BOC Sciences provides a wide range of research chemicals and biochemicals including inhibitors, building blocks, GMP Products, impurities and metabolites, APIs for Veterinary, Natural Compounds, ADCs, Stem Cell Molecule and chiral compounds.
| Product | Description | |
|---|---|---|
| pHLIP HM2b | pHLIP HM2b is a pH low insertion peptide used as a marker of low pH in tumor allografts and of malignant lesions. Alternative Names: Gly-Asp-Asn-Asn-Glu-Gly-Phe-Phe-Ala-Thr-Leu-Gly-Gly-Glu-Ile-Pro-Leu-Trp-Ser-Asp-Val-Val-Leu-Ala-Ile-Glu-Cys-Gly. Molecular formula: C131H195N31O43S. Mole weight: 2924.39. |  |
| pHLIP KC | pHLIP KC is a pH low insertion peptide used as a marker of low pH in tumor allografts and of malignant lesions. Alternative Names: Ac-Ala-Lys-Glu-Gln-Asn-Pro-Ile-Tyr-Trp-Ala-Arg-Tyr-Ala-Asp-Trp-Leu-Phe-Thr-Thr-Pro-Leu-Leu-Leu-Leu-Asp-Leu-Ala-Leu-Leu-Val-Asp-Ala-Asp-Glu-Cys-Thr. Molecular formula: C197H296N44O57S. Mole weight: 4225.03. | |
| pHLIP TM KC Var3 | pHLIP TM KC Var3 is a pH low insertion peptide used as a marker of low pH in tumor allografts and of malignant lesions. Alternative Names: Ac-Ala-Lys-Asp-Asp-Gln-Asn-Pro-Trp-Arg-Ala-Tyr-Leu-Asp-Leu-Leu-Phe-Pro-Thr-Asp-Thr-Leu-Leu-Leu-Asp-Leu-Leu-Trp-Cys-Gly. Molecular formula: C160H239N37O46S. Mole weight: 3449.10. | |
| pHLIP Var3 | pHLIP Var3 is a pH low insertion peptide used as a marker of low pH in tumor allografts and of malignant lesions. Alternative Names: pHLIP Variant 3; Ala-Cys-Asp-Asp-Gln-Asn-Pro-Trp-Arg-Ala-Tyr-Leu-Asp-Leu-Leu-Phe-Pro-Thr-Asp-Thr-Leu-Leu-Leu-Asp-Leu-Leu-Trp-Gly. Molecular formula: C152H225N35O44S. Mole weight: 3278.88. | |
| pHLIP W1 | pHLIP W1 is a pH low insertion peptide used as a marker of low pH in tumor allografts and of malignant lesions. Alternative Names: H-Ala-Asp-Asn-Asn-Pro-Trp-Ile-Tyr-Ala-Arg-Tyr-Ala-Asp-Leu-Thr-Thr-Phe-Pro-Leu-Leu-Leu-Leu-Asp-Leu-Ala-Leu-Leu-Val-Asp-Phe-Asp-Asp-OH. Molecular formula: C174H258N38O51. Mole weight: 3698.35. | |
| pHLIP W17-P7 | pHLIP W17-P7 is a pH low insertion peptide used as a marker of low pH in tumor allografts and of malignant lesions. Alternative Names: Ala-Asp-Asn-Asn-Pro-Phe-Pro-Tyr-Ala-Arg-Tyr-Ala-Asp-Leu-Thr-Thr-Trp-Ile-Leu-Leu-Leu-Leu-Asp-Leu-Ala-Leu-Leu-Val-Asp-Phe-Asp-Asp. Molecular formula: C174H258N38O51. Mole weight: 3698.35. | |
| pHLIP W2 | pHLIP W2 is a pH low insertion peptide used as a marker of low pH in tumor allografts and of malignant lesions. Alternative Names: H-Ala-Asp-Asn-Asn-Pro-Phe-Ile-Tyr-Ala-Arg-Tyr-Ala-Asp-Leu-Thr-Thr-Trp-Pro-Leu-Leu-Leu-Leu-Asp-Leu-Ala-Leu-Leu-Val-Asp-Phe-Asp-Asp-OH. Molecular formula: C174H258N38O51. Mole weight: 3698.35. | |
| pHLIP W30, R11 | pHLIP W30, R11 is a pH low insertion peptide used as a marker of low pH in tumor allografts and of malignant lesions. Alternative Names: Ala-Asp-Asn-Asn-Pro-Phe-Ile-Tyr-Ala-Tyr-Arg-Ala-Asp-Leu-Thr-Thr-Phe-Pro-Leu-Leu-Leu-Leu-Asp-Leu-Ala-Leu-Leu-Val-Asp-Trp-Asp-Asp. Molecular formula: C174H258N38O51. Mole weight: 3698.35. | |
| pHLIP W30, R15 | pHLIP W30, R15 is a pH low insertion peptide used as a marker of low pH in tumor allografts and of malignant lesions. Alternative Names: Ala-Asp-Asn-Asn-Pro-Phe-Ile-Tyr-Ala-Thr-Tyr-Ala-Asp-Leu-Arg-Thr-Phe-Pro-Leu-Leu-Leu-Leu-Asp-Leu-Ala-Leu-Leu-Val-Asp-Trp-Asp-Asp. Molecular formula: C174H258N38O51. Mole weight: 3698.35. | |
| PHM-27 (human) | PHM-27 (human) is an endogenous peptide analog of human prepro-VIP and potent agonist for the human calcitonin receptor. Alternative Names: PHM, Human; PHI Human; Peptide Histidine Methionine, Human; His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Phe-Ser-Lys-Leu-Leu-Gly-Gln-Leu-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Met-NH2. Grades: 98%. CAS No. 87403-73-4. Molecular formula: C135H214N34O40S. Mole weight: 2985.41. | |
| Phormia defensin A | Phormia defensin A is an antimicrobial peptide found in Phormia terranovae (Northern black blowfly), and has antibacterial activity against gram-positive bacteria. Alternative Names: Phormiadefensin A; Phormicin A; Insect defensin A. Grades: >98%. CAS No. 134090-74-7. Molecular formula: C163H270N58O52S6. Mole weight: 4066.65. | |
| Phormia defensin B | Phormia defensin B is an antimicrobial peptide found in Phormia terranovae (Northern black blowfly), and has antibacterial activity. Alternative Names: Phormicin B; Insect defensin B; Phormicin peptide B. Grades: >98%. CAS No. 119418-08-5. Molecular formula: C167H279N61O52S6. Mole weight: 4165.79. | |
| Phormicin precursor | Phormicin precursor is an antimicrobial peptide found in Protophormia terraenovae (Northern black blowfly), and has antibacterial activity. Grades: >98%. | |
| Phosphoramidon | Phosphoramide is an inhibitor of pyrolytic enzyme derived from the culture of Streptomyces tanashiensis. Alternative Names: N-(alpha-Rhamnopyranosyloxyhydroxyphosphinyl)-L-leucyl-L-tryptophan. Grades: >98%. CAS No. 119942-99-3. Molecular formula: C23H34N3O10P.xNa. Mole weight: 543.50 (free acid). | |
| Phosphorylase Kinase β-Subunit Fragment 420-436 | It is the β-subunit fragment (peptide 430-436) of phosphorylase kinase. Phosphokinase is a serine / threonine specific protein kinase that activates glycogen phosphorylase to release glucose-1-phosphate from glycogen. Alternative Names: Lys-Arg-Asn-Pro-Gly-Ser-Gln-Lys-Arg-Phe-Pro-Ser-Asn-Cys-Gly-Arg-Asp; L-lysyl-L-arginyl-L-asparagyl-L-prolyl-glycyl-L-seryl-L-glutaminyl-L-lysyl-L-arginyl-L-phenylalanyl-L-prolyl-L-seryl-L-asparagyl-L-cysteinyl-glycyl-L-arginyl-L-aspartic acid; Phosphorylase Kinase b-Subunit Fragment (420-436). Grades: ≥95%. CAS No. 150829-21-3. Molecular formula: C79H131N31O25S. Mole weight: 1947.14. | |
| Phrixotoxin 3 | Phrixotoxin 3, a peptide toxin produced by the Chilean copper tarantula (Paraphysa scrofa), is a potent blocker of voltage-gated sodium channels (IC50= 0.6, 42, and 72 nM for NaV1.2, NaV1.3 and NaV1.5 respectively). Alternative Names: 6-(phenylsulfinyl)-tetrazolo[1,5-b]pyridazine; DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI. Grades: >99%. CAS No. 880886-00-0. Molecular formula: C176H269N51O48S6. Mole weight: 4059.74. | |
| PhTD1 | PhTD1 is an antimicrobial peptide found in Papio hamadryas (Hamadryas baboon), and has antibacterial and antifungal activity. Alternative Names: PhTD-1; BTD 1; Baboon theta defensin 1; Cyclo(L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-arginyl-L-arginylglycyl-L-valyl-L-cysteinyl-L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-L-threonyl-rginylglycyl-L-phenylalanyl-cysteinyl), cyclic(2→11),(4→9),(13→18)-tris(disulfide); θ-Defensin 1 (Papio anubis); θ-Defensin 1 (Papio hamadryas); θ-Defensin 1 (baboon). Grades: >98%. CAS No. 1085365-19-0. Molecular formula: C80H133N33O19S6. Mole weight: 2053.51. | |
| PhTD3 | PhTD3 is an antimicrobial peptide found in Papio hamadryas (Hamadryas baboon), and has antibacterial and antifungal activity. Alternative Names: PhTD-3; BTD 3; Baboon theta defensin 3; Cyclo(L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-threonyl-L-arginylglycyl-L-phenylalanyl-L-cysteinyl-L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-L-threonyl-rginylglycyl-L-phenylalanyl-cysteinyl), cyclic(2→11),(4→9),(13→18)-tris(disulfide); θ-Defensin 3 (Papio anubis); θ-Defensin 3 (Papio hamadryas); θ-Defensin 3 (baboon). Grades: >98%. CAS No. 1085365-23-6. Molecular formula: C82H128N30O20S6. Mole weight: 2046.47. | |
| Pht-Gly-β-Ala-OH | Pht-Gly-β-Ala-OH. Alternative Names: Phthaloyl-glycyl-β-alanine; 3-(2-(1,3-Dioxoisoindolin-2-yl)acetamido)propanoic acid; Pht Gly β Ala OH. Grades: ≥ 99%. CAS No. 17896-84-3. Molecular formula: C13H12N2O5. Mole weight: 276.25. | |
| Phthaloyl-β-alanine | Phthaloyl-β-alanine. Alternative Names: Pht-β-Ala-OH; 3-(1,3-Dioxo-1,3-dihydro-isoindol-2-yl)propionic acid; 3-(1,3-Dioxoisoindolin-2-yl)propanoic acid; 3-Phthalimidopropionic acid; 2H-Isoindole-2-propanoic acid, 1,3-dihydro-1,3-dioxo-; 3-(1,3-Dioxo-1,3-dihydro-2H-isoindol-2-yl)propanoic acid; 3-(1,3-dioxo-2,3-dihydro-1H-isoindol-2-yl)propanoic acid; N-PHTHALOYL-BETA-ALANINE; PHT-BETA-ALA-OH; PHT BETA ALA OH. Grades: ≥ 98% (HPLC). CAS No. 3339-73-9. Molecular formula: C11H9NO4. Mole weight: 219.19. | |
| Phthaloyl-DL-glutamic acid | Phthaloyl-DL-glutamic acid. Alternative Names: Pht-DL-Glu-OH; 2-Phthalimidoglutaric acid; 2-(1,3-dioxoisoindolin-2-yl)pentanedioic acid. Grades: ≥ 98% (HPLC). CAS No. 2301-52-2. Molecular formula: C13H11NO6. Mole weight: 277.22. | |
| Phthaloyl-DL-Valine | Phthaloyl-DL-Valine. Alternative Names: Pht-DL-Val-OH; 2-(1,3-Dioxo-1,3-Dihydro-2H-Isoindol-2-Yl)-3-Methylbutanoic Acid. Grades: ≥ 98% (Assay). CAS No. 5115-65-1. Molecular formula: C13H13NO4. Mole weight: 247.24. | |
| Phthaloyl-glycine | Phthaloyl-glycine. Alternative Names: Pht-Gly-OH; Phthalimidoacetic acid. Grades: ≥ 99% (GC). CAS No. 4702-13-0. Molecular formula: C10H7NO4. Mole weight: 205.16. | |
| Phthaloyl-glycine 4-nitorophenyl ester | Phthaloyl-glycine 4-nitorophenyl ester. Alternative Names: Pht-Gly-Onp; 4-Nitrophenyl (1,3-Dioxo-1,3-Dihydro-2H-Isoindol-2-Yl)Acetate. Grades: ≥ 99% (HPLC). CAS No. 21313-49-5. Molecular formula: C16H10N2O6. Mole weight: 326.25. | |
| Phthaloyl-L-alanine | Phthaloyl-L-alanine. Alternative Names: Pht-L-Ala-OH; (S)-2-(1,3-Dioxoisoindolin-2-yl)propanoic acid. Grades: ≥ 98% (HPLC). CAS No. 4192-28-3. Molecular formula: C11H9NO4. Mole weight: 219.20. | |
| Phthaloyl-L-glutamic acid anhydride | Phthaloyl-L-glutamic acid anhydride. Alternative Names: Pht-L-Glu-anhydride; (S)-2-(2,6-Dioxotetrahydro-2H-Pyran-3-Yl)Isoindoline-1,3-Dione. Grades: ≥ 99%. CAS No. 25830-77-7. Molecular formula: C13H9NO5. Mole weight: 259.30. | |
| Phthaloyl-L-Leucine | Phthaloyl-L-Leucine. Alternative Names: Pht-L-Leu-OH; (S)-2-(1,3-Dioxoisoindolin-2-Yl)-4-Methylpentanoic Acid. Grades: ≥ 99% (HPLC). CAS No. 2419-38-7. Molecular formula: C14H15NO4. Mole weight: 261.28. | |
| Phthaloyl-S-methyl-L-cysteine | Phthaloyl-S-methyl-L-cysteine. Alternative Names: Pht-L-Cys(Me)-OH. Grades: ≥ 98%. Molecular formula: C12H11NO4S. Mole weight: 265.28. | |
| p-Hydroxyhippuric acid | p-Hydroxyhippuric acid. Alternative Names: p-Hydroxy-Bz-Gly-OH; 2-[(4-Hydroxyphenyl)formamido]acetic acid. Grades: ≥ 99% (titration). CAS No. 2482-25-9. Molecular formula: C9H9NO4. Mole weight: 195.17. | |
| p-Hydroxyhippuryl-His-Leu-OH | p-Hydroxyhippuryl-His-Leu-OH. Alternative Names: 4-Hydroxyhippuryl-histidyl-leucine; P-hydroxyhippuryl-his-leu; N-(N-(N-(4-Hydroxybenzoyl)glycyl)-L-histidyl)-L-leucine; (S)-2-((S)-2-(2-(4-hydroxybenzamido)acetamido)-3-(1H-imidazol-4-yl)propanamido)-4-methylpentanoic acid. Grades: 95%. CAS No. 77697-23-5. Molecular formula: C21H27N5O6. Mole weight: 445.47. | |
| Phylloseptin-1 precursor | Phylloseptin-1 precursor is an antimicrobial peptide found in Phyllomedusa sauvagii (Sauvage leaf frog), and has antibacterial activity. Alternative Names: Leu-Ser-Leu-Ile-Pro-His-Ile-Val-Ser-Gly-Val-Ala-Ser-Ile-Ala-Lys-His-Phe; PSN-1 precursor. Grades: ≥97%. Molecular formula: C89H145N23O22. Mole weight: 1889.28. | |
| Phylloseptin-H1 | Phylloseptin-H1 is an antimicrobial peptide found in Brazilian tree frog, Phylllomedusa hypochondrialis, South America, and has antibacterial activity. Alternative Names: Phylloseptin-1; PS-1; PSL-H1; PSN-1; Phe-Leu-Ser-Leu-Ile-Pro-His-Ala-Ile-Asn-Ala-Val-Ser-Ala-Ile-Ala-Lys-His-Asn-NH2; L-phenylalanyl-L-leucyl-L-seryl-L-leucyl-L-isoleucyl-L-prolyl-L-histidyl-L-alanyl-L-isoleucyl-L-asparaginyl-L-alanyl-L-valyl-L-seryl-L-alanyl-L-isoleucyl-L-alanyl-L-lysyl-L-histidyl-L-asparaginamide. Grades: ≥96%. Molecular formula: C93H151N27O23. Mole weight: 2015.40. | |
| Phylloseptin-H10 | Phylloseptin-H10 is an antimicrobial peptide found in Phyllomedusa hypochondrialis (Orange-legged monkey frog), and has antimicrobial activity. Alternative Names: PLS-H10; Phylloseptin 12; PS-12; PSN-12; Phe-Leu-Ser-Leu-Leu-Pro-Ser-Ile-Val-Ser-Gly-Ala-Val-Ser-Leu-Ala-Lys-Lys-Leu-NH2. Grades: >98%. CAS No. 950742-97-9. Molecular formula: C92H160N22O23. Mole weight: 1942.42. | |
| Phylloseptin-H11 | Phylloseptin-H11 is an antimicrobial peptide found in Phyllomedusa azurea (Orange-legged monkey frog), and has antimicrobial activity. Alternative Names: Phylloseptin 13; PS-13; PLS-H11; PSN-13; Phe-Leu-Ser-Leu-Ile-Pro-His-Ala-Ile-Asn-Ala-Val-Gly-Val-His-Ala-Lys-His-Phe-NH2; L-phenylalanyl-L-leucyl-L-seryl-L-leucyl-L-isoleucyl-L-prolyl-L-histidyl-L-alanyl-L-isoleucyl-L-asparaginyl-L-alanyl-L-valylglycyl-L-valyl-L-histidyl-L-alanyl-L-lysyl-L-histidyl-L-phenylalaninamide. Grades: ≥96%. CAS No. 950743-00-7. Molecular formula: C99H152N28O21. Mole weight: 2070.48. | |
| Phylloseptin-H12 | Phylloseptin-H12 is an antimicrobial peptide found in Phyllomedusa azurea (Orange-legged monkey frog), and has antimicrobial activity. Alternative Names: Phylloseptin 14; PLS-H12; PS-14; PSN-14. Grades: ≥95%. CAS No. 950743-01-8. Molecular formula: C92H144N22O24. Mole weight: 1942.29. | |
| Phylloseptin-H13 | Phylloseptin-H13 is an antimicrobial peptide found in Phyllomedusa hypochondrialis (Orange legged leaf frog), and has antimicrobial activity. Alternative Names: PLS-H13; Phylloseptin 15; PS-15; PSN-15. Grades: >98%. CAS No. 950742-99-1. Molecular formula: C94H154N26O22. Mole weight: 2000.38. | |
| Phylloseptin-H2 | Phylloseptin-H2 is an antimicrobial peptide found in Phyllomedusa hypochondrialis (Orange-legged leaf frog), and has antimicrobial activity. Alternative Names: Phylloseptin-2; PLS-H2; PS-2; PSN-2; Phe-Leu-Ser-Leu-Ile-Pro-His-Ala-Ile-Asn-Ala-Val-Ser-Thr-Leu-Val-His-His-Phe-NH2; L-phenylalanyl-L-leucyl-L-seryl-L-leucyl-L-isoleucyl-L-prolyl-L-histidyl-L-alanyl-L-isoleucyl-L-asparaginyl-L-alanyl-L-valyl-L-seryl-L-threonyl-L-leucyl-L-valyl-L-histidyl-L-histidyl-L-phenylalaninamide. Grades: ≥96%. Molecular formula: C101H155N27O23. Mole weight: 2115.51. | |
| Phylloseptin-H4 | Phylloseptin-H4 is an antimicrobial peptide found in Phyllomedusa hypochondrialis (Orange-legged leaf frog), and has antimicrobial activity. Alternative Names: PS-6; Phylloseptin 6; Phylloseptin H4; PSL-H4; PSN-6. Grades: >98%. CAS No. 850581-00-9. Molecular formula: C83H134N24O20. Mole weight: 1788.12. | |
| Phylloseptin-H5 | Phylloseptin-H5 is an antimicrobial peptide found in Phyllomedusa azurea, and has antibacterial activity. Alternative Names: PS-7; Phylloseptin H5; Phylloseptin 7; PSL-H5; PSN-7. Grades: >98%. CAS No. 920283-29-0. Molecular formula: C98H154N26O22. Mole weight: 2048.46. | |
| Phylloseptin-H7 | Phylloseptin-H7 is an antimicrobial peptide found in Phyllomedusa hypochondrialis, and has antimicrobial activity. Alternative Names: PLS-H7; PS-9; Phylloseptin 9; PSN-9. Grades: >98%. Molecular formula: C93H162N22O22. Mole weight: 1940.43. | |
| Phylloseptin-H8 | Phylloseptin-H8 is an antimicrobial peptide found in Phyllomedusa hypochondrialis (Orange legged leaf frog), and has antimicrobial activity. Alternative Names: PLS-H8; PS-10; Phylloseptin-10; PSN-10. Grades: >98%. Molecular formula: C94H164N22O23. Mole weight: 1970.44. | |
| Phylloseptin-H9 | Phylloseptin-H9 is an antimicrobial peptide found in Phyllomedusa hypochondrialis (Orange legged leaf frog), and has antimicrobial activity. Alternative Names: PLS-H9; Phylloseptin-11; PS-11; PSN-11. Grades: >98%. Molecular formula: C94H163N21O23. Mole weight: 1955.42. | |
| Phylloseptin-J1 | Phylloseptin-J1 is an antimicrobial peptide found in Phasmahyla jandaia (Jandaia leaf frog), and has antimicrobial activity. Alternative Names: PLS-J1; Phe-Leu-Ser-Leu-Ile-Pro-His-Ala-Ile-Asn-Ala-Ile-Ser-Ala-Ile-Ala-Asn-His-Phe-NH2; PS-J1; PSN-J1. Grades: ≥97%. Molecular formula: C97H150N26O23. Mole weight: 2048.43. | |
| Phylloseptin-J2 | Phylloseptin-J2 is an antimicrobial peptide found in Phasmahyla jandaia (Jandaia leaf frog), and has antimicrobial activity. Alternative Names: PLS-J2; Phe-Leu-Ser-Leu-Ile-Pro-His-Ala-Ile-Asn-Ala-Ile-Ser-Ala-Ile-Ala-Asp-His-Phe-NH2; PS-J2; PSN-J2. Grades: ≥98%. Molecular formula: C97H149N25O24. Mole weight: 2049.41. | |
| Phylloseptin-J3 | Phylloseptin-J3 is an antimicrobial peptide found in Phasmahyla jandaia (Jandaia leaf frog), and has antimicrobial activity. Alternative Names: PLS-J3; Phe-Leu-Ser-Leu-Ile-Pro-His-Ala-Ile-Asn-Ala-Ile-Ser-Ala-Ile-Ala-Asn-His-Leu-NH2; PS-J3; PSN-J3; L-phenylalanyl-L-leucyl-L-seryl-L-leucyl-L-isoleucyl-L-prolyl-L-histidyl-L-alanyl-L-isoleucyl-L-asparaginyl-L-alanyl-L-isoleucyl-L-seryl-L-alanyl-L-isoleucyl-L-alanyl-L-asparaginyl-L-histidyl-L-leucinamide. Grades: ≥95%. Molecular formula: C94H152N26O23. Mole weight: 2014.41. | |
| Phylloseptin-J4 | Phylloseptin-J4 is an antimicrobial peptide found in Phasmahyla jandaia (Jandaia leaf frog), and has antimicrobial activity. Alternative Names: PLS-J4; Phe-Leu-Ser-Leu-Ile-Pro-His-Ala-Ile-Asn-Ala-Ile-Ser-Ala-Ile-Ala-His-His-Leu-NH2; PS-J4; PSN-J4. Grades: ≥96%. Molecular formula: C96H153N27O22. Mole weight: 2037.45. | |
| Phylloseptin-J5 | Phylloseptin-J5 is an antimicrobial peptide found in Phasmahyla jandaia (Jandaia leaf frog), and has antimicrobial activity. Alternative Names: PLS-J5; Phe-Leu-Ser-Leu-Ile-Pro-His-Ala-Ile-Ser-Ala-Ile-Ser-Ala-Ile-Ala-His-His-Leu-NH2; PS-J5; PSN-J5; L-phenylalanyl-L-leucyl-L-seryl-L-leucyl-L-isoleucyl-L-prolyl-L-histidyl-L-alanyl-L-isoleucyl-L-seryl-L-alanyl-L-isoleucyl-L-seryl-L-alanyl-L-isoleucyl-L-alanyl-L-histidyl-L-histidyl-L-leucinamide. Grades: ≥98%. Molecular formula: C95H152N26O22. Mole weight: 2010.42. | |
| Phylloseptin-J6 | Phylloseptin-J6 is an antimicrobial peptide found in Phasmahyla jandaia (Jandaia leaf frog), and has antimicrobial activity. Alternative Names: PLS-J6; Phe-Leu-Ser-Leu-Ile-Pro-His-Ala-Ile-Ser-Ala-Ile-Ser-Ala-Ile-Ala-Asn-His-Leu-NH2; PS-J6; PSN-J6; L-phenylalanyl-L-leucyl-L-seryl-L-leucyl-L-isoleucyl-L-prolyl-L-histidyl-L-alanyl-L-isoleucyl-L-seryl-L-alanyl-L-isoleucyl-L-seryl-L-alanyl-L-isoleucyl-L-alanyl-L-asparaginyl-L-histidyl-L-leucinamide. Grades: ≥97%. Molecular formula: C93H151N25O23. Mole weight: 1987.38. | |
| Phylloseptin-J7 | Phylloseptin-J7 is an antimicrobial peptide found in Phasmahyla jandaia (Jandaia leaf frog), and has antimicrobial activity. Alternative Names: PLS-J7; Phe-Leu-Ser-Leu-Ile-Pro-His-Ala-Ile-Ser-Ala-Ile-Ser-Ala-Ile-Ala-Asp-His-Leu-NH2; PS-J7; PSN-J7; L-phenylalanyl-L-leucyl-L-seryl-L-leucyl-L-isoleucyl-L-prolyl-L-histidyl-L-alanyl-L-isoleucyl-L-seryl-L-alanyl-L-isoleucyl-L-seryl-L-alanyl-L-isoleucyl-L-alanyl-L-aspartyl-L-histidyl-L-leucinamide. Grades: ≥96%. Molecular formula: C93H150N24O24. Mole weight: 1988.37. | |
| Phylloseptin-L1 | Phylloseptin-L1 is an antimicrobial peptide found in Hylomantis lemur, Agalychnis callidryas (Lemur leaf frog, Red-eyed tree frog), and has activity against gram-positive bacteria Staphylococcus aureus (MIC=8 microM) and fungal Batrachochytrium dendrobatidis (MIC=100 microM). Alternative Names: PLS-L1; Leu-Leu-Gly-Met-Ile-Pro-Leu-Ala-Ile-Ser-Ala-Ile-Ser-Ala-Leu-Ser-Lys-Leu-NH2; L-leucyl-L-leucylglycyl-L-methionyl-L-isoleucyl-L-prolyl-L-leucyl-L-alanyl-L-isoleucyl-L-seryl-L-alanyl-L-isoleucyl-L-seryl-L-alanyl-L-leucyl-L-seryl-L-lysyl-L-leucinamide; PS-L1; PSN-L1. Grades: ≥97%. Molecular formula: C84H152N20O21S. Mole weight: 1810.32. | |
| Phylloseptin-O1 | Phylloseptin-O1 is an antimicrobial peptide found in Brazilian tree frog, Phyllomedusa hypochondrialis, South America, and has antibacterial activity. Alternative Names: PS-4; PLS-O1; Phe-Leu-Ser-Leu-Ile-Pro-His-Ala-Ile-Asn-Ala-Val-Ser-Thr-Leu-Val-His-His-Ser-NH2; PSN-O1; Phylloseptin-4. Grades: ≥96%. CAS No. 850582-18-2. Molecular formula: C95H151N27O24. Mole weight: 2055.42. | |
| Phylloseptin-O2 | Phylloseptin-O2 is an antimicrobial peptide found in Brazilian tree frog, Phyllomedusa hypochondrialis, South America, and has antibacterial activity. Alternative Names: PS-5; PLS-O2; Phe-Leu-Ser-Leu-Ile-Pro-His-Ala-Ile-Asn-Ala-Val-Ser-Ala-Ile-Ala-Lys-His-Ser-NH2; PSN-O2; Phylloseptin-5. Grades: ≥97%. CAS No. 850580-99-3. Molecular formula: C92H150N26O23. Mole weight: 1988.36. | |
| Phylloseptin-P1 | Phylloseptin-P1 is an antimicrobial peptide found in Phyllomedusa palliata (Jaguar leaf frog), and has antimicrobial activity. Alternative Names: PLS-P1; Leu-Ser-Leu-Ile-Pro-His-Ala-Ile-Asn-Ala-Val-Ser-Ala-Ile-Ala-Lys-His-Phe-NH2; PSN-P1; PS-P1; L-leucyl-L-seryl-L-leucyl-L-isoleucyl-L-prolyl-L-histidyl-L-alanyl-L-isoleucyl-L-asparaginyl-L-alanyl-L-valyl-L-seryl-L-alanyl-L-isoleucyl-L-alanyl-L-lysyl-L-histidyl-L-phenylalaninamide. Grades: ≥96%. Molecular formula: C89H145N25O21. Mole weight: 1901.29. | |
| Phylloxin | Phylloxin is an antimicrobial peptide found in South American two-colored leaf frog, Phyllomedusa bicolor, and has antibacterial activity. Alternative Names: H-Gly-Trp-Met-Ser-Lys-Ile-Ala-Ser-Gly-Ile-Gly-Thr-Phe-Leu-Ser-Gly-Ile-Gln-Gln-NH2; glycyl-L-tryptophyl-L-methionyl-L-seryl-L-lysyl-L-isoleucyl-L-alanyl-L-serylglycyl-L-isoleucylglycyl-L-threonyl-L-phenylalanyl-L-leucyl-L-serylglycyl-L-isoleucyl-L-glutaminyl-L-glutaminamide; PLX-B1. Grades: ≥98%. Molecular formula: C89H142N24O25S. Mole weight: 1980.32. | |
| Phylloxin-S1 | Phylloxin-S1 is an antimicrobial peptide found in Phyllomedusa sauvagei (Sauvage's leaf frog), and has antimicrobial activity. Alternative Names: Gly-Trp-Met-Ser-Lys-Ile-Ala-Ser-Gly-Ile-Gly-Thr-Phe-Leu-Ser-Gly-Val-Gln-Gln-NH2; PLX-S1; glycyl-L-tryptophyl-L-methionyl-L-seryl-L-lysyl-L-isoleucyl-L-alanyl-L-serylglycyl-L-isoleucylglycyl-L-threonyl-L-phenylalanyl-L-leucyl-L-serylglycyl-L-valyl-L-glutaminyl-L-glutaminamide. Grades: ≥97%. Molecular formula: C88H140N24O25S. Mole weight: 1966.29. | |
| PI230 | PI230 is an antimicrobial peptide found in Pisum sativum (Garden pea), and has antimicrobial activity. Alternative Names: Defensin-like protein 230. Grades: >98%. | |
| Piceain 1 | Piceain 1 is an antimicrobial peptide found in Picea sitchensis, and has activity against E.coli, P.aerμginosa, S.aureus and fungus C.albicans. It shows weak hemolysis activity. Alternative Names: H-Lys-Ser-Leu-Arg-Pro-Arg-Cys-Trp-Ile-Lys-Ile-Lys-Phe-Arg-Cys-Lys-Ser-Leu-Lys-Phe-OH; L-lysyl-L-seryl-L-leucyl-L-arginyl-L-prolyl-L-arginyl-L-cysteinyl-L-tryptophyl-L-isoleucyl-L-lysyl-L-isoleucyl-L-lysyl-L-phenylalanyl-L-arginyl-L-cysteinyl-L-lysyl-L-seryl-L-leucyl-L-lysyl-L-phenylalanine. Grades: ≥96%. Molecular formula: C118H197N35O23S2. Mole weight: 2538.18. | |
| Piceain 2 | Piceain 2 is an antimicrobial peptide found in Picea sitchensis, and has activity against E.coli, P.aeruginosa, S.aureus and fungus C.albicans. It shows weak hemolysis activity. Alternative Names: H-Arg-Pro-Arg-Cys-Trp-Ile-Lys-Ile-Lys-Phe-Arg-Cys-Lys-Ser-Leu-Lys-Phe-OH; L-arginyl-L-prolyl-L-arginyl-L-cysteinyl-L-tryptophyl-L-isoleucyl-L-lysyl-L-isoleucyl-L-lysyl-L-phenylalanyl-L-arginyl-L-cysteinyl-L-lysyl-L-seryl-L-leucyl-L-lysyl-L-phenylalanine. Grades: ≥95%. Molecular formula: C103H169N31O19S2. Mole weight: 2209.77. | |
| Pilosulin 1 | Pilosulin 1 is an antimicrobial peptide found in venom of Myrmecia pilosula (Jack jumper ant). It has anti-gram-positive bacteria, gram-negative bacteria, Fungi and Mammalian cells activity. Grades: ≥96%. | |
| Pilosulin 2 | Pilosulin 2 is an antimicrobial peptide found in Myrmecia pilosula (venom, Australia), and has antimicrobial activity. Alternative Names: H-Ile-Asp-Trp-Lys-Lys-Val-Asp-Trp-Lys-Lys-Val-Ser-Lys-Lys-Thr-Cys-Lys-Val-Met-Leu-Lys-Ala-Cys-Lys-Phe-Leu-Gly-OH (Disulfide bridge: Cys16-Cys23). Grades: ≥97%. Molecular formula: C149H246N38O34S3. Mole weight: 3210.02. | |
| Pilosulin 3 | Pilosulin 3 is an antimicrobial peptide found in Myrmecia banksi (venom, Australia), and has antibacterial activity against gram-negative bacteria Escherichia coli (MIC<25 μM) and gram-positive bacteria Staphylococcus aureus (MIC<25 μM), Bacillus subtilis (MIC<50 μM). Alternative Names: H-Ile-Ile-Gly-Leu-Val-Ser-Lys-Gly-Thr-Cys-Val-Leu-Val-Lys-Thr-Val-Cys-Lys-Lys-Val-Leu-Lys-Gln-Gly-OH (Disulfide bridge: Cys10-Cys17). Grades: ≥97%. Molecular formula: C113H206N30O29S2. Mole weight: 2513.19. | |
| Pilosulin 4 | Pilosulin 4 is an antimicrobial peptide found in Myrmecia banksi (Jack jumper ant), and has antibacterial activity against gram-negative bacteria Escherichia coli (MIC<6.25 μM), Pseudomonas aeruginosa (MIC<25 μM) and gram-positive bacteria Staphylococcus aureus (MIC<6.25 μM), Bacillus subtilis (MIC<50 μM). Alternative Names: H-Phe-Asp-Ile-Thr-Lys-Leu-Asn-Ile-Lys-Lys-Leu-Thr-Lys-Ala-Thr-Cys-Lys-Val-Ile-Ser-Lys-Gly-Ala-Ser-Met-Cys-Lys-Val-Leu-Phe-Asp-Lys-Lys-Lys-Gln-Glu-OH (Disulfide bridge: Cys16-Cys26). Grades: ≥97%. Molecular formula: C183H316N48O50S3. Mole weight: 4085.01. | |
| Pilosulin 5 | Pilosulin 5 is an antimicrobial peptide found in Myrmecia pilosula (Jack jumper ant, venom, Australia), and has antimicrobial activity. Alternative Names: Asp-Val-Lys-Gly-Met-Lys-Lys-Ala-Ile-Lys-Gly-Ile-Leu-Asp-Cys-Val-Ile-Glu-Lys-Gly-Tyr-Asp-Lys-Leu-Ala-Ala-Lys-Leu-Lys-Lys-Val-Ile-Gln-Gln-Leu-Trp-Glu. Grades: ≥95%. Molecular formula: C192H327N49O51S2. Mole weight: 4202.14. | |
| Pinealon | Pinealon has antioxidant activity and can directly interact with the cell genome. Alternative Names: L-Arginine, L-α-glutamyl-L-α-aspartyl-; L-Arginine, N2-(N-L-α-glutamyl-L-α-aspartyl)-; L-α-Glutamyl-L-α-aspartyl-L-arginine; Glu-Asp-Arg peptide; EDR; L-alpha-glutamyl-L-alpha-aspartyl-L-arginine. CAS No. 175175-23-2. Molecular formula: C15H26N6O8. Mole weight: 418.40. | |
| Pinealon acetate | Pinealon acetate has antioxidant activity and can directly interact with the cell genome. Alternative Names: H-Glu-Asp-Arg-OH.CH3CO2H; EDR.CH3CO2H; L-alpha-glutamyl-L-alpha-aspartyl-L-arginine acetic acid; L-Arginine, N2-(N-L-α-glutamyl-L-α-aspartyl)-, acetate salt; L-α-Glutamyl-L-α-aspartyl-L-arginine acetate salt. Grades: ≥95%. CAS No. 2703745-42-8. Molecular formula: C17H30N6O10. Mole weight: 478.45. | |
| Piperazine Trityl Resin | Pre-loaded resins for solid phase peptide and organic synthesis. | |
| Piperazinomethyl polystyrene | Resins for solid phase organic synthesis. Alternative Names: Polymer bound piperazine. | |
| Pis1 | Pis1 is an antimicrobial peptide found in Gadus morhua, and has antibacterial activity. Alternative Names: Phe-Ile-His-His-Ile-Ile-Gly-Trp-Ile-Ser-His-Gly-Val-Arg-Ala-Ile-His-Arg-Ala-Ile-His-Gly. Grades: ≥97%. Molecular formula: C118H179N39O24. Mole weight: 2527.98. | |
| Pis2 | Pis2 is an antimicrobial peptide found in Gadus morhua, and has anti-gram-negative bacteria (Y. ruckeric NCIMB 2196 and P. immobilisc NCIMB 308 (MIC 2.5-5 uM)) and antiparasitic activity. Alternative Names: Phe-Leu-His-His-Ile-Val-Gly-Leu-Ile-His-His-Gly-Leu-Ser-Leu-Phe-Gly-Asp-Arg-Ala-Asp. Grades: ≥97%. Molecular formula: C109H164N32O27. Mole weight: 2354.71. | |
| Piscidin 4 | Piscidin 4 is an antimicrobial peptide found in hybrid striped bass (Morone chrysops female x M. saxatilis male), and has potent and broad-spectrum antibacterial activity. Grades: >98%. | |
Our database is helping our users find suppliers everyday.
