacetate salt; Adrenocorticotropic Hormone (ACTH) (1-39), human (TFA); Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe.TFA. Grades: >98%. CAS No. 12279-41-3. Molecular formula: C207H308N56O58S.C2HF3O2. Mole weight: 4655.16. | |
| Ser-Glu | Ser-Glu. CAS No. 6403-16-3. Molecular formula: C8H14N2O6. Mole weight: 234.21. | |
| Ser-Glu-Cys-Gly | Ser-Glu-Cys-Gly is a tetrapeptide composed of L-serine, L-alpha-glutamic acid, L-cysteine, and glycine. L-serine is involved in protein synthesis and brain function, L-alpha-glutamic acid supports neurotransmitter activity and cellular metabolism, L-cysteine is crucial for antioxidant defense and protein structure, and glycine plays a role in various metabolic processes and central nervous system health. This peptide may contribute to enhanced cognitive function, improved cellular health, and increased antioxidant protection. Alternative Names: SECG; H-Ser-Glu-Cys-Gly-OH; L-seryl-L-alpha-glutamyl-L-cysteinyl-glycine; H-SECG-OH; (S)-4-((S)-2-Amino-3-hydroxypropanamido)-5-(((R)-1-((carboxymethyl)amino)-3-mercapto-1-oxopropan-2-yl)amino)-5-oxopentanoic acid; L-Seryl-L-α-glutamyl-L-cysteinylglycine. Grades: ≥90%. CAS No. 1001317-90-3. Molecular formula: C13H22N4O8S. Mole weight: 394.40. | |
| Ser-Gly-Gly-OH | Ser-Gly-Gly-OH. Alternative Names: L-Ser-Gly-Gly-OH; (S)-2-(2-(2-Amino-3-hydroxypropanamido)acetamido)acetic acid; Ser Gly Gly OH. Grades: ≥ 99% (TLC). CAS No. 2543-40-0. Molecular formula: C7H13N3O5. Mole weight: 219.2. | |
| Ser-Gly-OH | Ser-Gly-OH. Alternative Names: L-Seryl-L-glycine; Ser Gly OH. Grades: ≥ 97% (HPLC). CAS No. 687-63-8. Molecular formula: C5H10N2O4. Mole weight: 162.15. | |
| Serine protease hepsin (191-199) | A peptide fragment of Serine protease hepsin. Hepsin is a membrane-anchored, trypsin-like serine protease with prominent expression in the human liver and tumors of the prostate and ovaries. | |
| Serine protease hepsin (229-237) | A peptide fragment of Serine protease hepsin. Hepsin is a membrane-anchored, trypsin-like serine protease with prominent expression in the human liver and tumors of the prostate and ovaries. | |
| Serine protease hepsin (268-276) | A peptide fragment of Serine protease hepsin. Hepsin is a membrane-anchored, trypsin-like serine protease with prominent expression in the human liver and tumors of the prostate and ovaries. | |
| Serine / threonine-protein kinase B-raf (586-614) | Serine / threonine-protein kinase B-raf (586-614) is a 29-aa peptide. B-Raf is a member of the Raf kinase family of growth signal transduction protein kinases. This protein plays a role in regulating the MAP kinase / ERKs signaling pathway, which affects cell division, differentiation, and secretion. Alternative Names: Proto-oncogene B-Raf (586-614); v-Raf murine sarcoma viral oncogene homolog B1 (586-614). | |
| Serine / threonine-protein kinase mTOR (89-98) | Serine / threonine-protein kinase mTOR (89-98) is a truncated fragment of Serine / threonine-protein kinase mTOR. Serine / threonine protein kinase which is a central regulator of cellular metabolism, growth and survival in response to hormones, growth factors, nutrients, energy and stress signals (By similarity). MTOR directly or indirectly regulates the phosphorylation of at least 800 proteins (By similarity). This peptide can be used in Ovarian carcinoma research. | |
| Ser-Leu | A substrate for human kidney dipeptidase. Alternative Names: seryl-leucine; L-seryl-L-leucine; 4-fluoro-N-[[4-[[(4-fluorophenyl)amino]methyl]phenyl]methyl]aniline; SL dipeptide; L-Ser-L-Leu; Serine Leucine dipeptide. CAS No. 6665-16-3. Molecular formula: C9H18N2O4. Mole weight: 218.25. | |
| Ser-phe | Ser-phe. Alternative Names: Serinylphenylalanine; L-seryl-L-phenylalanine; SF dipeptide; L-Ser-L-Phe; Serine Phenylalanine dipeptide; (S)-2-((S)-2-Amino-3-hydroxypropanamido)-3-phenylpropanoic acid. CAS No. 16875-28-8. Molecular formula: C12H16N2O4. Mole weight: 252.27. | |
| Serracin-P 23 kDa subunit | Serracin-P 23 kDa subunit is an antibacterial peptide isolated from Serratia plymuthica. It has activity against gram-negative bacteria. Alternative Names: Ala-Leu-Pro-Lys-Lys-Leu-Lys-Tyr-Leu-Asn-Leu-Phe-Asn-Asp-Gly-Phe-Asn-Tyr-Met-Gly-Val-Val. Molecular formula: C121H186N28O30S. Mole weight: 2545.04. | |
| Serracin-P 43 kDa subunit | Serracin-P 43 kDa subunit is an antibacterial peptide isolated from Serratia plymuthica. It has activity against gram-negative bacteria. Alternative Names: Asp-Tyr-His-His-Gly-Val-Arg-Val-Leu. Molecular formula: C49H74N16O13. Mole weight: 1095.23. | |
| Ser-Ser-Ser-OH | Ser-Ser-Ser-OH. Alternative Names: (S)-2-((S)-2-((S)-2-Amino-3-hydroxypropanamido)-3-hydroxypropanamido)-3-hydroxypropanoic acid; Ser Ser Ser OH. Grades: ≥ 97% (HPLC). CAS No. 6620-98-0. Molecular formula: C9H17N3O7. Mole weight: 279.25. | |
| Serylmethionine | Serylmethionine. Alternative Names: Ser-met; L-Seryl-L-methionine; N-L-seryl-L-methionine; S-M Dipeptide; Serinyl-Methionine; Serine Methionine dipeptide. CAS No. 3227-9-6. Molecular formula: C8H16N2O4S. Mole weight: 236.29. | |
| Sesquin | SaBD is an antibacterial peptide isolated from Vigna unguiculata subsp. sesquipedalis. It has activity against gram-positive bacteria, gram-negative bacteria, viral and fungi. Alternative Names: Lys-Thr-Cys-Glu-Asn-Leu-Ala-Asp-Thr-Tyr. Molecular formula: C48H76N12O19S. Mole weight: 1157.26. | |
| Se-Trityl-L-selenocysteine | Se-Trityl-L-selenocysteine. Alternative Names: H-SelenoCys(Trt)-OH; H-SeC(Trt)-OH; (2R)-2-Amino-3-tritylselanylpropanoic acid. Molecular formula: C22H21NO2Se. Mole weight: 410.37. | |
| SEX PHEROMONE INHIBITOR IPD1 | Sex pheromone inhibitor ipd1 is produced by Streptococcus faecalis donor strains harboring bacteriocin plasmid pPD1. It inhibits the activity of sex pheromone cPD1. Alternative Names: H-Ala-Leu-Ile-Leu-Thr-Leu-Val-Ser-OH. Grades: 95%. CAS No. 120116-56-5. Molecular formula: C39H72N8O11. Mole weight: 829.04. | |
| S-(γ)-Phe | S-(γ)-Phe. Alternative Names: S gamma Phe. CAS No. 916198-97-5. Molecular formula: C11H15NO2. Mole weight: 193.24. | |
| SgI-29 | SgI-29 is an antibacterial peptide isolated from Homo sapiens. It has activity against gram-positive bacteria and gram-negative bacteria. Alternative Names: SgI-29 (85-113); His-Asn-Lys-Gln-Glu-Gly-Arg-Asp-His-Asp-Lys-Ser-Lys-Gly-His-Phe-His-Arg-Val-Val-Ile-His-His-Lys-Gly-Gly-Lys-Ala-His. Grades: >97%. Molecular formula: C145H226N56O39. Mole weight: 3377.74. | |
| SgII peptide A | SgII peptide A is an antibacterial peptide isolated from Homo sapiens. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Alternative Names: SgII peptide A (human); Lys-Gln-Glu-Gly-Arg-Asp-His-Asp-Lys-Ser-Lys-Gly-His-Phe-His-Met-Ile-Val-Ile-His-His-Lys-Gly-Gly-Gln-Ala-His-His-Gly. Grades: >97%. Molecular formula: C142H218N52O39S. Mole weight: 3309.68. | |
| sGnRH-A | sGnRH-A is a GnRH peptide analog that acts as a GnRH antagonist. Alternative Names: H-Pyr-His-Trp-Ser-Tyr-D-Arg-Trp-Leu-Pro-NHEt. CAS No. 96497-82-4. Molecular formula: C64H83N17O12. Mole weight: 1282.45. | |
| sGnRH-A TFA | sGnRH-A is a GnRH peptide analog that acts as a GnRH antagonist. Alternative Names: H-Pyr-His-Trp-Ser-Tyr-D-Arg-Trp-Leu-Pro-NHEt.CH3CO2H; L-pyroglutamyl-L-histidyl-L-tryptophyl-L-seryl-L-tyrosyl-D-arginyl-L-tryptophyl-L-leucyl-L-proline ethylamide acetic acid. Molecular formula: C66H87N17O14. Mole weight: 1342.53. | |
| sgp91 ds-tat Peptide 2, scrambled | sgp91 ds-tat Peptide 2, scrambled is a scrambled sequence of NADPH oxidase inhibitor gp91 ds-tat peptide. It is used as a control peptide. Molecular formula: C98H190N50O22S. Mole weight: 2453. | |
| Shepherdin | Shepherdin 79-87 is amino acids 79 to 87 fragment of Shepherdin. Shepherdin makes extensive contacts with the ATP pocket of Hsp90, destabilizes its client proteins, and induces massive death of tumor cells by apoptotic and nonapoptotic mechanisms. Conversely, shepherdin does not reduce the viability of normal cells nor affect colony formation of purified hematopoietic progenitors. Systemic administration of shepherdin in vivo is well tolerated, and inhibits human tumor growth in mice without toxicity. Alternative Names: NSC-741765; L-Lysyl-L-histidyl-L-seryl-L-serylglycyl-L-cysteinyl-L-alanyl-L-phenylalanyl-3-methyl-L-valine. Grades: >98%. CAS No. 861224-28-4. Molecular formula: C41H64N12O12S. Mole weight: 949.09. | |
| Shepherin I | Shepherin I is an antibacterial peptide isolated from Capsella bursa-pastoris. It has activity against gram-negative bacteria and fungi. Alternative Names: Gly-Tyr-Gly-Gly-His-Gly-Gly-His-Gly-Gly-His-Gly-Gly-His-Gly-Gly-His-Gly-Gly-His-Gly-His-Gly-Gly-Gly-Gly-His-Gly. Grades: >96%. Molecular formula: C95H124N44O30. Mole weight: 2362.31. | |
| Shepherin II | Shepherin II is an antibacterial peptide isolated from Capsella bursa-pastoris. It has activity against gram-negative bacteria and fungi. Alternative Names: Gly-Tyr-His-Gly-Gly-His-Gly-Gly-His-Gly-Gly-Gly-Tyr-Asn-Gly-Gly-Gly-Gly-His-Gly-Gly-His-Gly-Gly-Gly-Tyr-Asn-Gly-Gly-Gly-His-His-Gly-Gly-Gly-Gly-His-Gly. Grades: >96%. Molecular formula: C133H172N56O44. Mole weight: 3259.18. | |
| SH-Oligopeptide-5 | Sh-Oligopeptide-5 is a cosmetic peptide that can be used for anti-wrinkle and whitening skin. Grades: 95%. Molecular formula: C24H44N8O10. Mole weight: 604.65. | |
| SHR-2042 | SHR-2042 is a novel glucagon-like peptide-1 recceptor agonist (GLP-1RA) with higher oral bioavailability. The oral bioavailability of SHR-2042 matched with SNAC is 3.39% (1:30, w/w) in monkeys, which is over 10 times higher than that of semaglutide. Alternative Names: SHR 2042; SHR2042. | |
| SHU 9119 | SHU 9119 is a potent antagonist at human melanocortin 3 (IC50 = 0.23 nM) and 4 receptors (IC50 = 0.06 nM), and a partial agonist at the hMC5R (IC50 = 0.09 nM). Alternative Names: L-Lysinamide, N-acetyl-L-norleucyl-L-α-aspartyl-L-histidyl-3-(2-naphthalenyl)-D-alanyl-L-arginyl-L-tryptophyl-, (2→7)-lactam; L-Lysinamide, N-acetyl-L-norleucyl-L-α-aspartyl-L-histidyl-3-(2-naphthalenyl)-D-alanyl-L-arginyl-L-tryptophyl-, cyclic (2→7)-peptide; MBX 36; SHU-9119; SHU9119. Grades: ≥95%. CAS No. 168482-23-3. Molecular formula: C54H71N15O9. Mole weight: 1074.24. | |
| Shuchin 1 | Shuchin 1 is an antibacterial peptide isolated from Rana shuchinae. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Alternative Names: Asn-Ala-Leu-Ser-Met-Pro-Arg-Asn-Lys-Cys-Asn-Arg-Ala-Leu-Met-Cys-Phe-Gly. Grades: >96%. Molecular formula: C83H140N28O23S4. Mole weight: 2026.44. | |
| Shuchin 2 | Shuchin 2 is an antibacterial peptide isolated from Rana shuchinae. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Alternative Names: Asn-Ala-Leu-Ser-Ser-Pro-Arg-Asn-Lys-Cys-Asp-Arg-Ala-Ser-Ser-Cys-Phe-Gly. Grades: >97%. Molecular formula: C76H125N27O27S2. Mole weight: 1913.11. | |
| Shuchin 3 | Shuchin 3 is an antibacterial peptide isolated from Rana shuchinae. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Alternative Names: Lys-Ala-Tyr-Ser-Met-Pro-Arg-Cys-Lys-Gly-Gly-Phe-Arg-Ala-Val-Met-Cys-Trp-Leu. Grades: >98%. | |
| Shuchin 4 | Shuchin 4 is an antibacterial peptide isolated from Rana shuchinae. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Alternative Names: Lys-Ala-Tyr-Ser-Thr-Pro-Arg-Cys-Lys-Gly-Leu-Phe-Arg-Ala-Leu-Met-Cys-Trp-Leu. Grades: >97%. | |
| Shuchin 5 | Shuchin 5 is an antibacterial peptide isolated from Rana shuchinae. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Alternative Names: Lys-Ala-Tyr-Ser-Met-Pro-Arg-Cys-Lys-Tyr-Leu-Phe-Arg-Ala-Val-Leu-Cys-Trp-Leu. Grades: >95%. | |
| SIA Crosslinker | SIA Crosslinker is a non-cleavable ADC linker used in the synthesis of antibody-drug conjugates (ADCs). Alternative Names: 2,5-Dioxopyrrolidin-1-yl 2-iodoacetate; N-Succinimidyl Iodoacetate; Iodoacetic acid N-hydroxysuccinimide ester. Grades: > 99.3 %. CAS No. 39028-27-8. Molecular formula: C6H6INO4. Mole weight: 283.02. | |
| SIalpha1 | SIalpha1 is an antibacterial peptide isolated from Sorghum bicolor (Seeds). It has activity against fungi. | |
| SIalpha2 | SIalpha2 is an antibacterial peptide isolated from Sorghum bicolor (Seeds). It has activity against fungi. | |
| Siamycin I | Siamycin I is a tricyclic peptide antibiotic originally isolated from Streptomyces sp. AA6532. It exhibits antiviral and antibacterial effects against HIV and HSV, as well as B. subtilis, M. luteus and S. aureus. Alternative Names: Siamycin I;164802-68-0;BMY 29304;CLGVGSCNDFAGCGYAIVCFW;FR901724;FR 901724;MS 271;DTXSID70167811;DA-51269. Grades: ≥85%. CAS No. 164802-68-0. Molecular formula: C97H131N23O26S4. Mole weight: 2163.48. | |
| Siamycin II | Siamycin II is an antibacterial peptide isolated from Streptomyces strains AA3891. It has activity against viruses. Alternative Names: Cys-Leu-Gly-Ile-Gly-Ser-Cys-Asn-Asp-Phe-Ala-Gly-Cys-Gly-Tyr-Ala-Ile-Val-Cys-Phe-Trp. CAS No. 164802-69-1. Molecular formula: C98H133N23O26S4. Mole weight: 2177.50. | |
| Sieber linker | Sieber linker. Alternative Names: 3-Hydroxy-xanthen-9-one; 3-Hydroxy-9H-xanthen-9-one; 3-Hydroxyxanthone; 9H-Xanthen-9-one, 3-hydroxy-; 3-oxidanylxanthen-9-one; KSC490E1T. Grades: ≥ 99% (HPLC). CAS No. 3722-51-8. Molecular formula: C13H8O3. Mole weight: 212.20. | |
| Sieber Resin | Sieber Resin. Alternative Names: 9-Fmoc-aminoxanthen-3-yloxy-polystyrene resin. | |
| Signiferin-2.1 | Signiferin-2.1 is an antibacterial peptide isolated from Crinia signifera. It has activity against gram-negative bacteria. Alternative Names: Ile-Ile-Gly-His-Leu-Ile-Lys-Thr-Ala-Leu-Gly-Met-Leu-Gly-Leu. Grades: >96%. Molecular formula: C72H129N19O16S. Mole weight: 1549.00. | |
Our database is helping our users find suppliers everyday.
