BOC Sciences provides a wide range of research chemicals and biochemicals including inhibitors, building blocks, GMP Products, impurities and metabolites, APIs for Veterinary, Natural Compounds, ADCs, Stem Cell Molecule and chiral compounds.
×
Product
Description
Suppliers Website
Asp(3)-Calcitonin (salmon)
Asp(3)-Calcitonin is an impurity of Calcitonin salmon, which is a calcium regulating hormone used to be an effective alternative for the treatment of postmenopausal osteoporosis. Synonyms: Cys-Ser-Asp-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2(Cys1&Cys7 bridge); Asp3-Calcitonin(salmon); [Asp3]-Calcitonin (salmon); Calcitonin C; H-Cys-Ser-Asp-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2; CSDLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2(Cys1&Cys7 bridge); L-Cysteinyl-L-seryl-L-alpha-aspartyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-asparagyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolinamide (1->7)-disulfide; Asp(3)-Calcitonin. Grade: >90%. Molecular formula: C145H239N43O49S2. Mole weight: 3432.88.
ASP-4000
ASP-4000 is a dipeptidyl peptidase 4 (DPP) inhibitor with antihyperglycemic activity. Uses: Hyperlipidaemia;hyperlipoproteinaemia type iia;primary biliary cirrhosis. Synonyms: ASP4000; ASP-4000 free base; 2-Pyrrolidinecarbonitrile, 1-(((1R,3S,4S,6R)-6-hydroxy-2-azabicyclo(2.2.1)hept-3-yl)carbonyl)-, (2S)-. Grade: 98%. CAS No. 851510-67-3. Molecular formula: C12H17N3O2. Mole weight: 235.28.
ASP-4000 hydrochoride
ASP-4000 is a dipeptidyl peptidase 4 (DPP) inhibitor. It has antihyperglycemic activity. Uses: Antihyperglycemic agent. Synonyms: ASP-4000 hydrochoride; ASP 4000 hydrochoride; ASP4000 hydrochoride; UNII-7393JFE67B; (2S)-1-(((1R,3S,4S,6R)-6-Hydroxy-2-azabicyclo(2.2.1)hept-3-yl)carbonyl)-2-pyrrolidinecarbonitrile hydrochloride. Grade: 98%. CAS No. 851389-35-0. Molecular formula: C12H18ClN3O2. Mole weight: 271.74.
ASP-4058
ASP-4058 is a selective, next-generation and orally active Sphingosine 1-Phosphate receptors 1 and 5 (S1P1 and S1P5) agonist. It ameliorates experimental autoimmune encephalomyelitis in rodent with a favorable safety profile. Synonyms: 1H-Benzimidazole, 5-[5-[3-(trifluoromethyl)-4-[(1S)-2,2,2-trifluoro-1-methylethoxy]phenyl]-1,2,4-oxadiazol-3-yl]-; 5-{5-[3-(Trifluoromethyl)-4-{[(2S)-1,1,1-trifluoro-2-propanyl]oxy}phenyl]-1,2,4-oxadiazol-3-yl}-1H-benzimidazole. Grade: ≥95%. CAS No. 952565-91-2. Molecular formula: C19H12F6N4O2. Mole weight: 442.31.
ASP-4058 hydrochloride
ASP-4058 hydrochloride is a selective, next-generation and orally active Sphingosine 1-Phosphate receptors 1 and 5 (S1P1 and S1P5) agonist. It ameliorates experimental autoimmune encephalomyelitis in rodent with a favorable safety profile. Synonyms: 5-(5-(3-(Trifluoromethyl)-4-(((2S)-1,1,1-trifluoropropan-2-yl)oxy)phenyl)-1,2,4-oxadiazol-3-yl)-1H-benzimidazole hydrochloride; 1H-Benzimidazole, 6-(5-(3-(trifluoromethyl)-4-((1S)-2,2,2-trifluoro-1-methylethoxy)phenyl)-1,2,4-oxadiazol-3-yl)-, hydrochloride (1:1). Grade: ≥95%. CAS No. 952510-14-4. Molecular formula: C19H13ClF6N4O2. Mole weight: 478.78.
ASP4132
ASP4132 is an orally active activator of adenosine monophosphate-activated protein kinase (AMPK) with EC50 of 0.018 μM. CAS No. 1640294-30-9. Molecular formula: C46H51F3N6O8S2. Mole weight: 937.06.
ASP-5854
ASP-5854 is an adenosine A1 and A2A receptor antagonist receptor. It has therapeutic potential for the treatment of Parkinson's disease to ameliorate motor deficiencies. Uses: Parkinson's disease. Synonyms: ASP-5854; ASP 5854; ASP5854; UNII-BJS8Y4IC5V; C524699; 5-(5-amino-3-(4-fluorophenyl)-2-pyrazinyl)-1-(1-methylethyl)-2(1H)-Pyridinone. Grade: 98%. CAS No. 851087-60-0. Molecular formula: C18H17FN4O. Mole weight: 324.35.
ASP5878
ASP5878 is a potent and selective inhibitor of fibroblast growth factor receptor (FGFR). Synonyms: ASP-5878; ASP 5878. CAS No. 1453208-66-6. Molecular formula: C18H19F2N5O4. Mole weight: 407.37.
Asp5-Atosiban
An impurity of Atosiban. Atosiban is a synthetic peptide that acts as a selective oxytocin receptor antagonist, primarily used to delay preterm labor in pregnant women. Synonyms: Mpr-DTyr(Et)-Ile-Thr-Asp-Cys-Pro-Orn-Gly-NH2(Mpr1&Cys6 bridge); deamino-Cys-D-Tyr(Et)-Ile-Thr-Asp-Cys-Pro-Orn-Gly-NH2 (Disulfide bridge: Cys1-Cys6); Deamino-cysteinyl-O4-ethyl-D-tyrosyl-L-isoleucyl-L-threonyl-L-alpha-aspartyl-L-cysteinyl-L-prolyl-L-ornithyl-glycinamide (1->6)-disulfide; [Asp5]-Atosiban; Asp(5)-Atosiban. Grade: ≥95%. CAS No. 2014351-16-5. Molecular formula: C43H66N10O13S2. Mole weight: 995.18.
Asp(5)-AVP
Asp(5)-AVP is an impurity of Vasopressin, which is an antidiuretic hormone secreted from the posterior pituitary. Synonyms: Asp5-AVP; Asp(5)-Arg-Vasopressin; Asp(5)-Vasopressin; Vasopressin, 5-L-aspartic acid-8-L-arginine-; H-Cys-Tyr-Phe-Gln-Asp-Cys-Pro-Arg-Gly-NH2 (Disulfide bridge: Cys1-Cys6); L-cysteinyl-L-tyrosyl-L-phenylalanyl-L-glutaminyl-L-aspartyl-L-cysteinyl-L-prolyl-L-arginyl-glycinamide (1->6)-disulfide. CAS No. 78031-79-5. Molecular formula: C46H64N14O13S2. Mole weight: 1085.22.
Asp 5-Oxytocin
Asp 5-Oxytocin is an impurity of Oxytocin, which is a mammalian neurohypophysial hormone used as a vasodilator agent. Synonyms: [5-Aspartic acid]oxytocin; L-Cystyl-L-tyrosyl-L-isoleucyl-L-glutaminyl-L-aspartyl-L-cystyl-L-leucyl-L-prolyl-L-glycinamide (disulfide bridge between cysteines); H-Cys-Tyr-Ile-Gln-Asp-Cys-Pro-Leu-Gly-NH2 (Disulfide bridge: Cys1-Cys6); Oxytocin, 5-L-aspartic acid-; [5-Aspartic acid]-oxytocin; L-Cysteinyl-L-tyrosyl-L-isoleucyl-L-glutaminyl-L-alpha-aspartyl-L-cysteinyl-L-prolyl-L-leucyl-glycinamide (1->6)-disulfide; [Asp5]-Oxytocin; Oxytocin EP Impurity I; 5-L-Aspartic acid-oxytocin; 5-Asp-oxytocin; Asp5-Oxytocin; Asp5-Oxytocin; CYIQDCPLG-NH2(Cys1&Cys6 bridge); Cys-Tyr-Ile-Gln-Asp-Cys-Pro-Leu-Gly-NH2(Cys1&Cys6 bridge). Grade: ≥95%. CAS No. 65907-78-0. Molecular formula: C43H65N11O13S2. Mole weight: 1008.18.
ASP-7657
ASP-7657 is an analgesic and anti-inflammatory agent for the treatment of diabetic neuropathies developed by Astellas Pharma. A phase I clinical trial to evaluate the safety and tolerability of single and multiple ascending oral doses of ASP7657 in healthy subjects was started in 2014 but discontinued in 2015. Uses: An analgesics and anti-inflammatories for the treatment of diabetic neuropathies. Synonyms: ASP 7657; ASP7657; trans-4-[[[[1-(2-quinolinylmethyl)-5-(trifluoromethyl)-1H-indol-7-yl]carbonyl]amino]methyl]-cyclohexanecarboxylic acid. Grade: ≥98%. CAS No. 1196045-28-9. Molecular formula: C28H26F3N3O3. Mole weight: 509.52.
ASP 7663
ASP 7663 has been found to be a TRPA1 activator and could show abdominal analgesic activities. Synonyms: ASP7663; ASP-7663; ASP 7663; (2E)-2-[7-Fluoro-1,2-dihydro-1-(2-methylpropyl)-2-oxo-3H-indol-3-ylidene]acetic acid. Grade: ≥98% by HPLC. CAS No. 1190217-35-6. Molecular formula: C14H14FNO3. Mole weight: 263.26.
Asp(7)-Linaclotide
Asp(7)-Linaclotde is an impurity of Linaclotide, which is a peptide agonist of guanylate cyclase 2C used for the treatment of abdominal pain in patients with irritable bowel syndrome (IBS) associated with constipation. Synonyms: L-cysteinyl-L-cysteinyl-L-alpha-glutamyl-L-tyrosyl-L-cysteinyl-L-cysteinyl-L-α-aspartyl-L-prolyl-L-alanyl-L-cysteinyl-L-threonyl-glycyl-L-cysteinyl-L-tyrosine (1-6),(2-10),(5-13)-tris(disulfide); H-Cys-Cys-Glu-Tyr-Cys-Cys-Asp-Pro-Ala-Cys-Thr-Gly-Cys-Tyr-OH (Disulfide bridge: Cys1-Cys6, Cys2-Cys10, Cys5-Cys13); [7-Asp]-linaclotide; L-Tyrosine, L-cysteinyl-L-cysteinyl-L-α-glutamyl-L-tyrosyl-L-cysteinyl-L-cysteinyl-L-α-aspartyl-L-prolyl-L-alanyl-L-cysteinyl-L-threonylglycyl-L-cysteinyl-, cyclic (1→6),(2→10),(5→13)-tris(disulfide). CAS No. 1207977-38-5. Molecular formula: C59H78N14O22S6. Mole weight: 1527.71.
ASP-8497
ASP8497 is a long-acting and potent DPP-IV inhibitor. It improves glucose tolerance through glucose-dependent insulinotropic action via elevation of the GLP-1 level. It is used as a therapeutic agent for impaired glucose tolerance and type 2 diabetes. Uses: Asp8497 is used as a therapeutic agent for impaired glucose tolerance and type 2 diabetes. Synonyms: 2-Pyrrolidinecarbonitrile, 4-fluoro-1-(((4-methyl-1-(methylsulfonyl)-4-piperidinyl)amino)acetyl)-, (2S,4S)-(2E)-2-butenedioate (1:1); ASP8497; ASP 8497; (E)-but-2-enedioic acid (2S,4S)-4-fluoro-1-[2-[(4-methyl-1-methylsulfonylpiperidin-4-yl)amino]acetyl]pyrrolidine-2. Grade: 98%. CAS No. 651055-26-4. Molecular formula: C18H27FN4O7S. Mole weight: 462.49.
ASP-8497 free base
ASP-8497 free base is a long-acting and potent DPP-IV inhibitor. It improves glucose tolerance through glucose-dependent insulinotropic action via elevation of the GLP-1 level. It is used as a therapeutic agent for impaired glucose tolerance and type 2 diabetes. Uses: Asp-8497 free base is used as a therapeutic agent for impaired glucose tolerance and type 2 diabetes. Synonyms: 2-Pyrrolidinecarbonitrile, 4-fluoro-1-(((4-methyl-1-(methylsulfonyl)-4-piperidinyl)amino)acetyl)-, (2S,4S)-; (2S,4S)-4-fluoro-1-[2-[(4-methyl-1-methylsulfonylpiperidin-4-yl)amino]acetyl]pyrrolidine-2-carbonitrile; ASP8497; ASP 8497 free base. Grade: 98%. CAS No. 651055-25-3. Molecular formula: C14H23FN4O3S. Mole weight: 346.42.
Asp8,Gly12-Terlipressin
An impurity of Terlipressin. Terlipressin is a synthetic vasopressin analogue primarily used to improve kidney function in adults with hepatorenal syndrome (HRS), a condition that causes kidney problems in individuals with severe liver disease. It acts as a vasoconstrictor, predominantly in the splanchnic circulation, which helps increase arterial pressure and reduce portal venous pressure. Synonyms: Gly-Gly-Gly-Cys-Tyr-Phe-Gln-Asp-Cys-Pro-Lys-Gly(Cys4&Cys9 bridge); [8-L-aspartic acid,12-glycine]terlipressin; Terlipressin EP Impurity L; H-Gly-Gly-Gly-Cys-Tyr-Phe-Gln-Asp-Cys-Pro-Lys-Gly-OH (Disulfide bridge: Cys4-Cys9); Glycyl-glycyl-glycyl-L-cysteinyl-L-tyrosyl-L-phenylalanyl-L-α-aspartyl-L-asparagyl-L-cysteinyl-L-prolyl-L-lysyl-glycine (4->9)-disulfide; GGGCYFQDCPKG(Cys4&Cys9 bridge); [Asp8, Gly12]-Terlipressin; Terlipressin Impurity L; [Asp(8), Gly(12)]-Terlipressin [Asp(8)-TLY-COOH]. Grade: ≥95%. Molecular formula: C52H72N14O17S2. Mole weight: 1229.35.
Asp8-Terlipressin
An impurity of Terlipressin. Terlipressin is a synthetic vasopressin analogue primarily used to improve kidney function in adults with hepatorenal syndrome (HRS), a condition that causes kidney problems in individuals with severe liver disease. It acts as a vasoconstrictor, predominantly in the splanchnic circulation, which helps increase arterial pressure and reduce portal venous pressure. Synonyms: Gly-Gly-Gly-Cys-Tyr-Phe-Gln-Asp-Cys-Pro-Lys-Gly-NH2(Cys4&Cys9 bridge); α-Asp(8)-Terlipressin; GGGCYFQDCPKG-NH2(Cys4&Cys9 bridge); N-[N-(N-Glycylglycyl)glycyl]-5-L-aspartic acid-8-L-lysine-vasopressin; Terlipressin EP Impurity H; [8-L-α-aspartic acid]terlipressin; H-Gly-Gly-Gly-Cys-Tyr-Phe-Gln-Asp-Cys-Pro-Lys-Gly-NH2 (Disulfide bridge: Cys4-Cys9); Glycyl-glycyl-glycyl-L-cysteinyl-L-tyrosyl-L-phenylalanyl-L-glutaminyl-L-α-aspartyl-L-cysteinyl-L-prolyl-L-lysyl-glycinamide (4->9)-disulfide; [Asp8]-Terlipressin; Asp(8)-Terlipressin. Grade: ≥95%. CAS No. 159594-68-0. Molecular formula: C52H73N15O16S2. Mole weight: 1228.37.
ASP-9521
ASP9521 is a novel, selective, orally bioavailable inhibitor of 17β-hydroxysteroid dehydrogenase type 5 (17βHSD5; AKR1C3). ASP9521 has demonstrated anti-tumour activity in in vitro and in vivo preclinical models. ASP9521 inhibited conversion of androstenedione (AD) into testosterone (T) by recombinant human or cynomolgus monkey AKR1C3 in a concentration-dependent manner. Synonyms: ASP9521; ASP-9521; ASP 9521. AKR1C3 inhibitor ; 17HSD5 inhibitor; 4-(2-Hydroxy-2-methylpropyl)piperidino(5-methoxy-1H-indole-2-yl)methanone; 1-[1-[(5-Methoxy-1H-indol-2-yl)carbonyl]piperidin-4-yl]-2-methylpropan-2-ol. Grade: 98%. CAS No. 1126084-37-4. Molecular formula: C19H26N2O3. Mole weight: 330.428.
Asp9-Bivalirudin
Asp9-Bivalirudin is a modified analog of the anticoagulant peptide Bivalirudin, with an aspartic acid residue at the 9th position. Bivalirudin is a direct thrombin inhibitor used as an anticoagulant to prevent blood clots in patients undergoing certain medical procedures or with specific conditions. Synonyms: H-D-Phe-Pro-Arg-Pro-Gly-Gly-Gly-Gly-Asp-Gly-Asp-Phe-Glu-Glu-Ile-Pro-Glu-Glu-Tyr-Leu-OH; D-Phenylalanyl-L-prolyl-L-arginyl-L-prolylglycylglycylglycylglycyl-L-α-aspartylglycyl-L-α-aspartyl-L-phenylalanyl-L-α-glutamyl-L-α-glutamyl-L-isoleucyl-L-prolyl-L-α-glutamyl-L-α-glutamyl-L-tyrosyl-L-leucine; [Asp9]-Bivalirudin; DPhe-PRPGGGGDGDFEEIPEEYL; DPhe-Pro-Arg-Pro-Gly-Gly-Gly-Gly-Asp-Gly-Asp-Phe-Glu-Glu-Ile-Pro-Glu-Glu-Tyr-Leu. Grade: ≥95%. CAS No. 1182140-65-3. Molecular formula: C98H137N23O34. Mole weight: 2181.27.
Aspartic acid calcium
Aspartic acid calcium is a chelate where calcium is attached to L-Aspartic acid, an amino acid that is used in the biosynthesis of proteins. Synonyms: Calcium L-aspartate; Aspartic acid, calcium salt, L-; L-Aspartic acid, calcium salt; Calcium aspartate. CAS No. 21059-46-1. Molecular formula: C4H7NO4.xCa.
Aspartyl-alanyl-diketopiperazine acetate
Aspartyl-alanyl-diketopiperazine acetate is an immunomodulatory molecule generated by cleavage and cyclization from the N-terminus of human albumin and can modulate the inflammatory immune response through a molecular pathway implicated in T-lymphocyte anergy. Synonyms: DA-DKP acetate. Molecular formula: C9H14N2O6. Mole weight: 246.22.
Asp-Asp-Asp-Asp-Asp acetate
Asp-Asp-Asp-Asp-Asp acetate is an extensively studied biomedical agent exhibiting significant potential in studying various diseases. Through its agonistic nature towards specific receptors, this compound exemplifies its efficacy in studying neurological disorders and immune-related ailments. Molecular formula: C22H31N5O18. Mole weight: 653.51.
Asp-Clipped Eptifibatide
An impurity of Eptifibatide. Eptifibatide is a glycoprotein IIb/IIIa inhibitor used primarily to prevent blood clots in patients with acute coronary syndromes (ACS) and during percutaneous coronary interventions (PCI). Synonyms: A?Mpr-Har-Gly-Asp B?Trp-Pro-Cys-NH2(Mpr1&Cys7 bridge); A:Mpr-Har-GD B?WPC-NH2(Mpr&Cys bridge); L-Aspartic acid, N6-(aminoiminomethyl)-N2-(3-mercapto-1-oxopropyl)-L-lysylglycyl-, (1→3')-disulfide with L-tryptophyl-L-prolyl-L-cysteinamide; Trp-Pro-Cys(1)-NH2, Cys(1)-deamino-hArg-Gly-Asp(Disulfide bond); deamino-Cys-hArg-Gly-Asp.Trp-Pro-Cys-NH2 (Disulfide bridge: Cys1-Cys3'); Eptifibatide Impurity 2. Grade: ≥95%. CAS No. 358620-99-2. Molecular formula: C35H51N11O10S2. Mole weight: 849.98.
Aspergillumarin B
Aspergillumarins B is a dihydroisocoumarin derivative isolated from the culture broth of a marine-derived fungus Aspergillus sp., which was isolated from the fresh leaf of the mangrove tree Bruguiera gymnorrhiza collected from the South China Sea. Aspergillumarins B showed weak antibacterial activity against Staphylococcus aureus and Bacillus subtilis at a concentration of 50 μg/mL. CAS No. 1392495-07-6. Molecular formula: C14H18O4. Mole weight: 250.29.
Aspochalasin M
Aspochalasin M is a fungal metabolite originally isolated from S. elegans. It can inhibit the growth of HL-60 cells (IC50 = 20 μM). Synonyms: Aspochalasin M; 1173040-34-0; (1S,5S,9Z,11S,14S,15R,16S)-5-hydroxy-9,13,14-trimethyl-16-(2-methylpropyl)-17-azatricyclo[9.7.0.01,15]octadeca-9,12-diene-2,6,18-trione; (3S,3aR,4S,6aS,7E,12S,15aS)-3,3a,4,6a,9,10,13,14-octahydro-12-hydroxy-4,5,8-trimethyl-3-(2-methylpropyl)-1H-cycloundec[d]isoindole-1,11,15(2H,12H)-trione. Grade: >95%. CAS No. 1173040-34-0. Molecular formula: C24H35NO4. Mole weight: 401.54.
Aspulvinone O
Aspulvinone O is a fungal metabolite originally isolated from P. variotti and has antioxidant and anticancer activities. It inhibits aspartate transaminase 1 (GOT1, Kd=3.32 μM) and is cytotoxic to PANC-1, AsPC-1, and SW1990 pancreatic cancer cells (IC50s = 20.54-26.8 μM). Aspulvinone O (2.5 and 5 mg/kg) reduces tumor growth in an SW1990 mouse xenograft model because it reduces the oxygen consumption rate (OCR) and induces apoptosis in SW1990 cells. Synonyms: 914071-54-8; 3-[2,4-dihydroxy-5-(3-methyl-2-buten-1-yl)phenyl]-4-hydroxy-5-[[4-hydroxy-3-(3-methyl-2-buten-1-yl)phenyl]methylene]-2(5H)-furanone(5Z)-3-[2,4-dihydroxy-5-(3-methylbut-2-enyl)phenyl]-4-hydroxy-5-[[4-hydroxy-3-(3-methylbut-2-enyl)phenyl]methylidene]furan-2-one; Aspulvinone OMEGxm0_000073. Grade: >98%. CAS No. 914071-54-8. Molecular formula: C27H28O6. Mole weight: 448.51.
AST-1306
AST-1306 functions as an irreversible inhibitor, most likely through covalent interaction with Cys797 and Cys805 in the catalytic domains of EGFR and ErbB2, respectively. It inactivated pathways downstream of these receptors and thereby inhibited the proliferation of a panel of cancer cell lines. It blocks phosphorylation of EGFR and also prevents downstream pathways. It also dose-dependently inhibits EGF-induced EGFR phosphorylation in the A549 cancer cell line. Synonyms: AST-1306; AST 1306; AST1306. Grade: >98%. CAS No. 897383-62-9. Molecular formula: C24H18ClFN4O2. Mole weight: 448.88.
AST-1306 tosylate
AST-1306 is a novel irreversible inhibitor of EGFR and ErbB2 with IC50 of 0.5 nM and 3 nM, also effective in mutation EGFR T790M/L858R, more potent to ErbB2-overexpressing cells, 3000-fold selective for ErbB family than other kinases. Synonyms: AST-6; AST 6; AST6. Grade: >98%. CAS No. 1050500-29-2. Molecular formula: C24H18ClFN4O2,C7H8O3S. Mole weight: 621.08.
AST 487
AST487 is a Ret kinase inhibitor/FLT3 inhibitor, which displays high selectivity and potency toward FLT3 as a molecular target, and which could potentially be used to override drug resistance in AML. It induced a dose-dependent growth inhibition of xenografts of NIH3T3 cells expressing oncogenic RET, and of the MTC cell line TT in nude mice.It also inhibited calcitonin gene expression in vitro in TT cells, in part, through decreased gene transcription. Synonyms: NVP-AST 487; NVPAST487; AST 487; AST487; AST-487. Grade: >98%. CAS No. 630124-46-8. Molecular formula: C26H30F3N7O2. Mole weight: 529.56.
AST5902
AST5902, a major metabolite of Alflutinib in vivo and in vitro, is an EGFR inhibitor with antineoplastic activity. Synonyms: 2-Propenamide, N-[5-[[4-(1-methyl-1H-indol-3-yl)-2-pyrimidinyl]amino]-2-[methyl[2-(methylamino)ethyl]amino]-6-(2,2,2-trifluoroethoxy)-3-pyridinyl]-; N-[5-[[4-(1-Methyl-1H-indol-3-yl)-2-pyrimidinyl]amino]-2-[methyl[2-(methylamino)ethyl]amino]-6-(2,2,2-trifluoroethoxy)-3-pyridinyl]-2-propenamide; AST 5902; AST-5902. Grade: ≥95%. CAS No. 2412155-74-7. Molecular formula: C27H29F3N8O2. Mole weight: 554.57.
AST5902 mesylate
AST5902 mesylate, a major metabolite of Alflutinib in vivo and in vitro, is an EGFR inhibitor with antineoplastic activity. Synonyms: 2-Propenamide, N-[5-[[4-(1-methyl-1H-indol-3-yl)-2-pyrimidinyl]amino]-2-[methyl[2-(methylamino)ethyl]amino]-6-(2,2,2-trifluoroethoxy)-3-pyridinyl]-, compd. with methanesulfonate (1:1); AST 5902 mesylate; AST-5902 mesylate; N-(2-(methyl(2-(methylamino)ethyl)amino)-5-((4-(1-methyl-1H-indol-3-yl)pyrimidin-2-yl)amino)-6-(2,2,2-trifluoroethoxy)pyridin-3-yl)acrylamide methanesulfonate. Grade: ≥95%. CAS No. 2412155-75-8. Molecular formula: C27H29F3N8O2.CH4O3S. Mole weight: 650.67.
AST5902 trimesylate
AST5902 trimesylate, a major metabolite of Alflutinib in vivo and in vitro, is an EGFR inhibitor with antineoplastic activity. Synonyms: N-[5-{[4-(1-Methyl-1H-indol-3-yl)-2-pyrimidinyl]amino}-2-{methyl[2-(methylamino)ethyl]amino}-6-(2,2,2-trifluoroethoxy)-3-pyridinyl]acrylamide methanesulfonate (1:3); 2-Propenamide, N-[5-[[4-(1-methyl-1H-indol-3-yl)-2-pyrimidinyl]amino]-2-[methyl[2-(methylamino)ethyl]amino]-6-(2,2,2-trifluoroethoxy)-3-pyridinyl]-, methanesulfonate (1:3). Grade: ≥98%. CAS No. 2929417-90-1. Molecular formula: C30H41F3N8O11S3. Mole weight: 842.88.
Astemizole is a potent and orally active nonsedating-type histamine H1 receptor antagonist with IC50 value of 4 nM. It competitively binds to histamine H1 receptor sites in the uterus, gastrointestinal tract, bronchial muscle and blood vessels. It suppresses the formation of edema and pruritus caused by histamine. It has antipruritic and anticholinergic effects. It is also a potent blocker of ether-a-go-go-related gene (ERG) potassium channel blocker with IC50 value of 0.9 nM. It exhibits antimalarial activity in multidrug resistant strains in vitro with IC50 value of 227-734 nM. It has the potential for combination therapy with antivancer drugs in resistant leukemia. It is considerably less potent at muscarinic acetylcholine receptors with Ki value of 2.4 μM. It may be used as a potential antineoplastic agent for decreasing proliferation of various cancer cells. It may be used as a pharmacological chaperone to restore protein function for some mutated forms of hERG channels and correct folding defects. It was developed by Johnson & Johnson. Synonyms: 1-(p-Fluorobenzyl)-2-((1-(2-(p-methoxyphenyl)ethyl)piperid-4-yl)amino)benzim; Laridal; 1-[(4-Fluorophenyl)methyl]-N-[1-[2-(4-methoxyphenyl)ethyl]-4-piperidinyl]-1H-benzimidazol-2-amine; Astemisan; Hismanal; Histamen; Paralergin; R 42512; Retolen; Waruzol. Grade: ≥99% by HPLC. CAS No. 68844-77-9. Molecular formula: C28H31FN4O. Mole weight: 458.57.
Astragaloside VI
Astragaloside VI accelerates wound healing by activating the epidermal growth factor receptor/extracellular signal-regulated kinase (EGFR/ERK) signaling pathway. Synonyms: (3β,6α,9β,16β,20R,24S)-3-{[2-O-(β-D-Glucopyranosyl)-β-D-xylopyranosyl]oxy}-16,25-dihydroxy-20,24-epoxy-9,19-cyclolanostan-6-yl β-D-glucopyranoside; β-D-Glucopyranoside, (3β,6α,9β,16β,20R,24S)-20,24-epoxy-3-[(2-O-β-D-glucopyranosyl-β-D-xylopyranosyl)oxy]-16,25-dihydroxy-9,19-cyclolanostan-6-yl. Grade: ≥98%. CAS No. 84687-45-6. Molecular formula: C47H78O19. Mole weight: 947.11.
Astressin 2B TFA
Astressin 2B TFA is a selective and potent corticotropin-releasing factor receptor 2 (CRF2) antagonist with IC50 values of > 500 nM and 1.3 for CRF1 and CRF2 respectively. It antagonizes CRF2-mediated inhibition of gastric emptying. Grade: 98%. Molecular formula: C183H307N49O53.xC2HF3O2. Mole weight: 4041.69 (free base).
ASTX-029
ASTX029 is a highly potent and selective dual-mechanism ERK inhibitor. ASTX029 inhibits both ERK catalytic activity and the phosphorylation of ERK itself by MEK, despite not directly inhibiting MEK activity. Synonyms: ASTX 029; ASTX029; ERK1/2 inhibitor 2. CAS No. 2095719-92-7. Molecular formula: C29H31ClFN5O5. Mole weight: 584.04.
ASTX-660 2HCl
The dihydrochloride salt form of ASTX-660 which is found to be an IAP as well as XIAP inhitor that could be significant in the studies of lymphoma and solid tumours. It is still under Phase I/II trial. Synonyms: ASTX660 2HCl; ASTX-660 2HCl; ASTX 660 2HCl; 1-(6-(4-fluorobenzyl)-3,3-dimethylindolin-1-yl)-2-((2R,5R)-5-methyl-2-(((R)-3-methylmorpholino)methyl)piperazin-1-yl)ethan-1-one dihydrochloride. Grade: 98%. CAS No. 1605316-16-2. Molecular formula: C30H43Cl2FN4O2. Mole weight: 581.59.
ASTX-660 Freebase
ASTX-660 is found to be an IAP as well as XIAP inhitor that could be significant in the studies of lymphoma and solid tumours. It is still under Phase I/II trial. Synonyms: ASTX660; ASTX-660; ASTX 660; 1-(6-(4-fluorobenzyl)-3,3-dimethylindolin-1-yl)-2-((2R,5R)-5-methyl-2-(((R)-3-methylmorpholino)methyl)piperazin-1-yl)ethan-1-one. Grade: 98%. CAS No. 1605584-14-2. Molecular formula: C30H41FN4O2. Mole weight: 508.59.
Asu11-Bivalirudin
Asu11-Bivalirudin is a modified form of the anticoagulant Bivalirudin, where the amino acid at the 11th position is replaced with a specific residue. Bivalirudin is a direct thrombin inhibitor used as an anticoagulant to prevent blood clots in patients undergoing certain medical procedures or with specific conditions. Synonyms: DPhe-Pro-Arg-Pro-Gly-Gly-Gly-Gly-Asn-Gly-Asu-Phe-Glu-Glu-Ile-Pro-Glu-Glu-Tyr-Leu; D-Phenylalanyl-L-prolyl-L-arginyl-L-prolylglycylglycylglycylglycyl-L-asparaginylglycyl-(αS,3S)-3-amino-2,5-dioxo-α-(phenylmethyl)-1-pyrrolidineacetyl-L-α-glutamyl-L-α-glutamyl-L-isoleucyl-L-prolyl-L-α-glutamyl-L-α-glutamyl-L-tyrosyl-L-leucine; H-D-Phe-Pro-Arg-Pro-Gly-Gly-Gly-Gly-Asn-Gly-Asu-Phe-Glu-Glu-Ile-Pro-Glu-Glu-Tyr-Leu-OH; DPhe-PRPGGGGNG-Asu-FEEIPEEYL; Bivalirudin Impurity 3; [11-12]-Cycloimido-bivalirudin; Asu 12 Bivalirudin; Bivalirudin Impurity 12; [Asu11]-Bivalirudin. Grade: ≥95%. CAS No. 1224964-32-2. Molecular formula: C98H136N24O32. Mole weight: 2162.27.
Asu26-Calcitonin salmon
An impurity of Calcitonin (salmon). Calcitonin (salmon) is a synthetic form of the hormone calcitonin, derived from salmon. It is a potent 32-amino acid peptide used primarily to manage bone health and calcium regulation. Calcitonin (salmon) is used to treat conditions such as postmenopausal osteoporosis, Paget's disease, and hypercalcemia. Synonyms: Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asu-Thr-Gly-Ser-Gly-Thr-Pro-NH2(Cys1&Cys7 bridge); CSNLSTCVLGKLSQELHKLQTYPRT-Asu-TGSGTP-NH2(Cys1&Cys7 bridge); Asu26-Calcitonin; Asu26-Calcitonin (salmon); [Asu26]-Calcitonin (salmon); Asu(26)-Calcitonin (salmon). Grade: ≥95%. Molecular formula: C145H237N43O48S2. Mole weight: 3414.86.
Asu30-Teriparatide
Asu30-Teriparatide is an impurity of Teriparatide, which is an anabolic osteoporosis drug used to treat osteoporosis. Synonyms: Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asu-Val-His-Asn-Phe; Teriparatide succinimide 30; [Asu30]-Teriparatide; Asu(30)-Teriparatide. Grade: ≥95%. Molecular formula: C181H289N55O50S2. Mole weight: 4099.76.
Asu3-Calcitonin salmon
An impurity of Calcitonin (salmon). Calcitonin (salmon) is a synthetic form of the hormone calcitonin, derived from salmon. It is a potent 32-amino acid peptide used primarily to manage bone health and calcium regulation. Calcitonin (salmon) is used to treat conditions such as postmenopausal osteoporosis, Paget's disease, and hypercalcemia. Synonyms: Cys-Ser-Asu-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2(Cys1&Cys7 bridge); CS-Asu-LSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2(Cys1&Cys7 bridge); Asu3-Calcitonin; Asu3-Calcitonin (salmon); [Asu3]-Calcitonin (salmon); Asu(3)-Calcitonin (salmon). Grade: ≥95%. Molecular formula: C145H237N43O48S2. Mole weight: 3414.86.
Asu9-Bivalirudin
Asu9-Bivalirudin is a modified form of the anticoagulant Bivalirudin, where the amino acid at the 9th position is replaced with a specific residue. Bivalirudin is a direct thrombin inhibitor used as an anticoagulant to prevent blood clots in patients undergoing certain medical procedures or with specific conditions. Synonyms: DPhe-Pro-Arg-Pro-Gly-Gly-Gly-Gly-Asu-Gly-Asp-Phe-Glu-Glu-Ile-Pro-Glu-Glu-Tyr-Leu; DPhe-PRPGGGG-Asu-GDFEEIPEEYL; D-Phenylalanyl-L-prolyl-L-arginyl-L-prolylglycylglycylglycylglycyl-(3S)-3-amino-2,5-dioxo-1-pyrrolidineacetyl-L-α-aspartyl-L-phenylalanyl-L-α-glutamyl-L-α-glutamyl-L-isoleucyl-L-prolyl-L-α-glutamyl-L-α-glutamyl-L-tyrosyl-L-leucine; H-D-Phe-Pro-Arg-Pro-Gly-Gly-Gly-Gly-Asu-Gly-Asp-Phe-Glu-Glu-Ile-Pro-Glu-Glu-Tyr-Leu-OH; [9-10]-Cycloimido-bivalirudin; [Asu9]-Bivalirudin. Grade: ≥95%. CAS No. 1224964-31-1. Molecular formula: C98H135N23O33. Mole weight: 2163.29.
Asunaprevir
Asunaprevir is a potent hepatitis C virus (HCV) non-structural protein protease inhibitor currently in Phase III clinical trials for the treatment of HCV infection. Uses: Protease inhibitors. Synonyms: BMS-650032; BMS 650032; BMS650032; Asunaprevir. brand name: Sunvepra. Grade: >98%. CAS No. 630420-16-5. Molecular formula: C35H46ClN5O9S. Mole weight: 748.29.
Asymmetric Doubler (Lev) Phosphoramidite
Asymmetric Doubler (Lev) Phosphoramidite is a critical reagent used in the synthesis of nucleic acids with high efficiency and precision. It serves as a catalyst for the asymmetric doubling of chiral phosphoramidites, making it an essential tool for the production of oligonucleotides used in diagnostics and therapeutics for various diseases including cancer, viral infections and genetic disorders. Synonyms: 1-[5-(4,4'-dimethoxytrityloxy)pentylamido]-3-[5-levulinyloxypentylamido]-propyl-2-[(2-cyanoethyl)-(N,N-diisopropyl)]-phosphoramidite. Molecular formula: C48H67N4O10P. Mole weight: 891.04.
Asymmetric Methylene Conjugated Emtricitabine Dimer is an impurity of Emtricitabine, which is a nucleoside reverse transcriptase inhibitor for the treatment of HIV infection in adults and children. Synonyms: Emtricitabine Tenofovir FT3 IMP; Emtricitabine Asymmetric Dimer; 4-Amino-5-fluoro-1-[(2R,5S)-2-[[[[5-fluoro-1,2-dihydro-1-[(2R,5S)-2-(hydroxymethyl)-1,3-oxathiolan-5-yl]-2-oxo-4-pyrimidinyl]amino]methoxy]methyl]-1,3-oxathiolan-5-yl]-2(1H)-pyrimidinone; 2(1H)-Pyrimidinone, 4-amino-5-fluoro-1-[(2R,5S)-2-[[[[5-fluoro-1,2-dihydro-1-[(2R,5S)-2-(hydroxymethyl)-1,3-oxathiolan-5-yl]-2-oxo-4-pyrimidinyl]amino]methoxy]methyl]-1,3-oxathiolan-5-yl]-; Emtricitabine FT3. Grade: ≥95%. CAS No. 1962114-96-0. Molecular formula: C17H20F2N6O6S2. Mole weight: 506.50.
AT 1001
AT 1001 is a partial agonist and antagonist of α3β4 nAChR ligand (Ki value 2.6?nM at α3β4 nAChR). In vivo AT-1001 potently blocks nicotine self-administration in dose manner. Synonyms: AT 1001; AT1001; AT-1001. Grade: 99%. CAS No. 1314801-63-2. Molecular formula: C15H21BrN2. Mole weight: 309.24.
AT101
AT101, the R-(-) enantiomer of Gossypol acetic acid, binds with Bcl-2, Bcl-xL and Mcl-1 with Ki of 0.32 μM, 0.48 μM and 0.18 μM. Synonyms: AT-101; AT 101; AT101. Grade: >98%. CAS No. 90141-22-3. Molecular formula: C30H30O8·C2H4O2. Mole weight: 578.6.
AT 1015
AT 1015 has been found to be a 5-HT2A receptor antagonist and exhibit antithrombotic activities. Synonyms: AT-1015 anhydrous, AT 1015; AT1015; AT-1015 HCl anhydrous, AT-1015 hydrochloride anhydrous; N-[2-[4-(5H-Dibenzo[a,d]cyclohepten-5-ylidene)-1-piperidinyl]ethyl]-1-formyl-4-piperidinecarboxamide hydrochloride. Grade: ≥97% by HPLC. CAS No. 190508-50-0. Molecular formula: C29H33N3O2.HCl. Mole weight: 492.05.
AT-101 acetic acid
AT101 acetic acid is orally bioavailable solvate of R-(-)-enantiomer of gossypol with potential antineoplastic activity. It is used as the treatment of non Hodgkin's lymphoma, prostate cancer, and non small cell cancer. It binds with Bcl-2, Bcl-xL and Mcl-1 with Ki of 0.32 μM, 0.48 μM and 0.18 μM. It induces apoptosis in vitro through activation of caspase-9. It delays onset of androgen-independent growth of VCaP prostate cancer xenografts in vivo. It was developed by Ascenta and in clinical phase 2. Uses: At101 acetic acid is used as the treatment of non hodgkin's lymphoma, prostate cancer, and non small cell cancer. Synonyms: AT-101 acetic acid; AT 101 acetic acid; AT101 acetic acid; (R)-(-)-Gossypol acetic acid; (-)-Gossypol acetic acid; (R)-Gossypol acetic acid; Acetic acid 7-(8-formyl-1,6,7-trihydroxy-3-methyl-5-propan-2-ylnaphthalen-2-yl)-2,3,8-trihydroxy-6-methyl-4-propan-2-ylnaphthalene-1-carbaldehyde. Grade: >98 %. CAS No. 866541-93-7. Molecular formula: C32H34O10. Mole weight: 578.61.
AT-121
T-121 is a dual μ-opioid and nociceptin receptor partial agonist (Kis = 16.49 and 3.67 nM, respectively). AT-121 can decrease capsaicin-induced thermal allodynia without increasing scratching activity in rhesus monkeys in a dose-dependent manner. Synonyms: AT-121; 2099681-31-7; N-[2-[1,2-dihydro-1'-[cis-4-(1-methylethyl)cyclohexyl]-3-oxospiro[isoquinoline-4(3H),4'-piperidin]-2-yl]ethyl]-sulfamide; 3-oxo-1'-(4-propan-2-ylcyclohexyl)-2-[2-(sulfamoylamino)ethyl]spiro[1H-isoquinoline-4,4'-piperidine]; SCHEMBL18920959; SCHEMBL20230173; SCHEMBL21179793; DTXSID801336428; GLXC-25688; EX-A8003; AKOS040755934; HY-112692; CS-0062666; Q56448036; N-{2-[1'-(cis-4-Isopropylcyclohexyl)-3-oxo-1H-spiro[isoquinoline-4,4'-piperidin]-2(3H)-yl]ethyl}sulfuric diamide. Grade: ≥95%. CAS No. 2099681-31-7. Molecular formula: C24H38N4O3S. Mole weight: 462.65.
AT-121 hydrochloride
AT-121 hydrochloride is a safe and non-addictive analgesic with antinociceptive and antiallodynic effects. AT-121 hydrochloride is a bifunctional nociception and mu opioid receptor agonist, with Kis of 3.67 and 16.49 nM, respectively. Synonyms: AT121 hydrochloride; AT 121 hydrochloride. CAS No. 2099681-71-5. Molecular formula: C24H39ClN4O3S. Mole weight: 499.11.
AT13148
AT13148 is an orally available multi-AGC kinase inhibitor with potent pharmacodynamic and antitumor activity. It can block phosphorylation of AKT, p70S6K, PKA, ROCK and SGK substrates, and induce apoptosis in cancer cells. Synonyms: AT-13148; (1S)-2-amino-1-(4-chlorophenyl)-1-[4-(1H-pyrazol-4-yl)phenyl]ethanol. Grade: >98%. CAS No. 1056901-62-2. Molecular formula: C17H16ClN3O. Mole weight: 313.78.
AT 13148 dihydrochloride
AT13148 is an orally available multi-AGC kinase inhibitor with potent pharmacodynamic and antitumor activity. It can block phosphorylation of AKT, p70S6K, PKA, ROCK and SGK substrates, and induce apoptosis in cancer cells. Synonyms: (S)-1-(4-(1H-pyrazol-4-yl)phenyl)-2-amino-1-(4-chlorophenyl)ethanol dihydrochloride. Grade: 98%. Molecular formula: C17H16ClN3O.2HCl. Mole weight: 386.70.
AT-1459
AT-1459 is a novel, direct thrombin inhibitor with antithrombotic efficacy (Ki = 4.9 nM). Uses: Thrombin inhibitor. Synonyms: AT-1459; AT 1459; AT1459; UNII-JWP323ABVS; Butanoic acid, 4-[[(3S)?-1-[2-[(2S)?-2-[2-[6-(aminoiminomethyl)?-1-ethyl-1H-indol-2-yl]?ethyl]?-1-pyrrolidinyl]?-2-oxoethyl]?hexahydro-2-oxo-1H-azepin-3-yl]?amino]?-. Grade: ≥95%. CAS No. 294658-50-7. Molecular formula: C29H42N6O4. Mole weight: 538.32.
AT 1902
AT 1902 is a bio-active compound, but no detailed information has been published yet. Synonyms: AT 1902; AT-1902; AT1902; BRN 1714871; Nitriloacetic acid trihydride; NSC 351359; Nitrazine; Nitrazine; N,N-Bis(2-hydrazino-2-oxoethyl)glycine hydrazide; Glycine, N,N-bis(2-hydrazino-2-oxoethyl)-, hydrazide (9CI). Grade: 98%. CAS No. 80155-82-4. Molecular formula: C6H15N7O3. Mole weight: 233.23.
AT-308
AT-308 is a synthetic bio-active chemical. Uses: A synthetic bio-active chemical. Synonyms: AT-308; AT 308; AT308; AC1L4RQW; AC1Q642X; Ethyl 2-methyl-2-{4-[5-(pyridin-3-yl)-1,2,4-oxadiazol-3-yl]phenoxy}propanoate. Grade: ≥98%. CAS No. 40915-84-2. Molecular formula: C19H19N3O4. Mole weight: 353.38.
AT-406
AT-406 is a potent Smac mimetic and an antagonist of IAP (inhibitor of apoptosis protein via E3 ubiquitin ligase), binding to XIAP-BIR3 (with Ki of 66.4 nM), cIAP1-BIR3(with Ki of 1.9 nM) and cIAP2-BIR3 (with Ki of 5.1 nM), respectively. Synonyms: AT406; AT 406; SM-406; SM 406; SM406; ARRY-334543; ARRY 334543; ARRY334543. Grade: >98%. CAS No. 1071992-99-8. Molecular formula: C32H43N5O4. Mole weight: 561.71.
AT-406 hydrochloride
AT-406 hydrochloride, a potent and orally bioavailable smac mimetic and an antagonist of apoptosis proteins (IAPs) inhibitor, binds to XIAP, cIAP1 and cIAP2 proteins with Kis of 66.4, 1.9 and 5.1 nM, respectively. It can effectively antagonize XIAP BIR3 protein in a cell-free functional assay, induce rapid degradation of cellular cIAP1 protein, and inhibit the growth of various human cancer cell lines. It can effectively induce the apoptosis in xenograft tumors. Synonyms: Xevinapant hydrochloride; Debio 1143 hydrochloride; SM-406 hydrochloride; (5S,8S,10aR)-N-benzhydryl-5-((S)-2-(methylamino)propanamido)-3-(3-methylbutanoyl)-6-oxodecahydropyrrolo[1,2-a][1,5]diazocine-8-carboxamide hydrochloride; (5S,8S,10aR)-N-(Diphenylmethyl)-5-[(N-methyl-L-alanyl)amino]-3-(3-methylbutanoyl)-6-oxodecahydropyrrolo[1,2-a][1,5]diazocine-8-carboxamide hydrochloride (1:1). Grade: ≥98%. CAS No. 1071992-57-8. Molecular formula: C32H44ClN5O4. Mole weight: 598.18.
AT 4930
AT-4930 is a bio-active molecular, but detailed information has not been published yet. Synonyms: AT 4930; AT4930; AT-4930; 5-amino-1-cyclopropyl-7-(3,5-dimethyl-1-piperazinyl)-6-fluoro-1,4-dihydro-4-oxo-3-Quinolinecarboxylic acid. Grade: 98%. CAS No. 123016-40-0. Molecular formula: C19H23FN4O. Mole weight: 374.41.
AT-56
Orally active inhibitor of lipocalin-type prostaglandin D synthase (L-PGDS) (Ki = 75 muM, IC50 = 95 muM). Inhibits the production of PGD2 from PGH2 in vitro, with no effect on PGE2 or PGF2alpha production. Synonyms: AT 56; AT56; 4-(5H-Dibenzo[a,d]cyclohepten-5-ylidene)-1-[4-(2H-tetrazol-5-yl)butyl]-piperidine. Grade: ≥98%. CAS No. 162640-98-4. Molecular formula: C25H27N5. Mole weight: 397.53.
AT-584
AT-584, an azoniatricyclo compound, could have potential biological activity in pharmaceutical studies. Synonyms: AT 584; AT-584; AT584; Hexamethylenetetramine salt of p-(bis(2-chloroethyl)amino)-alpha-bromoacetophenone; 1-(p-(Bis(2-chloroethyl)amino)phenacyl)-3,5,7-triaza-1-azoniaadamantane bromide; 1-(2-(4-(Bis(2-chloroethyl)amino)phenyl)-2-oxoethyl)-3,5,7-triaza-1-azonia. Grade: 98%. CAS No. 16810-17-6. Molecular formula: C18H26BrCl2N5O. Mole weight: 479.24.
AT-61
AT-61 is a nonnucleoside analogue inhibitors of hepatitis B virus (HBV) replication. Uses: Inhibitors of hepatitis b virus (hbv) replication. Synonyms: AT 61; AT-61; AT61; N-(1-(Bromophenylmethylene)-2-oxo-2-piperidylethyl)benzamide; Benzamide, N-(2-chloro-2-phenyl-1-(1-piperidinylcarbonyl)ethenyl)-; N-[1-(Bromophenylmethylene)-2-oxo-2-piperidylethyl]benzamide. Grade: ≥98%. CAS No. 300669-68-5. Molecular formula: C21H21ClN2O2. Mole weight: 368.86.
AT-7519
AT-7519 is an orally bioavailable small molecule CDK inhibitor with potential antineoplastic activity. AT7519M selectively binds to and inhibits cyclin dependent kinases (CDKs), which may result in cell cycle arrest, induction of apoptosis, and inhibition of tumor cell proliferation. Synonyms: AT-7519, AT7519, AT 7519, AT-7519 free base. Grade: 0.98. CAS No. 844442-38-2. Molecular formula: C16H17Cl2N5O2. Mole weight: 382.24.
AT7519 HCl
AT-7519 is an orally bioavailable small molecule CDK inhibitor with potential antineoplastic activity. AT7519M selectively binds to and inhibits cyclin dependent kinases (CDKs), which may result in cell cycle arrest, induction of apoptosis, and inhibition of tumor cell proliferation. Synonyms: AT7519 HCl; AT 7519 HCl; AT-7519 HCl. CAS No. 902135-91-5. Molecular formula: C16H18Cl3N5O2. Mole weight: 418.71.
AT 7519 mesylate
AT 7519 mesylate is a small-molecule inhibitor of CDK including CDK 1, 2, 4, 5, 6, and 9 in vitro and it induces apoptosis in multiple myeloma via GSK-3β activation and RNA polymerase II inhibition. Synonyms: AT 7519 mesylate; AT7519 mesylate; AT-7519 mesylate; AT-7519M; AT 7519M, AT7519M; 4-[(2,6-dichlorobenzoyl)amino]-N-piperidin-4-yl-1H-pyrazole-5-carboxamide methanesulfonic acid. Grade: 99%. CAS No. 902135-89-1. Molecular formula: C16H17Cl2N5O2.CH4O3S. Mole weight: 478.35.
AT7519 trifluoroacetate
AT7519 is an ATP competitive CDK inhibitor with a Ki value of 38 nM for CDK1. AT7519 is inactive against all non-CDK kinases with the exception of GSK3β (IC50 = 89 nM). AT7519 shows potent antiproliferative activity in a variety of human tumor cell lines with IC50 values ranging from 40 nM for MCF-7 to 940 nM for SW620 consistent with the inhibition of CDK1 and CDK2. AT7519 induces dose-dependent cytotoxicity in multiple myeloma (MM) cell lines with IC50 values ranging from 0.5 to 2 μM at 48 hours, with the most sensitive cell lines being MM.1S (0.5 μM) and U266 (0.5 μM) and the most resistant MM.1R (>2 μM). It does not induce cytotoxicity in peripheral blood mononuclear cells (PBMNC). AT7519 partially overcomes the proliferative advantage conferred by IL6 and IGF-1 as well as the protective effect of bone marrow stromal cells (BMSCs). AT7519 induces rapid dephosphorylation of RNA pol II CTD at serine 2 and serine 5 sites, and leads to the inhibition of transcription, partially contributing to AT7519 induced cytotoxicity of MM cells. AT7519 induces activation of GSK-3β by down-regulating GSK-3β phosphorylation, which also contributes to AT7519 induced apoptosis independent of the inhibition of transcription. A twice daily dosing of AT7519 (9.1 mg/kg) causes tumor regression of both early-stage and advanced-stage s.c. tumors in the HCT116 and HT29 colon cancer xenograft models. AT7519 tre
AT7867
AT7867 is a potent ATP-competitive inhibitor of Akt1/2/3 and p70S6K/PKA with IC50 of 32 nM/17 nM/47 nM and 85 nM/20 nM, respectively; little activity outside the AGC kinase family. Synonyms: AMG-706; AMG 706; AMG706; AT7867; AT 7867; AT-7867. Grade: >98%. CAS No. 857531-00-1. Molecular formula: C20H20ClN3. Mole weight: 337.85.