BOC Sciences provides a wide range of research chemicals and biochemicals including inhibitors, building blocks, GMP Products, impurities and metabolites, APIs for Veterinary, Natural Compounds, ADCs, Stem Cell Molecule and chiral compounds.
| Product | Description | |
|---|---|---|
| (-)-Protolichesterinic acid | (-)-Protolichesterinic acid. Alternative Names: Protolichesterinic acid; (2S,3R)-4-methylene-5-oxo-2-tridecyltetrahydrofuran-3-carboxylic acid; 3-Furancarboxylic acid, tetrahydro-4-methylene-5-oxo-2-tridecyl-, (2S,3R)-; (2S)-2β-Tridecyl-4-methylene-5-oxotetrahydrofuran-3α-carboxylic acid; 3-Furancarboxylic acid, tetrahydro-4-methylene-5-oxo-2-tridecyl-, (2S,trans)-; succinic acid, (1-hydroxytetradecyl)methylene-, γ-lactone. CAS No. 493-46-9. Molecular formula: C19H32O4. Mole weight: 324.45. |  |
| Proto-oncogene PIM1 (191-199) | Proto-oncogene PIM1 (191-199) is a 9-aa peptide. Pim-1's role in oncogenic signalling has led to it becoming a widely studied target in cancer research, with numerous drug candidates under investigation which target it. | |
| PROTO_PROSY Protonectin | PROTO_PROSY Protonectin is an antimicrobial peptide found in Protonectarina sylveirae (Brazilian wasp), and has antibacterial activity against both gram-positive and gram-negative bacteria. It shows potent histamine releasing activities on rat peritoneal mast cells. Alternative Names: Ile-Leu-Gly-Thr-Ile-Leu-Gly-Leu-Leu-Lys-Gly-Leu; Protonectin. Grades: ≥96%. Molecular formula: C58H107N13O14. Mole weight: 1210.57. | |
| Pro-Trp-OH | Pro-Trp-OH. Alternative Names: L-Prolyl-L-tryptophan; Pro Trp OH. Grades: ≥ 99% (TLC). CAS No. 35310-39-5. Molecular formula: C16H19N3O3. Mole weight: 301.35. | |
| ProTx I | ProTx I, a toxin that was originally isolated from the venom of Thrixopelma pruriens (Peruvian green velvet tarantula), blocks native mouse CaV3.1 channel and recombinant human CaV3.1 channel currents similarly, and blocks to a lesser extent CaV3.2 and CaV3.3 channel currents. Alternative Names: ProTxI; ProTx-I; H-Glu-Cys(1)-Arg-Tyr-Trp-Leu-Gly-Gly-Cys(2)-Ser-Ala-Gly-Gln-Thr-Cys(3)-Cys(1)-Lys-His-Leu-Val-Cys(2)-Ser-Arg-Arg-His-Gly-Trp-Cys(3)-Val-Trp-Asp-Gly-Thr-Phe-Ser-OH; L-alpha-glutamyl-L-cysteinyl-L-arginyl-L-tyrosyl-L-tryptophyl-L-leucyl-glycyl-glycyl-L-cysteinyl-L-seryl-L-alanyl-glycyl-L-glutaminyl-L-threonyl-L-cysteinyl-L-cysteinyl-L-lysyl-L-histidyl-L-leucyl-L-valyl-L-cysteinyl-L-seryl-L-arginyl-L-arginyl-L-histidyl-glycyl-L-tryptophyl-L-cysteinyl-L-valyl-L-tryptophyl-L-alpha-aspartyl-glycyl-L-threonyl-L-phenylalanyl-L-serine (2->16),(9->21),(15->28)-tris(disulfide). Grades: >98%. CAS No. 484598-35-8. Molecular formula: C171H245N53O47S6. Mole weight: 3987.51. | |
| ProTx II | ProTx II is a selective NaV1.7 channel blocker with 100-fold selectivity over other sodium channel subtypes. Alternative Names: YCQKWMWTCDSERKCCEGMVCRLWCKKKLW. Grades: >98%. CAS No. 484598-36-9. Molecular formula: C168H250N46O41S8. Mole weight: 3826.59. | |
| ProTx III | ProTx III, isolated from the venom of the Peruvian green-velvet tarantula Thrixopelma pruriens, is a potent Nav1.7 blocker (IC50 = 2.5 nM) and also inhibits Nav1.1, Nav1.2, Nav1.3 and Nav1.6 in the nanomolar range. Alternative Names: DCLKFGWKCNPRNDKCCSGLKCGSNHNWCKLHI. Grades: >98%. Molecular formula: C162H246N52O43S6. Mole weight: 3802.41. | |
| Pro-Tyr-OH | Pro-Tyr-OH. Alternative Names: L-Prolyl-L-tyrosine; Pro Tyr OH. Grades: ≥ 99% (Assay). CAS No. 19786-36-8. Molecular formula: C14H18N2O4. Mole weight: 278.31. | |
| PrP 106-126 (human) | Prion Protein 106-126 (human), a peptide fragment of the cellular prion protein PrP, is used as a model to investigate neurodegeneration in prion diseases. It exhibits neurotoxicity caused by amplification of PrPC-associated signaling responses and induces NF-κB-mediated apoptosis in the mouse neuroblastoma cell line N2a. Alternative Names: Prion Protein Fragment 106-126 Human; Prion Protein 106-126 (human); Lys-Thr-Asn-Met-Lys-His-Met-Ala-Gly-Ala-Ala-Ala-Ala-Gly-Ala-Val-Val-Gly-Gly-Leu-Gly; L-lysyl-L-threonyl-L-asparagyl-L-methionyl-L-lysyl-L-histidyl-L-methionyl-L-alanyl-glycyl-L-alanyl-L-alanyl-L-alanyl-L-alanyl-glycyl-L-alanyl-L-valyl-L-valyl-glycyl-glycyl-L-leucyl-glycine. Grades: ≥95%. CAS No. 148439-49-0. Molecular formula: C80H138N26O24S2. Mole weight: 1912.24. | |
| PSA1 141-150 | PSA1 (141-150) is a prostate-specific antigen 1 peptide used for immunotherapy in cancer trials. Alternative Names: Phe-Leu-Thr-Pro-Lys-Lys-Leu-Gln-Cys-Val; L-phenylalanyl-L-leucyl-L-threonyl-L-prolyl-L-lysyl-L-lysyl-L-leucyl-L-glutaminyl-L-cysteinyl-L-valine. Grades: ≥95%. CAS No. 160215-60-1. Molecular formula: C55H93N13O13S. Mole weight: 1176.47. | |
| PSA1 141-150 acetate | PSA1 (141-150) is a prostate-specific antigen 1 peptide used for immunotherapy in cancer trials. Molecular formula: C57H97N13O15S. Mole weight: 1236.52. | |
| Psacotheasin | Psacotheasin is a 34-mer knottin-type antimicrobial peptide found in Psacothea hilaris larvae. It has antifungal properties but has no hemolytic activity against human erythrocytes. It has antibacterial activity against both gram-positive and gram-negative bacterial strains. Grades: >98%. Molecular formula: C143H220N46O44S6. Mole weight: 3479.96. | |
| Psalmopeotoxin-1 | Psalmopeotoxin-1 is an antimicrobial peptide found in Psalmopoeus cambridgei (Trinidad chevron tarantula), and has antiparasitic activity against Plasmodium falciparum (IC50=1.59 μM). Alternative Names: U1-theraphotoxin-Pc1a; U1-TRTX-Pc1a; PcFK1. Grades: >98%. Molecular formula: C153H247N47O43S6. Mole weight: 3625.29. | |
| Psalmopeotoxin-2 | Psalmopeotoxin-2 is an antimicrobial peptide found in Psalmopoeus cambridgei (Trinidad chevron tarantula), and has antiparasitic activity against Plasmodium falciparum (IC50=1.15 μM). Alternative Names: U2-theraphotoxin-Pc1a; U2-TRTX-Pc1a; PcFK2. Grades: >98%. Molecular formula: C116H203N41O35S7. Mole weight: 2956.56. | |
| Psalmotoxin 1 | Psalmotoxin 1 (PcTx1) is a potent and selective acid-sensing ion channel 1a (ASIC1a) blocker (IC50 = 0.9 nM) and not other members of the family. The blockade is rapidly reversible. PcTx1 has been successfully expressed to produce a spider toxin of the drosophila melanogaster S2 cell for the first time. It displays potent analgesic properties against thermal, mechanical, chemical, inflammatory and neuropathic pain in rodents. Alternative Names: PcTx1; Psalmopoeus cambridgei toxin-1; Glu-Asp-Cys-Ile-Pro-Lys-Trp-Lys-Gly-Cys-Val-Asn-Arg-His-Gly-Asp-Cys-Cys-Glu-Gly-Leu-Glu-Cys-Trp-Lys-Arg-Arg-Arg-Ser-Phe-Glu-Val-Cys-Val-Pro-Lys-Thr-Pro-Lys-Thr (Disulfide bridge: Cys3-Cys18, Cys10-Cys23, Arg17-Cys33); L-alpha-glutamyl-L-alpha-aspartyl-L-cysteinyl-L-isoleucyl-L-prolyl-L-lysyl-L-tryptophyl-L-lysyl-glycyl-L-cysteinyl-L-valyl-L-asparagyl-L-arginyl-L-histidyl-glycyl-L-alpha-aspartyl-L-cysteinyl-L-cysteinyl-L-alpha-glutamyl-glycyl-L-leucyl-L-alpha-glutamyl-L-cysteinyl-L-tryptophyl-L-lysyl-L-arginyl-L-arginyl-L-arginyl-L-seryl-L-phenylalanyl-L-alpha-glutamyl-L-valyl-L-cysteinyl-L-valyl-L-prolyl-L-lysyl-L-threonyl-L-prolyl-L-lysyl-L-threonine (3->18),(10->23),(17->33)-tris(disulfide). Grades: >98%. Molecular formula: C200H312N62O57S6. Mole weight: 4689.41. | |
| pSAS10 | pSAS10 is an antimicrobial peptide found in seeds, cowpea, Vigna unguiculata, and has antifungal activity. Alternative Names: Defensin-like protein (Clone PSAS10; Plant defensin). Grades: >98%. Molecular formula: C220H349N73O73S8. Mole weight: 5441.12. | |
| PSCA (14-22) | PSCA (14-22) is amino acids 14 to 22 fragment of PSCA. Prostate Stem Cell Antigen is involved in the regulation of cell proliferation and has a cell-proliferation inhibition activity in vitro. Alternative Names: Prostate Stem Cell Antigen (14-22). | |
| PsDef1 | PsDef1 is an antimicrobial peptide found in Scots pine, Pinus sylvestris, and has antifungal activity against Botrytis cinerea (IC50=0.4 μg/ml), Fusarium oxysporum (IC50=2.9 μg/ml), Fusarium solani (IC50=0.9 μg/ml), Heterobasidion annosum (IC50=1.4 μg/ml), Candida albicans and Trichoderma reesei. Alternative Names: Pinus sylvestris defensin 1; P. sylvestris defensin 1, p1. Grades: >98%. Molecular formula: C238H369N71O68S9. Mole weight: 5601.52. | |
| Pseudhymenochirin-1Pb | Pseudhymenochirin-1Pb is an antimicrobial peptide found in skin secretions, Merlins clawed frog, Pseudhymenochirus merlini, Africa, and has anti-gram-negative bacteria, gram-positive bacteria and fungal activity. Alternative Names: Ile-Lys-Ile-Pro-Ser-Phe-Phe-Arg-Asn-Ile-Leu-Lys-Lys-Val-Gly-Lys-Glu-Ala-Val-Ser-Leu-Ile-Ala-Gly-Ala-Leu-Lys-Gln-Ser. Grades: ≥97%. Molecular formula: C147H251N39O37. Mole weight: 3156.86. | |
| Pseudhymenochirin-2Pa | Pseudhymenochirin-2Pa is an antimicrobial peptide found in skin secretions, Merlins clawed frog, Pseudhymenochirus merlini, Africa, and has anti-gram-negative bacteria, gram-positive bacteria and fungal activity. Alternative Names: Gly-Ile-Phe-Pro-Ile-Phe-Ala-Lys-Leu-Leu-Gly-Lys-Val-Ile-Lys-Val-Ala-Ser-Ser-Leu-Ile-Ser-Lys-Gly-Arg-Thr-Glu. Grades: ≥97%. Molecular formula: C135H230N34O34. Mole weight: 2873.53. | |
| Pseudin-1 | Pseudin-1 is an amphipathic alpha-helical antimicrobial peptide found in Pseudis paradoxa (Paradoxical frog), and has antibacterial activity against gram-negative bacteria Escherichia coli and gram-positive bacteria Staphylococcus aureus, and has anti-yeast activity against Candida albicans. Alternative Names: H-Gly-Leu-Asn-Thr-Leu-Lys-Lys-Val-Phe-Gln-Gly-Leu-His-Glu-Ala-Ile-Lys-Leu-Ile-Asn-Asn-His-Val-Gln-OH; Pseudin 1; glycyl-L-leucyl-L-asparagyl-L-threonyl-L-leucyl-L-lysyl-L-lysyl-L-valyl-L-phenylalanyl-L-glutaminyl-glycyl-L-leucyl-L-histidyl-L-alpha-glutamyl-L-alanyl-L-isoleucyl-L-lysyl-L-leucyl-L-isoleucyl-L-asparagyl-L-asparagyl-L-histidyl-L-valyl-L-glutamine. Grades: ≥96%. Molecular formula: C123H204N36O33. Mole weight: 2715.20. | |
| Pseudin-2 | Pseudin-2, a cationic α-helical peptide originally isolated from paradoxical frog skin, has antimicrobial activity based on the Pseudis paradox. It stimulates insulin secretion in Brin-BD11 cells through a Ca2+-independent mechanism. Alternative Names: H-Gly-Leu-Asn-Ala-Leu-Lys-Lys-Val-Phe-Gln-Gly-Ile-His-Glu-Ala-Ile-Lys-Leu-Ile-Asn-Asn-His-Val-Gln-OH; glycyl-L-leucyl-L-asparagyl-L-alanyl-L-leucyl-L-lysyl-L-lysyl-L-valyl-L-phenylalanyl-L-glutaminyl-glycyl-L-isoleucyl-L-histidyl-L-alpha-glutamyl-L-alanyl-L-isoleucyl-L-lysyl-L-leucyl-L-isoleucyl-L-asparagyl-L-asparagyl-L-histidyl-L-valyl-L-glutamine. Grades: ≥95%. CAS No. 388602-02-6. Molecular formula: C122H202N36O32. Mole weight: 2685.17. | |
| Pseudin-3 | Pseudin-3 is an antibacterial peptide isolated from Pseud is paradoxa. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Alternative Names: Gly-Ile-Asn-Thr-Leu-Lys-Lys-Val-Ile-Gln-Gly-Leu-His-Glu-Val-Ile-Lys-Leu-Val-Ser-Asn-His-Glu. Grades: >97%. Molecular formula: C115H197N33O33. Mole weight: 2570.03. | |
| Pseudin-4 | Pseudin-4 is an antibacterial peptide isolated from Pseud is paradoxa. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Alternative Names: Gly-Ile-Asn-Thr-Leu-Lys-Lys-Val-Ile-Gln-Gly-Leu-His-Glu-Val-Ile-Lys-Leu-Val-Ser-Asn-His-Ala. Grades: >96%. Molecular formula: C113H195N33O31. Mole weight: 2511.99. | |
| Pseudo-hevein | Pseudo-hevein is an antibacterial peptide isolated from Hevea brasiliensis. It has activity against fungi. Alternative Names: Glu-Gln-Cys-Gly-Arg-Gln-Ala-Gly-Gly-Lys-Leu-Cys-Pro-Asn-Asn-Leu-Cys-Cys-Ser-Gln-Tyr-Gly-Trp-Cys-Gly-Ser-Ser-Asp-Asp-Tyr-Cys-Ser-Pro-Ser-Lys-Asn-Cys-Gln-Ser-Asn-Cys-Lys-Gly-Gly-Gly. | |
| PSMA (27-38) | Prostate-specific membrane antigen (PSMA) is considered an ideal target for antigen-redirected immunotherapy because it is expressed at the surface of prostate cancer cells, present in all tumor stages, and shows an increased expression in androgen-independent and metastatic stages of the disease. Alternative Names: Prostate-specific membrane antigen (27-38). | |
| PSMA-PEG4 | PSMA-PEG4. Alternative Names: (21S,25S)-1-Amino-15,23-dioxo-3,6,9,12-tetraoxa-16,22,24-triazaheptacosane-21,25,27-tricarboxylic acid. CAS No. 2256069-92-6. Molecular formula: C23H42N4O12. Mole weight: 566.60. | |
| PSMA/PSM-P1 (4-12) | This peptide is a tetramer of biotinylated peptide with streptavidin mainly composed of PSMA-derived peptide of LLHETDSAV sequence covering 4-12 and A*0201 molecule. | |
| PSM P2 (711-719) | PSM P2 (711-719) is a 9-aa peptide. PSM P2 is a zinc metalloenzyme that resides in membranes. It is mainly expressed in four tissues of the body, including prostate epithelium, the proximal tubules of the kidney, the jejunal brush border of the small intestine and ganglia of the nervous system. Alternative Names: Glutamate carboxypeptidase 2 (711-719); N-acetyl-L-aspartyl-L-glutamate peptidase I (711-719); NAAG peptidase (711-719); prostate-specific membrane antigen (PSMA) (711-719). | |
| Psychimicin | Psychimicin is an antibacterial peptide isolated from Oiketicus kirbyi. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Alternative Names: Ile-Asn-Asn-Trp-Val-Arg-Val-Pro-Pro-Cys-Asp-Gln-Val-Cys-Ser-Arg-Thr-Asn-Pro-Glu-Lys-Asp-Glu-Cys-Cys-Arg-Ala-His-Gly-His-Ala-Phe-His-Ala-Thr-Cys-Ser-Gly-Gly-Met-Gln-Cys-Tyr-Arg-Arg. | |
| Psyle A | Psyle A is an antibacterial peptide isolated from Psychotria leptothyrsa. It has anti-cancer activity and cytotoxicity. Alternative Names: Gly-Ile-Ala-Cys-Gly-Glu-Ser-Cys-Val-Phe-Leu-Gly-Cys-Phe-Ile-Pro-Gly-Cys-Ser-Cys-Lys-Ser-Lys-Val-Cys-Tyr-Phe-Asn. Molecular formula: C128H187N31O35S6. Mole weight: 2912.4. | |
| Psyle C | Psyle C is an antibacterial peptide isolated from Psychotria leptothyrsa. It has anti-cancer activity and cytotoxicity. Alternative Names: Lys-Leu-Cys-Gly-Glu-Thr-Cys-Phe-Lys-Phe-Lys-Cys-Tyr-Thr-Pro-Gly-Cys-Ser-Cys-Ser-Tyr-Pro-Phe-Cys-Lys. | |
| Psyle E | Psyle E is an antibacterial peptide isolated from Psychotria leptothyrsa. It has anti-cancer activity and cytotoxicity. Alternative Names: Gly-Val-Ile-Pro-Cys-Gly-Glu-Ser-Cys-Val-Phe-Ile-Pro-Cys-Ile-Ser-Ser-Val-Leu-Gly-Cys-Ser-Cys-Lys-Asn-Lys-Val-Cys-Tyr-Arg-Asp. | |
| PTD-DBM | PTD-DBM is a synthetic peptide that interacts with the mechanism of the hair loss linked endogenous protein CXXC5, which is a negative feedback regulator of the Wnt/β-catenin pathway. As a topical scalp treatment, PTD-DBM inhibits the follicle contraction effects caused by human hormones and enzymes, thereby rescuing follicles at the stem cell level. This treatment not only prevents hair loss but also promotes the growth of new hair follicles. Alternative Names: Protein transduction domain (PTD)-Dvl-binding motif (DBM); Protein Transduction Domain-fused Dishevelled Binding Motif; Protein transduction domain-Dishevelled binding motif; H-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Gly-Gly-Gly-Gly-Arg-Lys-Thr-Gly-His-Gln-Ile-Cys-Lys-Phe-Arg-Lys-Cys-OH; L-Arginyl-L-arginyl-L-arginyl-L-arginyl-L-arginyl-L-arginyl-L-arginyl-L-arginylglycylglycylglycylglycyl-L-arginyl-L-lysyl-L-threonylglycyl-L-histidyl-L-glutaminyl-L-isoleucyl-L-cysteinyl-L-lysyl-L-phenylalanyl-L-arginyl-L-lysyl-L-cysteine; PTD-DBM peptide (TFA removed). Grades: ≥95%. CAS No. 1609454-11-6. Molecular formula: C124H225N61O28S2. Mole weight: 3082.62. | |
| PTD-p65-P1 Peptide | PTD-p65-P1 Peptide, an inhibitor of nuclear transcription factor NF-kappab, consists of a sequence of membrane transport peptides generated by the binding of Antennapedia (PTD) to p65-P1, which selectively inhibits activation induced by various inflammatory stimuli. Alternative Names: Asp-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Gln-Leu-Arg-Arg-Pro-Ser-Asp-Arg-Glu-Leu-Ser-Glu. Grades: ≥95%. Molecular formula: C168H275N57O44S. Mole weight: 3829.46. | |
| PTEN antagonist peptide (PAP4) | PTEN antagonist peptide (PAP4) is a 30-amino acid peptide that binds to the C-terminal portion of PTEN, promoting axon growth. Alternative Names: PTEN antagonist peptide 4; PAP4. | |
| pTH (1-31) (human) | pTH (1-31) stimulates adenylyl cyclase in ROS 17/2 rat osteosarcoma cells as strongly as pTH (1-34) (teriparatide). Alternative Names: H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-OH. CAS No. 157938-23-3. Molecular formula: C162H269N49O47S2. Mole weight: 3719.29. | |
| PTH (13-34) (HUMAN) | PTH (13-34) (HUMAN). Alternative Names: Parathyroid Hormone Fragment 13-34 human; Parathyroid Hormone (13-34), human; LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE. CAS No. 81306-64-1. Molecular formula: C125H199N39O33S. Mole weight: 2808.22. | |
| pTH (1-34) amide (human) | pTH (1-34) amide (human) is a compound synthetic peptide hormone is acts as an agonist to the parathyroid hormone receptor. It is employed for the research of osteoporosis, hypoparathyroidism and various bone-related disorders. Alternative Names: H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-NH2; Parathyroid hormone (1-34)amide; L-seryl-L-valyl-L-seryl-L-alpha-glutamyl-L-isoleucyl-L-glutaminyl-L-leucyl-L-methionyl-L-histidyl-L-asparagyl-L-leucyl-glycyl-L-lysyl-L-histidyl-L-leucyl-L-asparagyl-L-seryl-L-methionyl-L-alpha-glutamyl-L-arginyl-L-valyl-L-alpha-glutamyl-L-tryptophyl-L-leucyl-L-arginyl-L-lysyl-L-lysyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-valyl-L-histidyl-L-asparagyl-L-phenylalaninamide; hPTH (1-34)-NH2; human parathyroid hormone (1-34) amide. Grades: 95%. CAS No. 83139-29-1. Molecular formula: C181H292N56O50S2. Mole weight: 4116.79. | |
| pTH (1-37) (human) | pTH (1-37) (human) is a native bioactive fragment of pTH (1-84) (human) in circulation. Pulsatile rather than continuous administration of pTH (1-37) (human) can increase growth, bone calcium content and bone mineral density in uremic animals. Alternative Names: Parathyrin (1-37) (human); H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-OH; L-seryl-L-valyl-L-seryl-L-alpha-glutamyl-L-isoleucyl-L-glutaminyl-L-leucyl-L-methionyl-L-histidyl-L-asparagyl-L-leucyl-glycyl-L-lysyl-L-histidyl-L-leucyl-L-asparagyl-L-seryl-L-methionyl-L-alpha-glutamyl-L-arginyl-L-valyl-L-alpha-glutamyl-L-tryptophyl-L-leucyl-L-arginyl-L-lysyl-L-lysyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-valyl-L-histidyl-L-asparagyl-L-phenylalanyl-L-valyl-L-alanyl-L-leucine. Grades: 95%. CAS No. 136799-54-7. Molecular formula: C195H316N58O54S2. Mole weight: 4401.15. | |
| PTH (1-44) (HUMAN) | PTH (1-44) (HUMAN). Alternative Names: Parathyroid Hormone (1-44), human; Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-Gly-Ala-Pro-Leu-Ala-Pro-Arg. CAS No. 85568-24-7. Molecular formula: C225H366N68O61S2. Mole weight: 5063.86. | |
| pTH (1-84) (dog) | pTH (1-84) (dog). Alternative Names: Parathyroid Hormone (1-84) (dog); H-Ser-Val-Ser-Glu-Ile-Gln-Phe-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ser-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-Gly-Ala-Pro-Ile-Ala-His-Arg-Asp-Gly-Ser-Ser-Gln-Arg-Pro-Leu-Lys-Lys-Glu-Asp-Asn-Val-Leu-Val-Glu-Ser-Tyr-Gln-Lys-Ser-Leu-Gly-Glu-Ala-Asp-Lys-Ala-Asp-Val-Asp-Val-Leu-Thr-Lys-Ala-Lys-Ser-Gln-OH. Grades: ≥95%. CAS No. 521986-14-1. Molecular formula: C414H672N122O128S2. Mole weight: 9470.77. | |
| pTH (1-84) (rat) | pTH (1-84) (rat). Alternative Names: H-Ala-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ala-Ser-Val-Glu-Arg-Met-Gln-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ser-Leu-Gly-Val-Gln-Met-Ala-Ala-Arg-Glu-Gly-Ser-Tyr-Gln-Arg-Pro-Thr-Lys-Lys-Glu-Glu-Asn-Val-Leu-Val-Asp-Gly-Asn-Ser-Lys-Ser-Leu-Gly-Glu-Gly-Asp-Lys-Ala-Asp-Val-Asp-Val-Leu-Val-Lys-Ala-Lys-Ser-Gln-OH. Grades: ≥95%. CAS No. 521986-16-3. Molecular formula: C406H670N122O126S3. Mole weight: 9372.73. | |
| pTH (2-34) (human) | pTH (2-34) (human) is an impurity and potential metabolite of teriparatide produced during chemical synthesis. The N-terminal truncation sequence of pTH (2-34) has a reduced potency in stimulating bone formation. Like pTH (1-34), pTH (2-34) reduced coronary perfusion pressure in isolated rat hearts, but had no effect on heart rate compared with pTH(1-34). Alternative Names: H-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH; Human PTH (2-34); hpTH (2-34). Grades: ≥95%. CAS No. 247902-18-7. Molecular formula: C178H286N54O49S2. Mole weight: 4030.70. | |
| pTH (2-38) (human) | pTH (2-38) (human). Alternative Names: H2N-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-Gly-COOH. CAS No. 154765-04-5. Molecular formula: C194H314N58O53S2. Mole weight: 4371.12. | |
| pTH (28-48) (human) | pTH (28-48) (human) is an ingenious and cutting-edge compoundexpressly designed and meticulously formulated to scrutinize the profound and intricate ramifications inflicted by the coveted parathyroid hormone (PTH) upon the exceptionally intricate and multifarious research of bone metabolism and calcium homeostasis. Alternative Names: Parathyroid Hormone (28-48), human; H-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-Gly-Ala-Pro-Leu-Ala-Pro-Arg-Asp-Ala-Gly-Ser-OH; L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-valyl-L-histidyl-L-asparagyl-L-phenylalanyl-L-valyl-L-alanyl-L-leucyl-glycyl-L-alanyl-L-prolyl-L-leucyl-L-alanyl-L-prolyl-L-arginyl-L-alpha-aspartyl-L-alanyl-glycyl-L-serine; Parathyroid Hormone Fragment 28-48 human. Grades: ≥95% by HPLC. CAS No. 83286-22-0. Molecular formula: C95H150N28O29. Mole weight: 2148.38. | |
| pTH (3-34) (bovine) | pTH (3-34) (bovine) inhibits the stimulation of adenylate cyclase by pTH (1-34) in vitro, but has no agonist or antagonistic effect on renal phosphate transport in vivo. Alternative Names: Parathyroid Hormone (3-34), bovine; H-Ser-Glu-Ile-Gln-Phe-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ser-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH; bPTH (3-34); L-seryl-L-alpha-glutamyl-L-isoleucyl-L-glutaminyl-L-phenylalanyl-L-methionyl-L-histidyl-L-asparagyl-L-leucyl-glycyl-L-lysyl-L-histidyl-L-leucyl-L-seryl-L-seryl-L-methionyl-L-alpha-glutamyl-L-arginyl-L-valyl-L-alpha-glutamyl-L-tryptophyl-L-leucyl-L-arginyl-L-lysyl-L-lysyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-valyl-L-histidyl-L-asparagyl-L-phenylalanine. Grades: ≥95% by HPLC. CAS No. 51257-86-4. Molecular formula: C175H274N52O48S2. Mole weight: 3938.55. | |
| PTH (44-68) (HUMAN) | PTH (44-68) (HUMAN). Alternative Names: Parathyroid hormone (44-68); H-Arg-Asp-Ala-Gly-Ser-Gln-Arg-Pro-Arg-Lys-Lys-Glu-Asp-Asn-Val-Leu-Val-Glu-Ser-His-Glu-Lys-Ser-Leu-Gly-OH. Grades: 95%. CAS No. 64421-69-8. Molecular formula: C117H199N41O41. Mole weight: 2836.08. | |
| pTH (53-84) (human) | pTH (53-84) (human) is a highly bioactive peptide derived from human Parathyroid Hormone (PTH), used in the biomedical industry for studying bone metabolism disorders like osteoporosis. It aids in the understanding of PTH's effect on bone formation and resorption. Alternative Names: Parathyroid Hormone (53-84), human; H-Lys-Lys-Glu-Asp-Asn-Val-Leu-Val-Glu-Ser-His-Glu-Lys-Ser-Leu-Gly-Glu-Ala-Asp-Lys-Ala-Asp-Val-Asn-Val-Leu-Thr-Lys-Ala-Lys-Ser-Gln-OH; Parathyroid Hormone[Asn76]-Human Fragment 53-84; L-lysyl-L-lysyl-L-alpha-glutamyl-L-alpha-aspartyl-L-asparagyl-L-valyl-L-leucyl-L-valyl-L-alpha-glutamyl-L-seryl-L-histidyl-L-alpha-glutamyl-L-lysyl-L-seryl-L-leucyl-glycyl-L-alpha-glutamyl-L-alanyl-L-alpha-aspartyl-L-lysyl-L-alanyl-L-alpha-aspartyl-L-valyl-L-asparagyl-L-valyl-L-leucyl-L-threonyl-L-lysyl-L-alanyl-L-lysyl-L-seryl-L-glutamine. Grades: ≥95% by HPLC. CAS No. 89439-30-5. Molecular formula: C149H253N43O54. Mole weight: 3510.86. | |
| PTH (73-84) (HUMAN) | PTH (73-84) (HUMAN). Alternative Names: ALA-ASP-VAL-ASN-VAL-LEU-THR-LYS-ALA-LYS-SER-GLN;H-ALA-ASP-VAL-ASN-VAL-LEU-THR-LYS-ALA-LYS-SER-GLN-OH; L-Glutamine, L-alanyl-L-α-aspartyl-L-valyl-L-asparaginyl-L-valyl-L-leucyl-L-threonyl-L-lysyl-L-alanyl-L-lysyl-L-seryl-(9CI). Grades: 95%. CAS No. 321957-35-1. Molecular formula: C54H96N16O19. Mole weight: 1273.44. | |
| pTH (7-84) (human) | pTH (7-84) (human). Alternative Names: parathyroid hormone (7-84) (human); H-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu-Gly-Ala-Pro-Leu-Ala-Pro-Arg-Asp-Ala-Gly-Ser-Gln-Arg-Pro-Arg-Lys-Lys-Glu-Asp-Asn-Val-Leu-Val-Glu-Ser-His-Glu-Lys-Ser-Leu-Gly-Glu-Ala-Asp-Lys-Ala-Asp-Val-Asn-Val-Leu-Thr-Lys-Ala-Lys-Ser-Gln-OH; Human parathyroid hormone (7-84). Grades: ≥95% by HPLC. CAS No. 406610-86-4. Molecular formula: C381H629N119O115S2. Mole weight: 8781.05. | |
| pTH-Related Protein (1-37) (human, mouse, rat) | pTH-Related Protein (1-37) (human, mouse, rat) is a parathyroid hormone-related protein sequence associated with malignant hypercalcemia. Alternative Names: Hypercalcemia of Malignancy Factor (1-37) (human, mouse, rat); H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Ile-Arg-OH; Human parathyroid hormone-related peptide-1-37. Grades: 95%. CAS No. 206010-80-2. Molecular formula: C197H317N63O53. Mole weight: 4416.08. | |
| pTH-Related Protein (1-40) (human, mouse, rat) | pTH-Related Protein (1-40) (human, mouse, rat) significantly increases the secretion of low Ca2+-stimulated pTH in normal rats in a dose-dependent manner. It stimulates the activity of membrane associated protein kinase C in rat spleen lymphocytes. Alternative Names: Hypercalcemia of Malignancy Factor (1-40) (human, mouse, rat); H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Ile-Arg-Ala-Thr-Ser-OH; pTHrP (1-40) (human, mouse, rat); L-alanyl-L-valyl-L-seryl-L-alpha-glutamyl-L-histidyl-L-glutaminyl-L-leucyl-L-leucyl-L-histidyl-L-alpha-aspartyl-L-lysyl-glycyl-L-lysyl-L-seryl-L-isoleucyl-L-glutaminyl-L-alpha-aspartyl-L-leucyl-L-arginyl-L-arginyl-L-arginyl-L-phenylalanyl-L-phenylalanyl-L-leucyl-L-histidyl-L-histidyl-L-leucyl-L-isoleucyl-L-alanyl-L-alpha-glutamyl-L-isoleucyl-L-histidyl-L-threonyl-L-alanyl-L-alpha-glutamyl-L-isoleucyl-L-arginyl-L-alanyl-L-threonyl-L-serine; PTH-Like Adenylate Cyclase Stimulating Protein. Grades: 95%. CAS No. 120298-73-9. Molecular formula: C207H334N66O58. Mole weight: 4675.27. | |
| pTH-Related Protein (7-34) amide (human, mouse, rat) | pTH-Related Protein (7-34) amide is a potent antagonist of the effects of pTH-related protein (1-34) in vitro and in vivo. Alternative Names: L-Alaninamide,l-Leucyl-L-Leucyl-L-histidyl-L-a-aspartyl-L-Lysylglycyl-L-Lysyl-L-seryl-L-isoleucyl-L-glutaminyl-L-a-aspartyl-L-Leucyl-L-arginyl-l-arginyl-l-arginyl-l-phenylalanyl-l-phenylalanyl-l-leucy; Hypercalcemia of Malignancy Factor (7-34) amide (human, mouse, rat). Grades: 95%. CAS No. 115695-30-2. Molecular formula: C153H247N49O37. Mole weight: 3364.90. | |
| Pthrp (1-34) | Pthrp (1-34). Alternative Names: Pth hypercalcemic factor; Human PTHrP (1-34); Pth-like protein (1-34); pTH-Related Protein (1-34) (human, mouse, rat). Grades: 95%. CAS No. 112540-82-6. Molecular formula: C180H287N57O48. Mole weight: 4017.55. | |
| Pth-St1 | Pth-St1 is an antibacterial peptide isolated from Solanum tuberosum. Alternative Names: Pseudothionin-St1; Arg-Asn-Cys-Glu-Ser-Leu-Ser-His-Arg-Phe-Lys-Gly-Pro-Cys-Thr-Arg-Asp-Ser-Asn. | |
| p-Trifluoromethyl-L-phenylalanine | p-Trifluoromethyl-L-phenylalanine. Alternative Names: L-Phe(4-CF3)-OH; H-L-Phe(4-trifluoromethyl)-OH; (S)-2-Amino-3-(4-trifluoromethyl-phenyl)propionic acid. Grades: ≥ 99% (HPLC). CAS No. 114926-38-4. Molecular formula: C10H10F3NO2. Mole weight: 233.19. | |
| PUMA BH3 | PUMA BH3, a p53-upregulating modulator of apoptosis (PUMA) BH3 domain peptide, is a direct activator of Bak with Kd of 26 nM. Alternative Names: Glu-Glu-Gln-Trp-Ala-Arg-Glu-Ile-Gly-Ala-Gln-Leu-Arg-Arg-Met-Ala-Asp-Asp-Leu-Asn-Ala-Gln-Tyr-Glu-Arg; L-alpha-glutamyl-L-alpha-glutamyl-L-glutaminyl-L-tryptophyl-L-alanyl-L-arginyl-L-alpha-glutamyl-L-isoleucyl-glycyl-L-alanyl-L-glutaminyl-L-leucyl-L-arginyl-L-arginyl-L-methionyl-L-alanyl-L-alpha-aspartyl-L-alpha-aspartyl-L-leucyl-L-asparagyl-L-alanyl-L-glutaminyl-L-tyrosyl-L-alpha-glutamyl-L-arginine. Grades: ≥95%. Molecular formula: C128H202N42O43S. Mole weight: 3049.29. | |
| Purotoxin 1 | It is an effective P2X3 receptor modulator, which shows negligible effects on P2X2 and P2X2/3, and exhibits antinociceptive properties in an animal model of inflammatory pain. Alternative Names: H-Gly-DL-Tyr-DL-Cys(1)-DL-Ala-DL-Glu-DL-Lys-Gly-DL-xiIle-DL-Arg-DL-Cys(2)-DL-Asp-DL-Asp-DL-xiIle-DL-His-DL-Cys(3)-DL-Cys(1)-DL-xiThr-Gly-DL-Leu-DL-Lys-DL-Cys(2)-DL-Lys-DL-Cys(4)-DL-Asn-DL-Ala-DL-Ser-Gly-DL-Tyr-DL-Asn-DL-Cys(4)-DL-Val-DL-Cys(3)-DL-Arg-DL-Lys-DL-Lys-NH2; glycyl-DL-tyrosyl-DL-cysteinyl-DL-alanyl-DL-alpha-glutamyl-DL-lysyl-glycyl-DL-isoleucyl-DL-arginyl-DL-cysteinyl-DL-alpha-aspartyl-DL-alpha-aspartyl-DL-isoleucyl-DL-histidyl-DL-cysteinyl-DL-cysteinyl-DL-threonyl-glycyl-DL-leucyl-DL-lysyl-DL-cysteinyl-DL-lysyl-DL-cysteinyl-DL-asparagyl-DL-alanyl-DL-seryl-glycyl-DL-tyrosyl-DL-asparagyl-DL-cysteinyl-DL-valyl-DL-cysteinyl-DL-arginyl-DL-lysyl-DL-lysinamide (3->16),(10->21),(15->32),(23->30)-tetrakis(disulfide). Grades: >98%. CAS No. 1396322-38-5. Molecular formula: C155H249N51O47S8. Mole weight: 3835.47. | |
| Putative antimicrobial peptide | Putative antimicrobial peptide is an antibacterial peptide isolated from Opisthacanthus cayaporum (South American scorpion). It has activity against bacteria and fungi. Molecular formula: C216H339N57O60. Mole weight: 4694.41. | |
| Putative antimicrobial peptide 1 | Putative antimicrobial protein 1 is an antibacterial peptide isolated from Lippia sidoides. It has activity against fungi. Alternative Names: Ala-Leu-Tyr-Asn-Ser-Glu-Asp-Leu-Tyr-Glu-Glu-Thr-Ser-Asp-Ser-Asp-Asp. Grades: >95%. Molecular formula: C86H123N19O42. Mole weight: 2095.02. | |
| Putative antimicrobial peptide 2 | Putative antimicrobial protein 2 is an antibacterial peptide isolated from Lippia sidoides. It has activity against fungi. Alternative Names: Pro-Pro-Glu-Ala-Ala-Tyr-Gly-Pro-Gly-Asn-Thr-Asn-Ser-Asp-Ser-Gly-Asp-Lys. Grades: >96%. Molecular formula: C76H114N22O33. Mole weight: 1863.87. | |
| Putative antimicrobial peptide A Northern Europe Heligoland variant | Putative antimicrobial peptide A Northern Europe Heligoland variant is an antibacterial peptide isolated from Ciona intestinalis. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Alternative Names: Ala-Ala-Leu-Arg-Gly-Ala-Leu-Arg-Ala-Val-Ala-Arg-Val-Gly-Lys-Ala-Ile-Leu-Pro-His-Val-Ala-Ile-Ala-Asn-Pro-Tyr-Val-Arg-Thr-Pro-Tyr-Val-His-Asn-Asn-Pro. Grades: >97%. Molecular formula: C179H293N57O44. Mole weight: 3947.65. | |
| Putative antimicrobial protein | Putative antimicrobial protein is an antibacterial peptide. Alternative Names: Met-Glu-Tyr-Trp-Cys-Tyr-Arg-Lys-Lys-Pro-Tyr-Arg-Lys-Cys-Arg. Grades: >97%. | |
| Putative antimicrobial protein 3 | Putative antimicrobial protein 3 is an antibacterial peptide. Alternative Names: Glu-Ser-Ile-Leu-Ile-Val-His-Gln-Gln-Gln-Ser-Arg-Ser-Ser-Gly-Ser. Grades: >97%. | |
| Putative protein product of HMFN1045 (253-264) | Putative protein product of HMFN1045 (253-264). | |
| PvD1 | PvD1 is an antibacterial peptide isolated from Phaseolus vulgaris. It has activity against fungi. Alternative Names: Lys-Thr-Cys-Glu-Asn-Leu-Ala-Asp-Thr-Tyr-Lys-Gly-Pro-Cys-Phe-Thr-Thr-Gly-Ser-Cys-Asp. | |
| pVEC (Cadherin-5) | It is a cell-penetrating peptide (CPP) derived from murine vascular endothelian cadherin. At low micromolar concentration, it can permeate cell membrane without obvious influence on cell membrane. pVEC can be conjugated with large molecules and used as a drug delivery vehicle. Alternative Names: H-Leu-Leu-Ile-Ile-Leu-Arg-Arg-Arg-Ile-Arg-Lys-Gln-Ala-His-Ala-His-Ser-Lys-OH; Cadherin-5 Peptide; vascular endothelial Peptide; L-leucyl-L-leucyl-L-isoleucyl-L-isoleucyl-L-leucyl-L-arginyl-L-arginyl-L-arginyl-L-isoleucyl-L-arginyl-L-lysyl-L-glutaminyl-L-alanyl-L-histidyl-L-alanyl-L-histidyl-L-seryl-L-lysine. Grades: ≥95%. Molecular formula: C98H177N37O21. Mole weight: 2209.73. | |
| Pw2 | Pw2 is a synthetic antibacterial peptide. It has anti-coccidial and anti-fungal activity with very low hemolytic activity, but it has no activity against bacteria. Alternative Names: His-Pro-Leu-Lys-Gln-Tyr-Trp-Trp-Arg-Pro-Ser-Ile. Molecular formula: C79H111N21O16. Mole weight: 1610.88. | |
| PXA-3 | Thrombin or factor Xa protease sites to cleave protein from fusion. pGEX-1lambdaT, pGEX-4T-1, pGEX-5X-1 accept cDNA from lambda gt11 libs. Alternative Names: pXa3. | |
Our database is helping our users find suppliers everyday.
