BOC Sciences provides a wide range of research chemicals and biochemicals including inhibitors, building blocks, GMP Products, impurities and metabolites, APIs for Veterinary, Natural Compounds, ADCs, Stem Cell Molecule and chiral compounds.
| Product | Description | |
|---|---|---|
| VKGILS-NH2 acetate | VKGILS-NH2 acetate is a reversed control peptide for SLIGKV-NH2, which is a protease-activated receptor 2 (PAR2) agonist. Alternative Names: H-Val-Lys-Gly-Ile-Leu-Ser-NH2.CH3CO2H; L-valyl-L-lysyl-glycyl-L-isoleucyl-L-leucyl-L-serinamide acetic acid. Grades: ≥95%. CAS No. 2763585-10-8. Molecular formula: C28H54N8O7.C2H4O2. Mole weight: 674.83. |  |
| VP-22 | VP-22 peptide is from herpes simplex virus type-1. Alternative Names: H-Asp-Ala-Ala-Thr-Ala-Thr-Arg-Gly-Arg-Ser-Ala-Ala-Ser-Arg-Pro-Thr-Glu-Arg-Pro-Arg-Ala-Pro-Ala-Arg-Ser-Ala-Ser-Arg-Pro-Arg-Arg-Pro-Val-Asp-OH; HSV-1 protein VP22. Grades: >98%. Molecular formula: C147H255N61O48. Mole weight: 3645.02. | |
| VrCRP | VrCRP is a peptide isolated from V. radiata (a bruchid-resistant mungbean). It has activity against bacteria and fungi. Alternative Names: Arg-Thr-Cys-Met-Ile-Lys-Lys-Glu-Gly-Trp-Gly-Lys-Cys-Leu-Ile-Asp-Thr-Thr-Cys-Ala-His-Ser-Cys-Lys-Asn-Arg-Gly-Tyr-Ile-Gly-Gly-Asp-Cys-Lys-Gly-Met-Thr-Arg-Thr-Cys-Tyr-Cys-Leu-Val-Asn-Cys. Molecular formula: C211H347N65O63S10. Mole weight: 5123.07. | |
| VrD1 | VrD1 is an antimicrobial plant peptide isolated from Vigna radiata. It has activity against fungi. Alternative Names: Arg-Thr-Cys-Met-Ile-Lys-Lys-Glu-Gly-Trp-Gly-Lys-Cys-Leu-Ile-Asp-Thr-Thr-Cys-Ala-His-Ser-Cys-Lys-Asn-Arg-Gly-Tyr-Ile-Gly-Gly-Asn-Cys-Lys-Gly-Met-Thr-Arg-Thr-Cys-Tyr-Cys-Leu-Val-Asn-Cys. | |
| VrD2 | VrD2 is an plant antimicrobial peptide isolated from Vigna radiata. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Alternative Names: Lys-Thr-Cys-Glu-Asn-Leu-Ala-Asn-Thr-Tyr-Arg-Gly-Pro-Cys-Phe-Thr-Thr-Gly-Ser-Cys-Asp-Asp-His-Cys-Lys-Asn-Lys-Glu-His-Leu-Arg-Ser-Gly-Arg-Cys-Arg-Asp-Asp-Phe-Arg-Cys-Trp-Cys-Thr-Arg-Asn-Cys. Molecular formula: C222H347N77O72S8. Mole weight: 5503.15. | |
| VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is the first N-terminal 1-28 residues of Exendin-4 peptide. Exendin-4 is a pure GLP-1 receptor agonist. Mole weight: 3241.7. | |
| VSV-G Peptide | VSV-G Peptide, vesicular stomatitis virus G (VSV-G) protein fragment, is commonly engineered onto the N- or C- terminus of a protein of interest so that the tagged protein can be analyzed and visualized using immunochemical methods. Alternative Names: H-Tyr-xiThr-Asp-xiIle-Glu-Met-Asn-Arg-Leu-Gly-Lys-OH; L-tyrosyl-(3xi)-L-threonyl-L-alpha-aspartyl-(3xi)-L-isoleucyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-arginyl-L-leucyl-glycyl-L-lysine. Molecular formula: C57H94N16O19S. Mole weight: 1339.52. | |
| Vv-AMP1 | Vv-AMP1 is an antibacterial peptide isolated from Vit is vinifera. It has activity against fungi. Alternative Names: Arg-Thr-Cys-Glu-Ser-Gln-Ser-His-Arg-Phe-Lys-Gly-Thr-Cys-Val-Arg-Gln-Ser-Asn-Cys-Ala-Ala-Val-Cys-Gln-Thr-Glu-Gly-Phe-His-Gly-Gly-Asn-Cys-Arg-Gly-Phe-Arg-Arg-Arg-Cys-Phe-Cys-Thr-Lys-His-Cys. Molecular formula: C216H343N81O64S8. Mole weight: 5355.08. | |
| WAM1 | WAM1 is an antibacterial peptide isolated from Macropus eugenii. It has activity against bacteria and fungi. It can inhibit the formation of biofilms in all clinical isolates at certain concentrations. Alternative Names: Lys-Arg-Gly-Phe-Gly-Lys-Lys-Leu-Arg-Lys-Arg-Leu-Lys-Lys-Phe-Arg-Asn-Ser-Ile-Lys-Lys-Arg-Leu-Lys-Asn-Phe-Asn-Val-Val-Ile-Pro-Ile-Pro-Leu-Pro-Gly. Grades: >96%. Molecular formula: C199H345N63O41. Mole weight: 4276.35. | |
| WAM2 | WAM2 is an antibacterial peptide isolated from Macropus eugenii. It has activity against bacteria and fungi. Alternative Names: Lys-Arg-Gly-Leu-Trp-Glu-Ser-Leu-Lys-Arg-Lys-Ala-Thr-Lys-Leu-Gly-Asp-Asp-Ile-Arg-Asn-Thr-Leu-Arg-Asn-Phe-Lys-Ile-Lys-Phe-Pro-Val-Pro-Arg-Gln-Gly. Grades: >97%. Molecular formula: C192H321N61O49. Mole weight: 4268.06. | |
| WAMP-1 | WAMP-1 is an antibacterial peptide isolated from Triticum kiharae. Alternative Names: Cys-Gly-Asp-Gln-Ala-Arg-Gly-Ala-Lys-Cys-Pro-Asn-Cys-Leu-Cys-Cys-Gly-Lys-Tyr-Gly-Phe-Cys-Gly-Ser-Gly-Asp-Ala-Tyr-Cys-Gly-Ala-Gly-Ser-Cys-Gln-Ser-Gln-Cys-Arg. | |
| WAMP-1a | WAMP-1a is an antibacterial peptide isolated from Triticum kiharae. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. The peptide has high broad-spectrum inhibitory activity against a variety of chitin-containing and non-chitin-containing pathogens. Alternative Names: Antimicrobial peptide 1a; Ala-Gln-Arg-Cys-Gly-Asp-Gln-Ala-Arg-Gly-Ala-Lys-Cys-Pro-Asn-Cys-Leu-Cys-Cys-Gly-Lys-Tyr-Gly-Phe-Cys-Gly-Ser-Gly-Asp-Ala-Tyr-Cys-Gly-Ala-Gly-Ser-Cys-Gln-Ser-Gln-Cys-Arg-Gly-Cys. Molecular formula: C172H272N60O59S10. Mole weight: 4445.02. | |
| WAMP-1b | WAMP-1b is an antibacterial peptide isolated from Triticum kiharae. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Alternative Names: Antimicrobial peptide 1b; Ala-Gln-Arg-Cys-Gly-Asp-Gln-Ala-Arg-Gly-Ala-Lys-Cys-Pro-Asn-Cys-Leu-Cys-Cys-Gly-Lys-Tyr-Gly-Phe-Cys-Gly-Ser-Gly-Asp-Ala-Tyr-Cys-Gly-Ala-Gly-Ser-Cys-Gln-Ser-Gln-Cys-Arg-Gly-Cys-Arg. Molecular formula: C178H284N64O60S10. Mole weight: 4601.21. | |
| WAMP-2 | WAMP-2 is an antibacterial peptide isolated from Triticum kiharae. Alternative Names: Cys-Gly-Asp-Gln-Ala-Arg-Gly-Ala-Lys-Cys-Pro-Asn-Cys-Leu-Cys-Cys-Gly-Lys-Tyr-Gly-Phe-Cys-Gly-Ser-Gly-Asp-Ala-Tyr-Cys-Gly-Lys-Gly-Ser-Cys-Gln-Ser-Gln-Cys-Arg. | |
| Warnericin RK | Warnericin RK is an antibacterial peptide isolated from Staphylococcus warneri RK. It has activity against gram-negative bacteria. Alternative Names: Met-Gln-Phe-Ile-Thr-Asp-Leu-Ile-Lys-Lys-Ala-Val-Asp-Phe-Phe-Lys-Gly-Leu-Phe-Gly-Asn-Lys. Grades: >96%. Molecular formula: C122H190N28O30S. Mole weight: 2561.08. | |
| WD repeat domain 16 (145-175) | WD repeat domain 16 (145-175). | |
| Weinreb Linker | Weinreb Linker. Alternative Names: 3-((((9H-Fluoren-9-yl)methoxy)carbonyl)(methoxy)amino)propanoic acid; N-Fmoc-N-methoxy-3-aminopropionic acid; beta-Alanine, N-[(9H-fluoren-9-ylmethoxy)carbonyl]-N-methoxy-; N-Fmoc-N-methoxy-3-aminopropionicacid; PubChem11749; SCHEMBL1274753; N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-N-methoxy-Beta-alanine; Fmoc-N-methoxy-3-aminopropionic acid. Grades: > 97%. CAS No. 247021-90-5. Molecular formula: C19H19NO5. Mole weight: 341.36. | |
| White cloud bean defensin | White cloud bean defensin is an antibacterial peptide isolated from Phaseolus vulgar is cv. white cloud beans. It has activity against bacteria and fungi. Alternative Names: Lys-Thr-Cys-Glu-Asn-Leu-Ala-Asp-Thr-Phe-Arg-Gly-Pro-Cys-Phe-Ala-Thr-Ser-Asn-Cys-Asp-Asp-His-Cys-Lys-Asn-Lys-Glu-His-Leu-Leu-Ser-Gly-Arg-Cys-Arg-Asp-Asp-Phe-Arg-Cys-Trp-Cys-Thr-Arg-Asn-Cys. | |
| Wilms tumor protein (235-243) | Wilms tumor protein (235-243) is a bioactive peptide of Wilms tumor protein. The transcription factor Wilms tumor protein 1 (WT1) belongs to a new generation of tumor antigens, as it is essential for tumor cell proliferation and is highly expressed in various hematologic and solid malignancies. Alternative Names: WT1 (235-243). | |
| Wilms tumor protein (317-327) | Wilms tumor protein (317-327) is a bioactive peptide of Wilms tumor protein. The transcription factor Wilms tumor protein 1 (WT1) belongs to a new generation of tumor antigens, as it is essential for tumor cell proliferation and is highly expressed in various hematologic and solid malignancies. Alternative Names: WT1 (317-327). | |
| Wilms tumor protein (332-347) | Wilms tumor protein (332-347) is a bioactive peptide of Wilms tumor protein. The transcription factor Wilms tumor protein 1 (WT1) belongs to a new generation of tumor antigens, as it is essential for tumor cell proliferation and is highly expressed in various hematologic and solid malignancies. Alternative Names: WT1 (332-347). | |
| Wilms tumor protein (337-347) | Wilms tumor protein (337-347) is a bioactive peptide of Wilms tumor protein. The transcription factor Wilms tumor protein 1 (WT1) belongs to a new generation of tumor antigens, as it is essential for tumor cell proliferation and is highly expressed in various hematologic and solid malignancies. Alternative Names: WT1 (337-347). | |
| Winter flounder 1 | Winter flounder 1 is an antibacterial peptide isolated from Pseudopleuronectes americanus. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Alternative Names: NRC-1 peptide; H-Gly-Lys-Gly-Arg-Trp-Leu-Glu-Arg-Ile-Gly-Lys-Ala-Gly-Gly-Ile-Ile-Ile-Gly-Gly-Ala-Leu-Asp-His-Leu-OH. Grades: >96%. Molecular formula: C112H188N36O28. Mole weight: 2486.96. | |
| Winter flounder 1a | Winter flounder 1a is an antibacterial peptide isolated from Pseudopleuronectes americanus. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Alternative Names: NRC-2 peptide; Trp-Leu-Arg-Arg-Ile-Gly-Lys-Gly-Val-Lys-Ile-Ile-Gly-Gly-Ala-Ala-Leu-Asp-His-Leu. Grades: >96%. Molecular formula: C100H170N32O22. Mole weight: 2172.66. | |
| Winter flounder 1a1 | Winter flounder 1a1 is an antibacterial peptide isolated from Pseudopleuronectes americanus. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Alternative Names: NRC-3 peptide; Gly-Arg-Arg-Lys-Arg-Lys-Trp-Leu-Arg-Arg-Ile-Gly-Lys-Gly-Val-Lys-Ile-Ile-Gly-Gly-Ala-Ala-Leu-Asp-His-Leu. Grades: >96%. Molecular formula: C132H233N49O28. Mole weight: 2954.63. | |
| Winter flounder 3 | Winter flounder 3 is an antibacterial peptide isolated from Pseudopleuronectes americanus. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Alternative Names: NRC-5 peptide; Phe-Leu-Gly-Ala-Leu-Ile-Lys-Gly-Ala-Ile-His-Gly-Gly-Arg-Phe-Ile-His-Gly-Met-Ile-Gln-Asn-His-His. Grades: >97%. Molecular formula: C120H187N39O26S. Mole weight: 2624.07. | |
| Winter flounder 4 | Winter flounder 4 is an antibacterial peptide isolated from Pseudopleuronectes americanus. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Alternative Names: NRC-6 peptide; H-Gly-Trp-Gly-Ser-Ile-Phe-Lys-His-Gly-Arg-His-Ala-Ala-Lys-His-Ile-Gly-His-Ala-Ala-Val-Asn-His-Tyr-Leu-OH. Grades: >96%. Molecular formula: C127H187N43O28. Mole weight: 2764.1. | |
| Winter flounder Y | Winter flounder Y is an antibacterial peptide isolated from Pseudopleuronectes americanus. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Alternative Names: Pleurocidin-like peptide WFY; NRC-9 peptide; H-Phe-Phe-Arg-Leu-Leu-Phe-His-Gly-Val-His-His-Gly-Gly-Gly-Tyr-Leu-Asn-Ala-Ala-OH. Grades: >96%. Molecular formula: C101H142N30O21. Mole weight: 2112.39. | |
| Winter flounder Z | Winter flounder Z is an antibacterial peptide isolated from Pseudopleuronectes americanus. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Alternative Names: NRC-10; Phe-Phe-Arg-Leu-Leu-Phe-His-Gly-Val-His-His-Val-Gly-Lys-Ile-Lys-Pro-Arg-Ala. Grades: >98%. Molecular formula: C109H168N34O19. Mole weight: 2258.7. | |
| Wiskott-Aldrich syndrome protein (262-281) | Wiskott-Aldrich syndrome protein (262-281) is a peptide derived from Wiskott-Aldrich syndrome protein. In addition to its role in the cytoplasmic cytoskeleton, it also promotes actin polymerization in the nucleus, thereby regulating gene transcription and repair of damaged DNA. Alternative Names: WASp (262-281). | |
| Witch flounder GC3.8-t | Witch flounder GC3.8-t is an antibacterial peptide isolated from Glyptocephalus cynoglossus. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Alternative Names: NRC-16 peptide; Gly-Trp-Lys-Lys-Trp-Leu-Arg-Lys-Gly-Ala-Lys-His-Leu-Gly-Gln-Ala-Ala-Ile-Lys. Grades: >96%. Molecular formula: C102H167N33O20. Mole weight: 2175.62. | |
| Witch flounder GcSc4B7 | Witch flounder GcSc4B7 is an antibacterial peptide isolated from Glyptocephalus cynoglossus. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Alternative Names: NRC-15 peptide; Gly-Phe-Trp-Gly-Lys-Leu-Phe-Lys-Leu-Gly-Leu-His-Gly-Ile-Gly-Leu-Leu-His-Leu-His-Leu. Grades: >96%. Molecular formula: C117H179N31O21. Mole weight: 2355.86. | |
| WKYMVM | WKYMVm is a selective agonist for the formyl peptide receptors FPR1, FPR2 (EC50 = 75 pM) and FPR3 (EC50 = 3 nM) that is expressed on immune cells. WKYMVm induces Ca2+ mobilization and superoxide production in, and chemotaxic migration of, monocytes and neutrophils. Alternative Names: Trp-Lys-Tyr-Met-Val-D-Met-NH2; Leukocyte chemoattractant peptide; W-Peptide. CAS No. 187986-17-0. Molecular formula: C41H61N9O7S2. Mole weight: 856.11. | |
| WKYMVM 2TFA | WKYMVM 2TFA is a selective agonist of the formyl peptide receptors FPR1, FPR2 (EC50 = 75 pM), and FPR3 (EC50 = 3 nM) and is expressed on immune cells. It induces Ca2+ mobilization and superoxide production, as well as chemotactic migration of monocytes and neutrophils. Alternative Names: H-Trp-Lys-Tyr-Met-Val-D-Met-NH2.2TFA; L-tryptophyl-L-lysyl-L-tyrosyl-L-methionyl-L-valyl-D-methioninamide trifluoroacetic acid; (2R,5S,8S,11S,14S,17S)-17-Amino-14-(4-aminobutyl)-11-(4-hydroxybenzyl)-18-(1H-indol-3-yl)-5-isopropyl-2,8-bis[2-(methylsulfanyl)ethyl]-4,7,10,13,16-pentaoxo-3,6,9,12,15-pentaazaoctadecan-1-amide trifluoroacetate; W-Peptide TFA salt; WKYMVm TFA salt. Grades: ≥95%. Molecular formula: C41H61N9O7S2.2C2HF3O2. Mole weight: 1084.16. | |
| WLBU2 | WLBU2 is a synthetic cationic antibacterial peptide that can kill Pseudomonas aeruginosa in human serum. Alternative Names: Arg-Arg-Trp-Val-Arg-Arg-Val-Arg-Arg-Trp-Val-Arg-Arg-Val-Val-Arg-Val-Val-Arg-Arg-Trp-Val-Arg-Arg. Grades: >96%. Molecular formula: C151H260N66O25. Mole weight: 3400.15. | |
| WRW4 | WRW4 is a selective antagonist of formyl peptide receptor 2 (FPR2) signaling. WRW4 inhibits WKYMVm binding to FPR2 (IC50 = 0.23 μM) and blocks intracellular calcium release induced by WKYMVm, MMK 1, amyloid β42, and F peptide. Alternative Names: WRW4; WRW 4; WRW-4. CAS No. 878557-55-2. Molecular formula: C61H65N15O6. Mole weight: 1104.28. | |
| WRW4 TFA | WRW4 TFA is a selective antagonist of formyl peptide receptor 2 (FPR2) signaling. WRW4 inhibits WKYMVm binding to FPR2 (IC50 = 0.23 μM) and blocks intracellular calcium release induced by WKYMVm, MMK 1, amyloid β42, and F peptide. Alternative Names: H-Trp-Arg-Trp-Trp-Trp-Trp-NH2.TFA; L-tryptophyl-L-arginyl-L-tryptophyl-L-tryptophyl-L-tryptophyl-L-tryptophanamide trifluoroacetic acid; WRW4 Trifluoroacetate; WRW4 (trifluoroacetate salt). Grades: ≥95%. Molecular formula: C63H66F3N15O8. Mole weight: 1218.29. | |
| WT-1 (0201) | WT-1 (0201) is a fragment of Wilms' tumor gene WT1, which is overexpressed in leukemias and various types of solid tumors. Alternative Names: H-Arg-Met-Phe-PNA-Pro-Tyr-Leu-OH. | |
| WT-1 (2402) | WT-1 (2402) is a fragment of Wilms' tumor gene WT1, which is overexpressed in leukemias and various types of solid tumors. Alternative Names: H-Cys-Tyr-Thr-Trp-Asn-Gln-Met-Asn-Leu-OH; L-cysteinyl-L-tyrosyl-L-threonyl-L-tryptophyl-L-asparagyl-L-glutaminyl-L-methionyl-L-asparagyl-L-leucine. Molecular formula: C51H73N13O15S2. Mole weight: 1172.3. | |
| WT Occ | WT Occ. Alternative Names: FITC-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Lys-Arg-Thr-Glu-Gln-Asp-His-Tyr-Glu-Thr-Asp-Tyr-Thr-Thr-Gly-Gly-Glu-Ser-Cys-Asp-Glu-Leu. | |
| X antigen family member 1 (17-32) | X antigen family member 1 (17-32) is a bioactive peptide of X antigen family member 1. The transcription of XAGE1A is regulated by methylation of the CpG island in the promoter. Alternative Names: Cancer / testis antigen 12.1 (17-32); G antigen family D member 2 (17-32). | |
| X antigen family member 1 (21-29) | X antigen family member 1 (21-29) is a bioactive peptide of X antigen family member 1. The transcription of XAGE1A is regulated by methylation of the CpG island in the promoter. Alternative Names: Cancer / testis antigen 12.1 (21-29); G antigen family D member 2 (21-29). | |
| X antigen family member 1 (33-49) | X antigen family member 1 (33-49) is a bioactive peptide of X antigen family member 1. The transcription of XAGE1A is regulated by methylation of the CpG island in the promoter. Alternative Names: Cancer / testis antigen 12.1 (33-49); G antigen family D member 2 (33-49). | |
| Xenin | Xenin, a 25-amino acid peptide initially isolated from human gastric mucosa, has 6 C-terminal amino acids in common with amphibian xenopsin. Xenin may stimulate the enzyme release from the exocrine pancreas. Alternative Names: Xenin-25; L-Methionyl-L-leucyl-L-threonyl-L-lysyl-L-phenylalanyl-L-α-glutamyl-L-threonyl-L-lysyl-L-seryl-L-alanyl-L-arginyl-L-valyl-L-lysylglycyl-L-leucyl-L-seryl-L-phenylalanyl-L-histidyl-L-prolyl-L-lysyl-L-arginyl-L-prolyl-L-tryptophyl-L-isoleucyl-L-leucine; Human Xenin. CAS No. 144092-28-4. Molecular formula: C139H224N38O32S. Mole weight: 2971.57. | |
| Xenin 8 acetate | Xenin-8, a C-terminal octapeptide, is a biologically active fragment of Xenin. Xenin-8 stimulates basal insulin secretion and potentiates the insulin response to glucose in a dose-dependent manner (EC50=0.16 nM). Molecular formula: C53H83N15O11. Mole weight: 1106.32. | |
| Xenopsin | Xenopsin, the neurotensin-like octapeptide from Xenopusskin at the carboxyl terminus of its precursor, shows sequence homology to mammalian neurotensin and shares a number of its biological properties. Alternative Names: H-Pyr-Gly-Lys-Arg-Pro-Trp-Ile-Leu-OH; 5-oxo-L-prolylglycyl-L-lysyl-L-arginyl-L-prolyl-L-tryptophyl-L-isoleucyl-L-leucine. Grades: >98%. CAS No. 51827-01-1. Molecular formula: C47H73N13O10. Mole weight: 980.16. | |
| Xenopsin 2TFA | Xenopsin 2TFA is a neurotensin-like octapeptide previously isolated from amphibian skin. Alternative Names: H-Pyr-Gly-Lys-Arg-Pro-Trp-Ile-Leu-OH.2TFA; L-pyroglutamyl-glycyl-L-lysyl-L-arginyl-L-prolyl-L-tryptophyl-L-isoleucyl-L-leucine trifluoroacetic acid; 5-Oxo-L-prolylglycyl-L-lysyl-L-arginyl-L-prolyl-L-tryptophyl-L-isoleucyl-L-leucine trifluoroacetate; Xenopsin trifluoroacetate; L-Leucine, N-[N-[N-[1-[N2-[N2-[N-(5-oxo-L-prolyl)glycyl]-L-lysyl]-L-arginyl]-L-prolyl]-L-tryptophyl]-L-isoleucyl]-, trifluoroacetate (1:2); Xenopsin (Xenopus amieti) trifluoroacetate. Grades: ≥95%. Molecular formula: C51H75F6N13O14. Mole weight: 1208.23. | |
| Xenopsin precursor fragment | Xenopsin precursor fragment is an antibacterial peptide isolated from Xenopus laevis. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Alternative Names: XPF; Gly-Trp-Ala-Ser-Lys-Ile-Gly-Gln-Thr-Leu-Gly-Lys-Ile-Ala-Lys-Val-Gly-Leu-Lys-Glu-Leu-Ile-Gln-Pro-Lys. Grades: >96%. Molecular formula: C123H211N33O32. Mole weight: 2664.23. | |
| XG 102 | XG-102 is a TAT-conjugated dextrose peptide that inhibits c-Jun N-terminal kinase, and has the potential to treat intraocular inflammation. Alternative Names: AM 111; XG 102 peptide; D-JNKI-1. CAS No. 1198367-70-2. Molecular formula: C164H285N65O41. Mole weight: 3823.49. | |
| XPF-SE1 | XPF-SE1 is an antibacterial peptide isolated from Silurana epitropicalis. It has strong activity against methicillin-resistant Staphylococcus aureus (MRSA). Alternative Names: Gly-Leu-Phe-Leu-Asp-Thr-Leu-Lys-Lys-Phe-Ala-Lys-Ala-Gly-Met-Glu-Ala-Val-Ile-Asn-Pro-Lys. Grades: >95%. Molecular formula: C111H183N27O29S. Mole weight: 2391.91. | |
| XPF-SE3 | XPF-SE3 is an antibacterial peptide isolated from Silurana epitropicalis. It has strong activity against methicillin-resistant Staphylococcus aureus (MRSA). Alternative Names: Gly-Phe-Trp-Thr-Thr-Ala-Ala-Glu-Gly-Leu-Lys-Lys-Phe-Ala-Lys-Ala-Gly-Leu-Ala-Ser-Ile-Leu-Asn-Pro-Lys. Grades: >95%. Molecular formula: C123H195N31O32. Mole weight: 2620.10. | |
| XPF-SE4 | XPF-SE4 is an antibacterial peptide isolated from Silurana epitropicalis. It has strong activity against methicillin-resistant Staphylococcus aureus (MRSA). Alternative Names: Gly-Val-Trp-Thr-Thr-Ile-Leu-Gly-Gly-Leu-Lys-Lys-Phe-Ala-Lys-Gly-Gly-Leu-Glu-Ala-Leu-Thr-Asn-Pro-Lys. Grades: >96%. Molecular formula: C121H199N31O32. Mole weight: 2600.11. | |
| XPF-St4 | XPF-St4 is an antibacterial peptide isolated from the African clawed frog Silurana tropicalis. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Alternative Names: Gly-Trp-Ala-Ser-Ser-Ile-Gly-Ser-Ile-Leu-Gly-Lys-Phe-Ala-Lys-Gly-Gly-Ala-Gln-Ala-Phe-Leu-Gln-Pro-Lys. Grades: >96%. Molecular formula: C117H183N31O31. Mole weight: 2519.94. | |
| XPF-St5 | XPF-St5 is an antibacterial peptide isolated from the African clawed frog Silurana tropicalis. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Alternative Names: Gly-Trp-Leu-Pro-Thr-Phe-Gly-Lys-Ile-Leu-Arg-Lys-Ala-Met-Gln-Leu-Gly-Pro-Lys-Leu-Ile-Gln-Pro-Ile. Grades: >96%. Molecular formula: C129H213N33O28S. Mole weight: 2706.39. | |
| XPF-St6 | XPF-St6 is an antibacterial peptide isolated from the African clawed frog Silurana tropicalis. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Alternative Names: Gly-Val-Trp-Ser-Thr-Ile-Leu-Gly-Gly-Leu-Lys-Lys-Phe-Ala-Lys-Gly-Gly-Leu-Asp-Ala-Ile-Val-Asn-Pro-Lys. Grades: >95%. Molecular formula: C120H197N31O31. Mole weight: 2570.08. | |
| XPF-St7 | XPF-St7 is an antibacterial peptide isolated from the African clawed frog Silurana tropicalis. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Alternative Names: Gly-Leu-Leu-Ser-Asn-Val-Ala-Gly-Leu-Leu-Lys-Gln-Phe-Ala-Lys-Gly-Gly-Val-Asn-Ala-Val-Leu-Asn-Pro-Lys. Grades: >96%. Molecular formula: C114H194N32O31. Mole weight: 2509.00. | |
| XPF-St8 | XPF-St8 is an antibacterial peptide isolated from the African clawed frog Silurana tropicalis. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Alternative Names: Gly-Phe-Met-Ser-Lys-Val-Ala-Asn-Phe-Ala-Lys-Lys-Phe-Ala-Lys-Gly-Gly-Val-Asn-Ala-Ile-Met-Asn-Gln-Lys. Grades: >97%. Molecular formula: C121H196N34O31S2. Mole weight: 2687.23. | |
| X-press Tag Peptide | X-press Tag Peptide, an N-terminal leader peptide containing a polyhistidine sequence, is a tag peptide used for protein purification. Alternative Names: H-Asp-Leu-Tyr-Asp-Asp-Asp-Asp-Lys-OH; L-alpha-aspartyl-L-leucyl-L-tyrosyl-L-alpha-aspartyl-L-alpha-aspartyl-L-alpha-aspartyl-L-alpha-aspartyl-L-lysine. Molecular formula: C41H59N9O20. Mole weight: 997.96. | |
| XT-2 | XT-2 is an antibacterial peptide isolated from Xenopus tropicalis (Diploid clawed frog, Africa). It has activity against gram-negative bacteria. Alternative Names: Gly-Cys-Trp-Ser-Thr-Val-Leu-Gly-Gly-Leu-Lys-Lys-Phe-Ala-Lys-Gly-Gly-Leu-Glu-Ala-Ile-Val-Asn-Pro-Lys. Grades: >95%. Molecular formula: C118H193N31O31S. Mole weight: 2574.08. | |
| XT-4 | Antimicrobial peptide 4 is an antimicrobial peptide found in Xenopus tropicalis skin secretions (Western clawed frog, Silurana tropicalis). It has antibacterial and antifungal activity. Alternative Names: Antimicrobial peptide 4; Gly-Val-Phe-Leu-Asp-Ala-Leu-Lys-Lys-Phe-Ala-Lys-Gly-Gly-Met-Asn-Ala-Val-Leu-Asn-Pro-Lys; Xenopus tropicalis antimicrobial peptide 4. Grades: ≥97%. CAS No. 398143-81-2. Molecular formula: C107H176N28O27S. Mole weight: 2318.81. | |
| XT-5 | Antimicrobial peptide 5 is an antimicrobial peptide found in Xenopus tropicalis skin secretions (Western clawed frog, Silurana tropicalis). It has antibacterial and antifungal activity. Alternative Names: Antimicrobial peptide 5; PGLa-like peptide-SE1; PGLa-SE1; Gly-Met-Ala-Thr-Lys-Ala-Gly-Thr-Ala-Leu-Gly-Lys-Val-Ala-Lys-Ala-Val-Ile-Gly-Ala-Ala-Leu-NH2; Xenopus tropicalis antimicrobial peptide 5; glycyl-L-methionyl-L-alanyl-L-threonyl-L-lysyl-L-alanylglycyl-L-threonyl-L-alanyl-L-leucylglycyl-L-lysyl-L-valyl-L-alanyl-L-lysyl-L-alanyl-L-valyl-L-isoleucylglycyl-L-alanyl-L-alanyl-L-leucinamide. Grades: ≥96%. CAS No. 398143-82-3. Molecular formula: C88H160N26O24S. Mole weight: 1998.47. | |
| XT-6 | Antimicrobial peptide 6 is an antimicrobial peptide found in Xenopus tropicalis skin secretions (Western clawed frog, Silurana tropicalis). It has antibacterial and antifungal activity. Alternative Names: Antimicrobial peptide 6; Gly-Phe-Leu-Gly-Ser-Leu-Leu-Lys-Thr-Gly-Leu-Lys-Val-Gly-Ser-Asn-Leu-Leu-NH2; Xenopus tropicalis antimicrobial peptide 6. Grades: 97%. CAS No. 398143-84-5. Molecular formula: C84H146N22O22. Mole weight: 1816.22. | |
| XT-7 | Antimicrobial peptide 7 is an antimicrobial peptide found in Xenopus tropicalis skin secretions (Western clawed frog, Silurana tropicalis). It has antibacterial and antifungal activity. Alternative Names: Antimicrobial peptide 7; Gly-Leu-Leu-Gly-Pro-Leu-Leu-Lys-Ile-Ala-Ala-Lys-Val-Gly-Ser-Asn-Leu-Leu-NH2; glycyl-L-leucyl-L-leucyl-glycyl-L-prolyl-L-leucyl-L-leucyl-L-lysyl-L-isoleucyl-L-alanyl-L-alanyl-L-lysyl-L-valyl-glycyl-L-seryl-L-asparagyl-L-leucyl-L-leucinamide; Xenopus tropicalis antimicrobial peptide 7. Grades: >96%. CAS No. 398143-86-7. Molecular formula: C83H150N22O20. Mole weight: 1776.25. | |
| YFGAP | YFGAP is an antibacterial peptide isolated from Yellowfin tuna (Thunnus albacares). It has activity against gram-positive bacteria and gram-negative bacteria. Alternative Names: YFGAP-OH; Val-Lys-Val-Gly-Ile-Asn-Gly-Phe-Gly-Arg-Ile-Gly-Arg-Leu-Val-Thr-Arg-Ala-Ala-Phe-His-Gly-Lys-Lys-Val-Glu-Val-Val-Ala-Ile-Asn-Asp. Molecular formula: C154H258N48O40. Mole weight: 3422.04. | |
| YNYNGGVKSDLN | YNYNGGVKSDLN. Alternative Names: Tyr-Asn-Tyr-Asn-Gly-Gly-Val-Lys-Ser-Asp-Leu-Asn. Molecular formula: C58H86N16O21. Mole weight: 1343.42. | |
| YRGDS Fibronectin Fragment | YRGDS Fibronectin Fragment is an adhesion peptide, a fibronectin fragment which displays strong binding affinity to thrombin-stimulated platelets. Alternative Names: H-Tyr-Arg-Gly-Asp-Ser-OH; YRGDS. Grades: 95%. CAS No. 134282-68-1. Molecular formula: C24H36N8O10. Mole weight: 596.59. | |
| Z-1,2-cis-ACHC-OH | Z-1,2-cis-ACHC-OH. Alternative Names: cis-1-(Benzyloxycarbonyl-amino)-cyclohexyl-2-carboxylic acid; Z-cis-2-aminocyclohexanecarboxylic acid. Grades: ≥ 99% (HPLC). CAS No. 54867-08-2. Molecular formula: C15H19NO4. Mole weight: 277.32. | |
| Z-1,2-cis-ACHeC-OH | Z-1,2-cis-ACHeC-OH. Alternative Names: cis-1-(Benzyloxycarbonyl-amino)-cyclohex-4-enyl-2-carboxylic acid. Grades: ≥ 99% (HPLC). CAS No. 124753-65-7. Molecular formula: C15H17NO4. Mole weight: 275.3. | |
| Z-1,2-diaminoethane HCl | Z-1,2-diaminoethane HCl (CAS# 18807-71-1) is a reagent used to synthesize new opioid ligand as an analgesics with mixed agonist and antagonist properties to induce tolerance and dependence. Alternative Names: Benzyl 2-Aminoethylcarbamate Hydrochloride; N-(Benzyloxycarbonyl)ethylenediamine Hydrochloride; N-[(Benzyloxy)carbonyl]-1,2-diaminoethane Hydrochloride; N-(Benzyloxycarbonyl)ethane-1,2-diamine Hydrochloride; N-(2-Aminoethyl)carbamic Acid Benzyl Ester Hydrochloride; 2-[[(Benzyloxy)carbonyl]amino]ethanamine Hydrochloride; 2-(Benzyloxycarbonylamino)ethylamine Hydrochloride; 1-(Benzyloxycarbonylamino)-2-aminoethane Hydrochloride; (2-Aminoethyl)carbamic Acid Benzyl Ester Hydrochloride. Grades: ≥95%. CAS No. 18807-71-1. Molecular formula: C10H15N2O2Cl. Mole weight: 230.69. | |
| Z-1,3-cis-ACHC-OH | Z-1,3-cis-ACHC-OH. Alternative Names: cis-1-(Benzyloxycarbonyl-amino)-cyclohexyl-3-carboxylic acid. Grades: ≥ 99% (HPLC). CAS No. 952616-39-6. Molecular formula: C15H19NO4. Mole weight: 277.31. | |
Our database is helping our users find suppliers everyday.
