BOC Sciences provides a wide range of research chemicals and biochemicals including inhibitors, building blocks, GMP Products, impurities and metabolites, APIs for Veterinary, Natural Compounds, ADCs, Stem Cell Molecule and chiral compounds.
| Product | Description | |
|---|---|---|
| P15 | P15 is an antimicrobial peptide found in Cervus elaphus (New Zealand red deer), and has antimicrobial activity against gram-negative bacterium Escherichia coli O111 (MIC=0.3 μg/mL), gram-positive bacterium Staphylococcus aureus NCTC 4163 (MIC=1 μg/mL) and Fungi Candida albicans 3135A (MIC=3 μg/mL). Alternative Names: deer beta-defensin. Grades: >98%. |  |
| P-18 | P-18 is an antimicrobial peptide with anti-gram-positive bacteria, gram-negative bacteria, Cancer cells and Mammalian cells activity. The source of P-18 is Sequence reverse. Alternative Names: Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Pro-Lys-Phe-Leu-His-Leu-Ala-Lys-Lys-Phe; Cecropin A(1-8)-Magainin 2(1-12) hybrid peptide analogue; P18. Grades: ≥98%. Molecular formula: C118H186N28O19. Mole weight: 2300.95. | |
| P1, Human | It is a cell-penetrating peptide (CPP) derived from the human immunoglobulin heavy chain sequence. At low molar concentration, it can permeate cell membrane without obvious influence on cell membrane. CPP can bind macromolecules and be used as drug delivery vectors. Alternative Names: H-Met-Gly-Leu-Gly-Leu-His-Leu-Leu-Val-Leu-Ala-Ala-Ala-Leu-Gln-Gly-Ala-Trp-Ser-Gln-Pro-Lys-Lys-Lys-Arg-Lys-Val-OH; Human P1. Grades: 97%. Molecular formula: C134H229N39O31S. Mole weight: 2914.61. | |
| P21 | When administered peripherally to normal adult mice, the pentamer P21 significantly enhanced cognition, increased proliferation and neuronal differentiation of adult hippocampal progenitors and promoted the expression of synaptic vesicle proteins, synaptophysin and synapsin I. P21 induced enhancement of neurogenesis and maturation of newly born neurons in the granular cell layer and subgranular zone of the dentate gyrus. Alternative Names: Ac-Asp-Gly-Gly-Leu-adamantane-Gly-NH2; N-Acetyl-L-α-aspartylglycylglycyl-N-[(1s,3S,5R,7S)-3-(aminocarbonyl)tricyclo[3.3.1.13,7]dec-1-yl]-L-leucinamide. Grades: ≥95%. Molecular formula: C27H42N6O8. Mole weight: 578.66. | |
| P21 Peptide acetate | P21 Peptide has the effect of inhibiting protein transferase. Alternative Names: P21 Peptide. | |
| P22 N (14-30) | The peptide sequence is found in residues 14 to 30 of P22 N. P22 N is a transcriptional antiterminator that binds to N-utilization (NUT) sites on viral transcripts. P22 N modifies RNA polymerase activity by creating a termination-resistant form of the RNA polymerase complex that is able to continue transcribing the viral transcript. Alternative Names: H-Asn-Ala-Lys-Thr-Arg-Arg-His-Glu-Arg-Arg-Arg-Lys-Leu-Ala-Ile-Glu-Arg-OH; P22 N-(14-30); L-asparagyl-L-alanyl-L-lysyl-L-threonyl-L-arginyl-L-arginyl-L-histidyl-L-alpha-glutamyl-L-arginyl-L-arginyl-L-arginyl-L-lysyl-L-leucyl-L-alanyl-L-isoleucyl-L-alpha-glutamyl-L-arginine. Grades: ≥95%. Molecular formula: C90H164N40O24. Mole weight: 2190.55. | |
| p2Ca | p2Ca, a ligand containing 8 amino acids, is naturally processed and presented to the LD heterologous T-cell clone 2C. Alternative Names: H-Leu-Ser-Pro-Phe-Pro-Phe-Asp-Leu-OH; L-leucyl-L-seryl-L-prolyl-L-phenylalanyl-L-prolyl-L-phenylalanyl-L-alpha-aspartyl-L-leucine; p2Ca peptide; L-Leucine, N-(N-(N-(1-(N-(1-(N-L-leucyl-L-seryl)-L-prolyl)-L-phenylalanyl)-L-prolyl)-L-phenylalanyl)-L-alpha-aspartyl)-. Grades: ≥95%. CAS No. 142606-55-1. Molecular formula: C47H66N8O12. Mole weight: 935.07. | |
| p53 (103-111) | P53 has been described as ''the guardian of the genome'' because of its role in conserving stability by preventing genome mutation. Suppression of p53 in human breast cancer cells is shown to lead to increased CXCR5 chemokine receptor gene expression and activated cell migration in response to chemokine CXCL13. Alternative Names: Cellular tumor antigen p53 (103-111); NY-CO-13 (103-111); Tumor suppressor p53 (103-111). | |
| p53 (139-147) | P53 has been described as ''the guardian of the genome'' because of its role in conserving stability by preventing genome mutation. Suppression of p53 in human breast cancer cells is shown to lead to increased CXCR5 chemokine receptor gene expression and activated cell migration in response to chemokine CXCL13. Alternative Names: Cellular tumor antigen p53 (139-147); NY-CO-13 (139-147); Tumor suppressor p53 (139-147). | |
| p53 (149-157) | P53 has been described as ''the guardian of the genome'' because of its role in conserving stability by preventing genome mutation. Suppression of p53 in human breast cancer cells is shown to lead to increased CXCR5 chemokine receptor gene expression and activated cell migration in response to chemokine CXCL13. Alternative Names: Cellular tumor antigen p53 (149-157); NY-CO-13 (149-157); Tumor suppressor p53 (149-157). | |
| p53 17-26 | P53 (17-26) is the 17-26 amino acid fragment of P53. P53 (17-26) is the mdm-2-binding domain. Alternative Names: H-Glu-Thr-Phe-Ser-Asp-Leu-Trp-Lys-Leu-Leu-OH; L-alpha-glutamyl-L-threonyl-L-phenylalanyl-L-seryl-L-alpha-aspartyl-L-leucyl-L-tryptophyl-L-lysyl-L-leucyl-L-leucine; (2S,5S,8S,11S,14S,17S,20S,23S,26S,29S)-11-((1H-indol-3-yl)methyl)-29-amino-8-(4-aminobutyl)-23-benzyl-17-(carboxymethyl)-26-((R)-1-hydroxyethyl)-20-(hydroxymethyl)-2,5,14-triisobutyl-4,7,10,13,16,19,22,25,28-nonaoxo-3,6,9,12,15,18,21,24,27-nonaazadotriacontane-1,32-dioic acid. Grades: ≥95%. CAS No. 488118-64-5. Molecular formula: C60H90N12O17. Mole weight: 1251.43. | |
| p5 Ligand for Dnak and DnaJ | It is a high affinity ligand for DnaK and DnaJ and corresponds to the main binding site of the 23 residues part of the prosequence of mitochondrial aspartate aminotransferase. Alternative Names: Peptide p5; H-Cys-Leu-Leu-Leu-Ser-Ala-Pro-Arg-Arg-OH; L-cysteinyl-L-leucyl-L-leucyl-L-leucyl-L-seryl-L-alanyl-L-prolyl-L-arginyl-L-arginine; 2-[(2S)-2-({[(2S)-1-{N-[(2S,5S,8S,11S,14R)-14-Amino-1,4,7,10,13-pentahydroxy-2-(hydroxymethyl)-5,8,11-triisobutyl-15-sulfanyl-3,6,9,12-tetraazapentadeca-3,6,9,12-tetraen-1-ylidene]-L-alanyl}-2-pyrrolidinyl](hydroxy)methylene}amino)-5-carbamimidamido-1-hydroxypentylidene]-L-arginine. Grades: ≥95%. CAS No. 209518-24-1. Molecular formula: C44H81N15O11S. Mole weight: 1028.27. | |
| p5 Ligand for Dnak and DnaJ acetate | p5 Ligand for Dnak and DnaJ acetate is a high-affinity ligand for DnaK (E. coli Hsp70) and DnaJ (E. coli Hsp40) and corresponds to the main binding site of the 23 residues part of the prosequence of mitochondrial aspartate aminotransferase. Alternative Names: H-Cys-Leu-Leu-Leu-Ser-Ala-Pro-Arg-Arg-OH.CH3CO2H; L-Cysteinyl-L-leucyl-L-leucyl-L-leucyl-L-seryl-L-alanyl-L-prolyl-L-arginyl-L-arginine acetate salt; L-cysteinyl-L-leucyl-L-leucyl-L-leucyl-L-seryl-L-alanyl-L-prolyl-L-arginyl-L-arginine acetic acid. Grades: ≥95%. CAS No. 2803415-96-3. Molecular formula: C44H81N15O11S.C2H4O2. Mole weight: 1088.33. | |
| P9 | P9 is an antimicrobial peptide found in Cervus elaphus (New Zealand red deer), and has antibacterial activity. Grades: >98%. | |
| PA (224-233), Influenza | PA (224-233), Influenza, a 10-aa peptide, is a fragment of polymerase 2 protein in influenza A virus. Alternative Names: Ser-Ser-Leu-Glu-Asn-Phe-Arg-Ala-Tyr-Val; L-seryl-L-seryl-L-leucyl-L-alpha-glutamyl-L-asparagyl-L-phenylalanyl-L-arginyl-L-alanyl-L-tyrosyl-L-valine. Grades: ≥95%. CAS No. 271573-27-4. Molecular formula: C53H80N14O17. Mole weight: 1185.29. | |
| Pa-AMP2 | Pa-AMP2 is an antimicrobial peptide found in pokeweed seeds, Phytolacca americana, and has anti-gram-positive bacteria and fungal activity. Alternative Names: Phytolacca americana antimicrobial peptide 2. Grades: >98%. | |
| PAC-113 | PAC-113 an anti-fungal, for the treatment of oral candidiasis infections. Molecular formula: C71H109N27O14. Mole weight: 1564.82. | |
| PACAP (1-27), human, ovine, rat | Pituitary adenylate cyclase activating polypeptide (PACAP 1-27) is an endogenous neuropeptide showing considerable homology with vasoactive intestinal peptide (VIP). It is a potent PACAP receptor agonist. Alternative Names: PACAP 1-27; Pituitary Adenylate Cyclase Activating Polypeptide1-27; H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucinamide. Grades: ≥98% by HPLC. CAS No. 127317-03-7. Molecular formula: C142H224N40O39S. Mole weight: 3147.60. | |
| PACAP (1-27), human, ovine, rat acetate | PACAP (1-27), human, ovine, rat acetate is a neuropeptide originally isolated from the bovine hypothalamus, also found in humans and rats. It is a potent PACAP receptor agonist. Alternative Names: H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2.CH3CO2H; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucinamide acetic acid; Pituitary adenylate cyclase-activating peptide-27 (sheep) acetate. Grades: ≥95%. Molecular formula: C144H228N40O41S. Mole weight: 3207.71. | |
| PACAP (1-38), human, ovine, rat | PACAP 1-38, an endogenous neuropeptide, is a highly potent PACAP receptor agonist (Kd = 100 pM). It stimulates adenylate cyclase and phagocytosis. It is reported to serve as a neuronal survival factor. Alternative Names: PACAP 1-38; Pituitary Adenylate Cyclase-Activating Polypeptide 1-38; His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥99%. CAS No. 137061-48-4. Molecular formula: C203H331N63O53S. Mole weight: 4534.26. | |
| PACAP (1-38), human, ovine, rat TFA | PACAP (1-38), human, ovine, rat TFA, an endogenous neuropeptide, is a highly potent PACAP receptor agonist. It stimulates adenylate cyclase and phagocytosis. It is reported to serve as a neuronal survival factor. Alternative Names: Pituitary Adenylate Cyclase Activating Polypeptide 1-38 (TFA); His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2.TFA; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide trifluoroacetic acid. Grades: >98%. Molecular formula: C203H331N63O53S.C2HF3O2. Mole weight: 4648.28. | |
| PACAP-38 (16-38) (human, chicken, mouse, ovine, porcine, rat) | It has a strong, effective and sustained stimulating effect on the production of sympathetic NPY and catecholamines. PACAP is an effective activator of cAMP formation. Alternative Names: Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; Pituitary Adenylate Cyclase Activating Polypeptide-38 (16-38); PACAP-38 (16-38), human, mouse, rat; L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥95% by HPLC. CAS No. 144025-82-1. Molecular formula: C123H215N39O28S. Mole weight: 2720.33. | |
| PACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat) | PACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat) is distinguished as a bioactive peptide fragment. By binding and subsequently activating PAC1 receptors, it aids in the research of an array of ailments spanning neurodegenerative disorders to cardiovascular conditions. Alternative Names: H-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide; L-Lysinamide, glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparaginyl-. Grades: 95%. CAS No. 160489-86-1. Molecular formula: C61H110N24O14. Mole weight: 1403.68. | |
| PACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) | An activator of cAMP formation. It stimulates sympathetic neuronal NPY and catecholamine production. Alternative Names: PACAP-38 (31-38), human, mouse, rat; PACAP (31-38); Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥98%. CAS No. 138764-85-9. Molecular formula: C47H83N17O11. Mole weight: 1062.27. | |
| PACAP-38 (human, mouse, ovine, porcine, rat) | PACAP-38 (human, mouse, ovine, porcine, rat) is a multifunctional neuropeptide that interacts with PACAP receptors and vasoactive intestinal peptide receptors to enhance intracellular cyclic AMP levels and exert systemic effects. It is a PAC1 agonist that strongly increases α-secretase activity. Upregulation of the APP-degrading enzyme promotes non-amyloidogenic processing of APP by reducing Aβ40/42 production, and thus may contribute to the prevention of Alzheimer's disease. Intranasal application of PACAP-38 in APP[V717I]-transgenic mice promotes the production of Aβ-degrading enzyme neprilysin by inducing somatostatin. Alternative Names: Pituitary Adenylate Cyclase Activating Polypeptide-38 (human, mouse, ovine, porcine, rat); H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: 95%. CAS No. 124123-15-5. Molecular formula: C203H331N63O53S. Mole weight: 4534.32. | |
| PACAP (6-38), human, ovine, rat | PACAP 6-38 is a PACAP (pituitary adenylate cyclase-activating polypeptide) non-stimulating competitive antagonist (IC50 = 2 nM), with antitumor activity in vivo. And it inhibits PACAP(1-27)-induced stimulation of adenylate cyclase (Ki = 1.5 nM). Alternative Names: H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK; L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥99%. CAS No. 143748-18-9. Molecular formula: C182H300N56O45S. Mole weight: 4024.74. | |
| PACAP (6-38), human, ovine, rat TFA | It is a PACAP (pituitary adenylate cyclase-activating polypeptide) non-stimulating competitive antagonist with antitumor activity in vivo. It inhibits PACAP(1-27)-induced stimulation of adenylate cyclase. Alternative Names: Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2.TFA; L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide trifluoroacetic acid. Grades: >98%. Molecular formula: C182H300N56O45S.C2HF3O2. Mole weight: 4138.76. | |
| PACAP Related Peptide (1-29) (rat) | PACAP Related Peptide (1-29) (rat) entails an invaluable compound, effectively deployed to study an array of prevalent ailments. Its profound efficacy lies in its remarkable prowess to intricately govern the release of vital neurotransmitters, while simultaneously rendering indispensable neuroprotective attributes and studying inflammatory processes. Alternative Names: H-Asp-Val-Ala-His-Glu-Ile-Leu-Asn-Glu-Ala-Tyr-Arg-Lys-Val-Leu-Asp-Gln-Leu-Ser-Ala-Arg-Lys-Tyr-Leu-Gln-Ser-Met-Val-Ala-OH; L-alpha-aspartyl-L-valyl-L-alanyl-L-histidyl-L-alpha-glutamyl-L-isoleucyl-L-leucyl-L-asparagyl-L-alpha-glutamyl-L-alanyl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alpha-aspartyl-L-glutaminyl-L-leucyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-tyrosyl-L-leucyl-L-glutaminyl-L-seryl-L-methionyl-L-valyl-L-alanine. Grades: 95%. CAS No. 132769-35-8. Molecular formula: C148H242N42O45S. Mole weight: 3361.82. | |
| PACAP-Related Peptide (PRP), human | It is a 29 amino-acid region of the PACAP precursor protein. Alternative Names: Asp-Val-Ala-His-Gly-Ile-Leu-Asn-Glu-Ala-Tyr-Arg-Lys-Val-Leu-Asp-Gln-Leu-Ser-Ala-Gly-Lys-His-Leu-Gln-Ser-Leu-Val-Ala. Grades: ≥95%. Molecular formula: C139H229N41O42. Mole weight: 3146.55. | |
| PaD7 | PaD7 is an antimicrobial peptide found in Panulirus argus, and has antibacterial activity. Alternative Names: Pa-D7, Panusin. Grades: >98%. | |
| Paenicidin A | Paenicidin A is an antimicrobial peptide found in Paenibacillus polymyxa NRRL B-30509, and has antimicrobial activity. It is a highly cyclized lantibiotic, containing three lanthionines (between residues 3-7, 8-11, 19-24) and three methyllanthionine rings (between residues 16-20, 23-28, 30-36), three of which are interlocking. Alternative Names: paeA. Grades: >98%. | |
| PAF | PAF is an antimicrobial peptide found in Penicillium chrysogenum (Penicillium notatum), and has antifungal activity. Alternative Names: Penicillium Antifungal protein (PAF). Grades: >98%. | |
| PAF26 | PAF26 is a cell penetration peptide found in Screened from Synthetic Combinatorial Peptide Library. It has antifungal and antibacterial activity. Alternative Names: Ac-Arg-Lys-Lys-Trp-Phe-Trp-NH2; N-acetyl-L-arginyl-L-lysyl-L-lysyl-L-tryptophyl-L-phenylalanyl-L-tryptophanamide; L-Tryptophanamide, N2-acetyl-L-arginyl-L-lysyl-L-lysyl-L-tryptophyl-L-phenylalanyl-. Grades: ≥95%. Molecular formula: C51H70N14O7. Mole weight: 991.19. | |
| Paired box protein Pax-5 (311-319) | Paired box protein Pax-5 (311-319) is a bioactive peptide of Paired box protein Pax-5. Paired box protein Pax-5 is a transcription factor that plays an essential role in commitment of lymphoid progenitors to the B-lymphocyte lineage. Alternative Names: B-cell-specific transcription factor (311-319). | |
| Pal-Glu(OSu)-OH | Pal-Glu(OSu)-OH is a side chain of Liraglutide. Liraglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist that can be used for type 2 diabetes mellitus research. Alternative Names: (S)-5-((2,5-dioxopyrrolidin-1-yl)oxy)-5-oxo-2-palmitamidopentanoic acid. CAS No. 294855-91-7. Molecular formula: C25H42N2O7. Mole weight: 482.61. | |
| Pal-Glu(OSu)-Ome | Pal-Glu(OSu)-Ome. CAS No. 294855-90-6. Molecular formula: C26H44N2O7. Mole weight: 496.64. | |
| Palicourein | Palicourein is an antimicrobial peptide found in Palicourea condensata (Cappel), and has antiviral activity. Alternative Names: cyclo[Ala-Ala-Leu-Gly-Cys(1)-Thr-Cys(2)-Asp-Asp-Arg-Ser-Asp-Gly-Leu-Cys(3)-Lys-Arg-Asn-Gly-Asp-Pro-Thr-Phe-Cys(1)-Gly-Glu-Thr-Cys(2)-Arg-Val-Ile-Pro-Val-Cys(3)-Thr-Tyr-Ser]; (cyclo)-AALGC(1)TC(2)DDRSDGLC(3)KRNGDPTFC(1)GETC(2)RVIPVC(3)TYS-(cyclo); cyclo[L-alanyl-L-alanyl-L-leucyl-glycyl-L-cysteinyl-L-threonyl-L-cysteinyl-L-alpha-aspartyl-L-alpha-aspartyl-L-arginyl-L-seryl-L-alpha-aspartyl-glycyl-L-leucyl-L-cysteinyl-L-lysyl-L-arginyl-L-asparagyl-glycyl-L-alpha-aspartyl-L-prolyl-L-threonyl-L-phenylalanyl-L-cysteinyl-glycyl-L-alpha-glutamyl-L-threonyl-L-cysteinyl-L-arginyl-L-valyl-L-isoleucyl-L-prolyl-L-valyl-L-cysteinyl-L-threonyl-L-tyrosyl-L-seryl] (5->24),(7->28),(15->34)-tris(disulfide). Grades: >85%. CAS No. 331714-57-9. Molecular formula: C159H248N48O55S6. Mole weight: 3904.35. | |
| Paliperidone related compound C | An impurity of Paliperidone which is an active metabolite of RISPERIDONE and used as a second generation (atypical) antipsychotic agent. Alternative Names: Paliperidone USP RC C; Paliperidone USP Related Compound C; Paliperidone Chloroethyl Impurity. Grades: > 95%. CAS No. 130049-82-0. Molecular formula: C11H15ClN2O2. Mole weight: 242.71. | |
| Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Ala-Gly-OH | Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Ala-Gly-OH. Alternative Names: S-(2,3-Bis(palmitoyloxy)propyl)-N-palmitoylcysteinyl-alanyl-glycine; Pam(3)-cys-ala-gly; Tripalmitoyl-cysteinyl-alanyl-glycine; N-Palmitoyl-5,6-dipalmitoylcysteinyl-alanyl-glycine. Grades: 95%. CAS No. 117858-54-5. Molecular formula: C59H111N3O9S. Mole weight: 1038.59. | |
| Palmitoyl Dipeptide-18 | Palmitoyl Dipeptide-18 is a cosmetic ingredient known for its ability to promote the synthesis of matrix proteins, including collagen. It also increases the production of elastin, hyaluronic acid, glycosaminoglycans, and fibronectin. By enhancing the activity of matrix cells and promoting collagen synthesis, Palmitoyl Dipeptide-18 contributes to a more youthful and elastic appearance of the skin. This ingredient is characterized by its self-organizing properties in water, forming ribbon-like fibers that adhere to the skin when cosmetics containing it are applied, providing a smoothing effect. It is widely used in personal care products for its multifunctional benefits, including as a viscosity controlling agent. Alternative Names: N-Palmitoyl-Gly-His; N-(1-Oxohexadecyl)glycyl-L-histidine; ES 01; Nanofibergel ES 01; Nanofibergel HA 01; Nanofibergel OA 03; Nanofibergel TW 01W; Palmitoyl-Gly-His-OH; N-Palmitoyl-glycyl-L-histidine; Pal-Gly-His. Grades: ≥95%. CAS No. 1206591-87-8. Molecular formula: C24H42N4O4. Mole weight: 450.62. | |
| Palmitoyl Dipeptide-5 Diaminohydroxybutyrate | Palmitoyl Dipeptide-5 Diaminohydroxybutyrate is a bioactive peptide with anti-aging properties that is commonly used as a cosmetic ingredient. This peptide is known for its ability to stimulate the synthesis of proteins that are crucial for skin health and structure, such as laminin V, collagen IV, VII, and XVII, and integrin β4. By improving the dermal-epidermal junction (DEJ) function, it helps to restructure the skin, enhance intercellular communication, and promote the exchange of nutrients, which can reduce the signs of premature skin aging and damage. The use of Palmitoyl Dipeptide-5 Diaminohydroxybutyrate contributes to smoother skin, a reduction in the appearance of wrinkles, and a more youthful, firm complexion. Alternative Names: Palmitoyllysylvalyldiaminobutyric acid; Palmitoyl-Lys-Val-Dab-OH; N-Palmitoyl-L-lysyl-L-valyl-3-aminomethyl-L-alanine; Butanoic acid, N2-(1-oxohexadecyl)-L-lysyl-L-valyl-2,4-diamino-, (2S)-; (2S)-N2-(1-Oxohexadecyl)-L-lysyl-L-valyl-2,4-diaminobutanoic acid; Palmitoyllysylvalyldiaminobutyrate; Palmitoyl-KV-Dab. Grades: ≥90% by HPLC. CAS No. 794590-33-3. Molecular formula: C31H61N5O5. Mole weight: 583.85. | |
| Palmitoyl Dipeptide-7 | Palmitoyl Dipeptide-7. Alternative Names: Palmitoyl dipeptide-7; PAL-KT; Palmitoyl-lysine-threonine. Grades: 98%. CAS No. 911813-90-6. Molecular formula: C26H51N3O5. Mole weight: 485.7. | |
| Palmitoyl Hexapeptide-12 acetate | Palmitoyl hexapeptide-12 acetate can promote the proliferation of collagen, elastin, and hyaluronic acid. Palmitoyl hexapeptide-12 acetate can be used to improve the water content of the skin, increase the thickness of the dermis, and reduce microgrooves. Alternative Names: Pal-VGVAPG (acetate); palmitoyl-Val-Gly-Val-Ala-Pro-Gly-OH.CH3CO2H; N-palmitoyl-L-valyl-glycyl-L-valyl-L-alanyl-L-prolyl-glycine acetic acid. Grades: ≥95%. CAS No. 2763584-33-2. Molecular formula: C40H72N6O10. Mole weight: 797.03. | |
| Palmitoyl Hexapeptide-14 | Palmitoyl Hexapeptide-14 is a bioactive peptide that has been reported to possess anti-aging properties and is widely used in cosmetic products. This peptide is known for its ability to stimulate collagen production, which is essential for maintaining skin firmness and elasticity. It also promotes the proliferation of fibroblast cells, which are crucial for collagen production in the skin. Additionally, Palmitoyl Hexapeptide-14 has been shown to inhibit the activity of matrix metalloproteinases (MMPs), enzymes that can degrade collagen and contribute to the formation of wrinkles and fine lines. Alternative Names: Palmitoyl-Phe-Ala-Leu-Leu-Lys-Leu-NH2; Pal-FALLKL-NH2; N-Palmitoyl-L-phenylalanyl-L-alanyl-L-leucyl-L-leucyl-L-lysyl-L-leucinamide; N-(1-Oxohexadecyl)-L-phenylalanyl-L-alanyl-L-leucyl-L-leucyl-L-lysyl-L-leucinamide; Palmitoyl hexapeptide 14; Palmitoyl hexapeptide-6. Grades: ≥95%. CAS No. 891498-01-4. Molecular formula: C52H92N8O7. Mole weight: 941.34. | |
| Palmitoyl Isoleucine | Palmitoyl isoleucine, a cosmetic peptide, is known for its ability to enhance skin hydration, reduce inflammation, and promote skin repair by penetrating deeply into the skin layers, making it a valuable ingredient in skincare products for improving skin health and appearance. It has the effect of breast enhancement, lip enhancement, anti-inflammatory, moisturizing and repairing. Alternative Names: Palmitoyl-Ile-OH; Palmitoyl-L-isoleucine; Voluform; N-Palmitoyl isoleucine; N-Palmitoyl-L-isoleucine; L-Isoleucine, N-(1-oxohexadecyl)-; N-(1-Oxohexadecyl)-L-isoleucine; N-Hexadecanoyl-isoleucine. Grades: ≥95%. CAS No. 54617-29-7. Molecular formula: C22H43NO3. Mole weight: 369.58. | |
| Palmitoyl-Lys-Val-Ala | Palmitoyl-Lys-Val-Ala is a peptide compound known for its anti-aging properties in the beauty industry. It stimulates the synthesis of collagen and elastin, reduces wrinkles, enhances skin elasticity, and improves skin hydration and radiance. By promoting the production of key skin components such as collagen, hyaluronic acid, and glycosaminoglycans, it helps maintain skin health and youthfulness. Alternative Names: Palmitoyl Tripeptide; Palmitoyl-L-lysyl-L-valyl-L-alanine; Pal-Lys-Val-Ala-OH; Palmitoyl-Lys-Val-Ala-OH; Pal-KVA-OH. Grades: ≥95%. Molecular formula: C30H58N4O5. Mole weight: 554.82. | |
| Palmitoyl pentapeptide-4 hydrochloride | Palmitoyl pentapeptide-4 is a matrikine messenger peptide that can effectively promote the production of collagen, hyaluronic acid and elastic fibers in the skin, increase skin water content and moisture retention, increase skin thickness, enhance skin firmness and gloss, and eliminate static lines. Palmitoyl pentapeptide-4 addresses the skin condition at its source, rebuilding it from the inside out to reverse the skin aging process. Palmitoyl pentapeptide-4 exhibits anti-wrinkle activity and is used in cosmetics. Alternative Names: N2-(1-Oxohexadecyl)-L-lysyl-L-threonyl-L-threonyl-L-lysyl-L-serine hydrochloride; Matrixyl hydrochloride; Palmitoyl-KTTKS hydrochloride; Palmitoyl Pentapeptide hydrochloride; PAL-KTTKS hydrochloride. Grades: 98% by HPLC. Molecular formula: C39H76ClN7O10. Mole weight: 838.53. | |
| Palmitoyl-S-[2,3-bis(palmitoyloxy)-(2RS)-propyl]-L-cysteine | An extraordinary building block for the synthesis of amphiphilic acid water soluble lypopeptides. Alternative Names: Pam-L-Cys[(2,3-bis-PamO)Pr]-OH; Pam3-Cys-OH. Grades: ≥ 98% (TLC). CAS No. 70512-46-8. Molecular formula: C54H103NO7S. Mole weight: 910.50. | |
| Palmitoyl tetrapeptide-10 | Palmitoyl tetrapeptide-10 can be used in skin care products. Grades: 98%. CAS No. 887140-79-6. Molecular formula: C41H72N6O7. Mole weight: 761.04. | |
| Palmitoyl Tetrapeptide-20 Amide | Palmitoyl Tetrapeptide-20 Amide, with the sequence Pal-Pro-Glu-Lys-Lys-NH2, is a synthetic peptide that is widely used in the cosmetics industry for its potential to modulate skin pigmentation and support skin health. This peptide is known for its ability to mimic the effects of alpha-melanocyte-stimulating hormone (α-MSH), which can help in reducing the appearance of hyperpigmentation and promoting an even skin tone. Its lipophilic nature, due to the palmitoyl group, enhances its ability to penetrate the skin and deliver benefits effectively. It also promotes hair growth and eyelash growth. Alternative Names: Palmitoyl-Pro-Glu-Lys-Lys-NH2; N-palmitoyl-L-prolyl-L-alpha-glutamyl-L-lysyl-L-lysinamide; Pal-PEKK-NH2. Grades: ≥95%. Molecular formula: C38H71N7O7. Mole weight: 738.03. | |
| Palmitoyl Tetrapeptide-20 HCl | Palmitoyl tetrapeptide-20 is a biomimetic peptide and α-MSH agonist that protects follicular melanocytes by increasing the expression of catalase, activating melanin production and darkening hair. Alternative Names: PTP20 HCl; Pal-PEKK HCl; N-palmitoyl-L-prolyl-L-alpha-glutamyl-L-lysyl-L-lysine HCl. Grades: 98%. Molecular formula: C38H70N6O8.xHCl. Mole weight: 739.00 (free base). | |
| Palmitoyl tripeptide-1 acetate | Palmitoyl tripeptide-1 is a type I collagen fragment used to repair skin damage. CAS No. 1628252-62-9. Molecular formula: C30H54N6O5.xC2H4O2. | |
| Palmitoyl Tripeptide-38 Acetate | Palmitoyl tripeptide-38, consisting of three amino acids, is a di-oxidized lipopeptide. It rebuilds the skin from the inside where it is needed, smoothes wrinkles and soothes the skin, especially for forehead lines, crow's feet, forehead lines and necklines. Molecular formula: C35H69N5O9S. Mole weight: 736.00. | |
| Palmitoyl tripeptide 5 | Palmitoyl tripeptide-5 is a component of cell transduction, and promotes the production of collagen. It is commonly used in anti-aging and anti-wrinkle cosmetics. Palmitoyl tripeptide-5 promotes skin cell growth, inhibits oxygen and hydroxyl radicals, promotes matrixprotein synthesis, especially collagen, and may also increase the production of elastin, hyaluronic acid, glycosaminoglycan and fibronectin. This collagen peptide promotes collagen synthesis by increasing stromal cell activity, making the skin look more elastic and youthful. Alternative Names: L-Lysine, N2-(1-oxohexadecyl)-L-lysyl-L-valyl-; N2-(1-Oxohexadecyl)-L-lysyl-L-valyl-L-lysine; Palmitoyl tripeptide-5; SYN-COLL; palmitoyl-Lys-Val-Lys-OH; N-palmitoyl-L-lysyl-L-valyl-L-lysine; Palmitoyl-lysyl-valyl-lysine. Grades: >95%. CAS No. 623172-55-4. Molecular formula: C33H65N5O5. Mole weight: 611.90. | |
| Palmitoyl Tripeptide-8 | Palmitoyl tripeptide-8 is a multifunctional active ingredient that helps reduce irritation due to UV light, immune responses, and unconscious stress in and outside the body. Palmitoyl tripeptide-5 can down-regulate the mRNA levels of microphthalmia-associated transcription factor (MITF) and tyrosinase by inhibiting tyrosinase activity, thus inhibiting the production of melanin in melanocytes. Palmitoyl tripeptide-8 is a signaling cosmetic peptide that promotes collagen synthesis (types I, II and IV) and extracellular matrix protein production by increasing stromal cell activity, making skin look younger and more resilient. Alternative Names: N-(1-Oxohexadecyl)-L-histidyl-D-phenylalanyl-L-argininamide; palmitoyl-His-D-Phe-Arg-NH2; N-palmitoyl-L-histidyl-D-phenylalanyl-L-argininamide; N-((S)-1-(((R)-1-(((S)-1-amino-5-guanidino-1-oxopentan-2-yl)amino)-1-oxo-3-phenylpropan-2-yl)amino)-3-(1H-imidazol-5-yl)-1-oxopropan-2-yl)palmitamide. CAS No. 936544-53-5. Molecular formula: C37H61N9O4. Mole weight: 695.94. | |
| P-alpha | It is a synthetic peptide and cell-penetrating peptide. Alternative Names: H-Gly-Ala-Leu-Phe-Leu-Ala-Phe-Leu-Ala-Ala-Ala-Leu-Ser-Leu-Met-Gly-Leu-Trp-Ser-Gln-Pro-Lys-Lys-Lys-Arg-Arg-Val-OH. Molecular formula: C140H230N38O31S. Mole weight: 2973.68. | |
| PAL resin | PAL resin is useful for the synthesis of peptide amides using Fmoc strategy. Cleavage has been performed with 50% TFA in CH2Cl2 or 95% aqueous TFA. Scavengers may be required. Alternative Names: H2NCH2-Ph(OCH3)2-O-CH2-polymer; 4-Alkoxy-2,6-dimethoxybenzylamine resin. | |
| Palustrin-1a | Palustrin-1a is an antimicrobial peptide found in Rana palustris (Pickerel frog, Lithobates palustris), and has antibacterial activity against gram-negative bacterium E.coli. Alternative Names: Recombinant Rana palustris Palustrin-1a. Grades: >85%. Molecular formula: C144H238N38O35S3. Mole weight: 3157.85. | |
| Palustrin-1b | Palustrin-1b is an antimicrobial peptide found in Rana palustris (Pickerel frog, Lithobates palustris), and has antibacterial activity against gram-negative bacterium E.coli (MIC=8 μM). Alternative Names: Recombinant Rana palustris Palustrin-1b; Ala-Leu-Phe-Ser-Ile-Leu-Arg-Gly-Leu-Lys-Lys-Leu-Gly-Asn-Met-Gly-Gln-Ala-Phe-Val-Asn-Cys-Lys-Ile-Tyr-Lys-Lys-Cys (Disulfide bridge: Cys22-Cys28). Grades: ≥97%. Molecular formula: C143H237N39O34S3. Mole weight: 3142.89. | |
| Palustrin-1c | Palustrin-1c is an antimicrobial peptide found in Rana palustris (Pickerel frog, Lithobates palustris), and has antimicrobial activity against gram-negative bacterium E.coli (MIC=28 μM). Alternative Names: Recombinant Rana palustris Palustrin-1c; Ala-Leu-Ser-Ile-Leu-Arg-Gly-Leu-Glu-Lys-Leu-Ala-Lys-Met-Gly-Ile-Ala-Leu-Thr-Asn-Cys-Lys-Ala-Thr-Lys-Lys-Cys (Disulfide bridge: Cys21-Cys27). Grades: ≥95%. Molecular formula: C125H226N36O34S3. Mole weight: 2873.58. | |
| Palustrin-1d | Palustrin-1d is an antimicrobial peptide found in Rana palustris (Pickerel frog, Lithobates palustris), and has antibacterial activity against gram-negative bacterium E.coli (MIC=28 μM). Alternative Names: Recombinant Rana palustris Palustrin-1d; Ala-Leu-Ser-Ile-Leu-Lys-Gly-Leu-Glu-Lys-Leu-Ala-Lys-Met-Gly-Ile-Ala-Leu-Thr-Asn-Cys-Lys-Ala-Thr-Lys-Lys-Cys (Disulfide bridge: Cys21-Cys27). Grades: ≥95%. Molecular formula: C125H226N34O34S3. Mole weight: 2845.57. | |
| Palustrin-2a | Palustrin-2a is an antimicrobial peptide found in Rana palustris (Pickerel frog, Lithobates palustris), and has antibacterial activity against gram-negative bacterium E.coli. Alternative Names: Recombinant Rana palustris Palustrin-2a. Grades: >85%. Molecular formula: C137H233N41O42S2. Mole weight: 3190.74. | |
| Palustrin-2AJ1 | Palustrin-2AJ1 is an antimicrobial peptide found in Amolops jingdongensis (Chinese torrent frog), and has broad-spectrum antibacterial activity against a range of Gram-positive and Gram-negative bacteria. Alternative Names: PL2AJ1; Recombinant Amolops jingdongensis Palustrin-2AJ1; Gly-Phe-Met-Asp-Thr-Ala-Lys-Asn-Val-Ala-Lys-Asn-Val-Ala-Val-Thr-Leu-Ile-Asp-Lys-Leu-Arg-Cys-Lys-Val-Thr-Gly-Gly-Cys (Disulfide bridge: Cys23-Cys29). Grades: ≥98%. Molecular formula: C131H224N38O39S3. Mole weight: 3051.64. | |
| Palustrin-2AJ2 | Palustrin-2AJ2 is an antimicrobial peptide found in Amolops jingdongensis (Chinese torrent frog), and has broad-spectrum antibacterial activity against a range of Gram-positive and Gram-negative bacteria. Alternative Names: PL2AJ2; Recombinant Amolops jingdongensis Palustrin-2AJ2; Gly-Phe-Met-Asp-Thr-Ala-Lys-Gln-Val-Ala-Lys-Asn-Val-Ala-Val-Thr-Leu-Ile-Asp-Lys-Leu-Arg-Cys-Lys-Val-Thr-Gly-Gly-Cys (Disulfide bridge: Cys23-Cys29). Grades: ≥97%. Molecular formula: C132H226N38O39S3. Mole weight: 3065.67. | |
| Palustrin-2b | Palustrin-2b is an antimicrobial peptide found in Rana palustris (Pickerel frog, Lithobates palustris), and has antibacterial activity against gram-negative bacterium E.coli (MIC=78 μM). Alternative Names: Gly-Phe-Phe-Ser-Thr-Val-Lys-Asn-Leu-Ala-Thr-Asn-Val-Ala-Gly-Thr-Val-Ile-Asp-Thr-Leu-Lys-Cys-Lys-Val-Thr-Gly-Gly-Cys-Arg-Ser (Disulfide bridge: Cys23-Cys29); Recombinant Rana palustris Palustrin-2b. Grades: ≥97%. Molecular formula: C138H229N39O43S2. Mole weight: 3186.70. | |
| Palustrin-2c | Palustrin-2c is an antimicrobial peptide found in Rana palustris (Pickerel frog, Lithobates palustris), and has antibacterial activity against gram-negative bacterium E.coli (MIC=120 μM). Alternative Names: Recombinant Rana palustris Palustrin-2c; Gly-Phe-Leu-Ser-Thr-Val-Lys-Asn-Leu-Ala-Thr-Asn-Val-Ala-Gly-Thr-Val-Ile-Asp-Thr-Leu-Lys-Cys-Lys-Val-Thr-Gly-Gly-Cys-Arg-Ser (Disulfide bridge: Cys23-Cys29). Grades: ≥96%. Molecular formula: C135H231N39O43S2. Mole weight: 3152.68. | |
| Palustrin-2CE | Palustrin-2CE is an antimicrobial peptide found in Rana chensinensis (Chinese brown frog), and has antimicrobial activity against B.subtilis, P.aeruginosa, E.coli (MIC=5-30 μM) and S.aureus (MIC=90-100 μM), including resistant E.coli and S.aureus strains. Alternative Names: Gly-Leu-Trp-Asp-Ser-Ile-Lys-Asn-Phe-Gly-Lys-Thr-Ile-Ala-Leu-Asn-Val-Met-Asp-Lys-Ile-Lys-Cys-Lys-Ile-Gly-Gly-Gly-Cys-Pro-Pro (Disulfide bridge: Cys23-Cys29). Grades: ≥97%. Molecular formula: C148H241N39O40S3. Mole weight: 3302.97. | |
| Palustrin-2CG1 | Palustrin-2CG1 is an antimicrobial peptide found in Amolops chunganensis (Chungan torrent frog, Hylorana chunganensis), and has antimicrobial activity against a variety of Gram-positive and some Gram-negative bacterial strains. It has antifungal activity against slime mold isolate. It has hemolytic activity against human erythrocytes. Alternative Names: Gly-Leu-Trp-Asn-Thr-Ile-Lys-Glu-Ala-Gly-Lys-Lys-Phe-Ala-Ile-Asn-Val-Leu-Asp-Lys-Ile-Arg-Cys-Gly-Ile-Ala-Gly-Gly-Cys-Lys-Thr (Disulfide bridge: Cys23-Cys29). Grades: ≥97%. Molecular formula: C147H244N42O40S2. Mole weight: 3303.94. | |
| Palustrin-2ISb precursor protein | Palustrin-2ISb precursor protein is an antimicrobial peptide found in Odorrana ishikawae (Ishikawa frog), and has antibacterial and antifungal activity. Alternative Names: Leu-Trp-Asn-Ser-Ile-Lys-Ile-Ala-Gly-Lys-Lys-Leu-Phe-Val-Asn-Val-Leu-Asp-Lys-Ile-Arg-Cys-Lys-Val-Ala-Gly-Gly-Cys-Lys-Thr-Ser-Pro-Asp-Val-Glu. Grades: ≥97%. Molecular formula: C172H287N47O47S2. Mole weight: 3829.59. | |
| Palustrin-2ISc | Palustrin-2ISc is an antimicrobial peptide found in Odorrana ishikawae (Ishikawa's frog, Rana ishikawae), and has antimicrobial activity against gram-negative bacterium Escherichia coli (MIC=100 μM) and gram-positive bacterium Staphylococcus aureus (MIC=25 μM), Bacillus subtilis (MIC=12.5 μM). Alternative Names: Gly-Phe-Met-Asp-Thr-Ala-Lys-Asn-Val-Ala-Lys-Asn-Val-Ala-Ala-Thr-Leu-Leu-Asp-Lys-Leu-Lys-Cys-Lys-Ile-Thr-Gly-Gly-Cys (Disulfide bridge: Cys23-Cys29). Grades: ≥97%. Molecular formula: C130H222N36O39S3. Mole weight: 3009.60. | |
Our database is helping our users find suppliers everyday.
