A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| Calcipotriol Impurity G |  | |
| Calcipotriol Impurity H | | |
| Calcipotriol Impurity I | | |
| Calcipotriol Intermediate 9 | Calcipotriol Intermediate 9 is an intermediate of calcipotriol synthesis. Calcipotriol is a vitamin D3 analogue used for psoriasis treatment. Synonyms: (2E, 4R) -4- [ (1R, 3aS, 4E, 7aR) -4- [ (2E) -2- [ (3S, 5R) -3, 5-Bis [ [ (tert-butyl) dimethylsilyl] oxy] -2-methylenecyclohexylidene] ethylidene] octahydro-7a-methyl-1H-inden-1-yl] -1-cyclopropyl-2-penten-1-one; (5E)-1,3-Bis-O-(tert-Butyldimethylsilyl)-24-oxo-calcipotriene. CAS No. 112849-17-9. Molecular formula: C39H66O3Si2. Mole weight: 639.124. | |
| Calcipotriol monohydrate | Calcipotriol monohydrate is a synthetic VitD3 analogue with a high affinity for the vitamin D receptor. Uses: Scientific research. Group: Signaling pathways. CAS No. 147657-22-5. Pack Sizes: 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-10001A. |  |
| Calcite | Calcium carbonate appears as white, odorless powder or colorless crystals. Practically insoluble in water. Occurs extensive in rocks world-wide. Ground calcium carbonate (CAS: 1317-65-3) results directly from the mining of limestone. The extraction process keeps the carbonate very close to its original state of purity and delivers a finely ground product either in dry or slurry form. Precipitated calcium carbonate (CAS: 471-34-1) is produced industrially by the decomposition of limestone to calcium oxide followed by subsequent recarbonization or as a by-product of the Solvay process (which is used to make sodium carbonate). Precipitated calcium carbonate is purer than ground calcium carbonate and has different (and tailorable) handling properties.;Limestone is an odorless, white to tan powder.;Limestone (calcium carbonate) that has been recrystallized by metamorphism and is capable of taking a polish. Practically insoluble in water.;DryPowder; DryPowder, Liquid; DryPowder, OtherSolid; Liquid; OtherSolid; PelletsLargeCrystals; WetSolid; WetSolid, Liquid; WetSolid, OtherSolid;DryPowder; DryPowder, Liquid; DryPowder, OtherSolid; DryPowder, PelletsLargeCrystals; DryPowder, PelletsLargeCrystals, Liquid; DryPowder, WetSolid; Liquid; OtherSolid; OtherSolid, Liquid; PelletsLargeCrystals; WetSolid; WetSolid, Liquid; WetSolid, OtherSolid;White crystalline or amorphous, odourless and tasteless powder;WHITE POWDER OR PELLETS.;White, odorlessÂ… |  |
| Calcite (CaCO3) Crystal | Calcite (CaCO3) Crystal. Group: Alloys nanopowders. Alternative Names: Calcite Crystal, CaCO3 Crystal, CaCO3 Wafers, CaCO3 Substrate, CaCO3 Slice. | |
| Calcitermin | Calcitermin is isolated from Homo sapiens. Calcitermin possesses antifungal activity against C.albicans and is also active against E.coli and P.aeruginosa but not L.monocytogenes and S.aureus. | |
| Calcitetrol | Calcitetrol is the hormonally active form of vitamin D with three hydroxyl groups. It increases blood calcium levels ([Ca2+]) by promoting absorption of dietary calcium from the gastrointestinal tract and increasing renal tubular reabsorption of calcium, thus reducing the loss of calcium in the urine. It also stimulates release of calcium from bone by its action on the specific type of bone cells referred to as osteoblasts, causing them to release RANKL, which in turn activates osteoclasts. Synonyms: 1α, 24, 25-Trihydroxy VD3. Grades: >98%. CAS No. 72203-93-1. Molecular formula: C27H44O4. Mole weight: 432.64. | |
| Calcitonin (8-32), salmon | Calcitonin (8-32), salmon is an amylin receptor antagonist with highly selectivity. Synonyms: H-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2; L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-asparagyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolinamide; 8-32-Calcitonin (salmon reduced); Calcitonin (salmon reduced), 1-de-L-cysteine-2-de-L-serine-3-de-L-asparagine-4-de-L-leucine-5-de-L-serine-6-de-L-threonine-7-de-L-cysteine-; Salmon calcitonin (8-32). Grades: ≥95%. CAS No. 155069-90-2. Molecular formula: C119H198N36O37. Mole weight: 2725.06. | |
| Calcitonin(chicken)(9ci) | Heterocyclic Organic Compound. Alternative Names: CALCITONIN, CHICKEN;H-CYS-ALA-SER-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASP-VAL-GLY-ALA-GLY-THR-PRO-NH2;H-CYS-ALA-SER-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-TH. CAS No. 100016-62-4. Molecular formula: C145H240N42O46S2. Mole weight: 3371.84. Purity: 0.96. IUPACName: CALCITONIN, CHICKEN. Canonical SMILES: CC1C (=O)NC (C (=O)NC (C (=O)NC (C (=O)NC (C (=O)NC (CSSCC (C (=O)N1)N)C (=O)NC (C (C)C)C (=O)NC (CC (C)C)C (=O)NCC (=O)NC (CCCCN)C (=O)NC (CC (C)C)C (=O)NC (CO)C (=O)NC (CCC (=O)N)C (=O)NC (CCC (=O)O)C (=O)NC (CC (C)C)C (=O)NC (CC2=CNC=N2)C (=O)NC (CCCCN)C (=O)NC (CC (C)C)C (=O)NC (CCC (=O)N)C (=O)NC (C (C)O)C (=O)NC (CC3=CC=C (C=C3)O)C (=O)N4CCCC4C (=O)NC (CCCNC (=N)N)C (=O)NC (C (C)O)C (=O)NC (CC (=O)O)C (=O)NC (C (C)C)C (=O)NCC (=O)NC (C)C (=O)NCC (=O)NC (C (C)O)C (=O)N5CCCC5C (=O)N)C (C)O)CO)CC (C)C)CO. Catalog: ACM100016624. |  |
| Calcitonin eel | Calcitonin eel is a peptide hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Synonyms: Eel calcitonin; Calcitonin (eel); Calcitonin, Eel; Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2 [Disulfide bridge: 1-7], Thyrocalcitonin Eel. Grades: 98%. CAS No. 57014-02-5. Molecular formula: C146H241N43O47S2. Mole weight: 3414.86. | |
| Calcitonin gene-related peptide | Calcitonin gene-related peptide is a member of the calcitonin family of peptides consisting of calcitonin, amylin, adrenomedullin, adrenomedullin 2 (intermedin) and calcitonin - receptor - stimulating peptide. Synonyms: Calcitonin, pro-; CALCA protein, human; CALC1 protein, human; CGRP1 protein, human. CAS No. 83652-28-2. Molecular formula: C163H266N50O50S2. Mole weight: 3790.28. | |
| Calcitonin gene-related peptide free acid | Calcitonin gene-related peptide (CGRP) free acid is the deamidated form of α-CGRP(human) (HY-P1071). Calcitonin gene-related peptide can be used to study the effect of C-terminal amidation on CGRP [1] [2]. Uses: Scientific research. Group: Peptides. Alternative Names: CGRP free acid. CAS No. 83652-28-2. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P4058. | |
| Calcitonin human | Calcitonin is a peptide hormone that lowers blood calcium levels and inhibits bone resorption. The binding of human calcitonin to the calcitonin receptor (CTR) is modulated by receptor activity-modifying proteins (RAMPs). Calcitonin binds to CTR2 with IC50 values of 8.5, 6.2, 10.7, and 5.8 nM alone and with RAMP1, 2, or 3, respectively. It induces cAMP accumulation in rabbit aortic endothelial cells (RAECs) expressing CTR2 alone, or co-transfected with RAMP1, 2, or 3 (EC50s = 0.07, 0.08, 0.05, and 0.99 nM, respectively). Synonyms: Ba 47175; Calcitonin (1-32) (human); hCT; Thyrocalcitonin (human). Grades: ≥95%. CAS No. 21215-62-3. Molecular formula: C151H226N40O45S3. Mole weight: 3417.84. | |
| Calcitonin (human) | Calcitonin (human) is a hypocalcemic hormone. Calcitonin can lower blood calcium levels and inhibit bone resorption. Calcitonin can be used in hypercalcemia or osteoporosis research [1] [2] [3]. Uses: Scientific research. Group: Peptides. CAS No. 21215-62-3. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P2273. | |
| Calcitonin N-terminal flanking peptide(human) | Heterocyclic Organic Compound. Alternative Names: N-PROCALCITONIN (HUMAN);N-PROCT AMINO-TERMINAL PROCALCITONIN; APFRSALESSPADPATLSEDE ARLLLAALVQDYVQMKASELEQEQEREGSSLDSPRS ; CALCITONIN N-TERMINAL FLANKING PEPTIDE (HUMAN);CLEAVAGE PEPTIDE, HUMAN;H-ALA-PRO-PHE-ARG-SER-ALA-LEU-GLU-SER-SER-PRO-ALA-ASP-PRO-ALA-TH. CAS No. 118277-01-3. Molecular formula: C264H426N74O97S. Catalog: ACM118277013. | |
| Calcitonin Paralle Dimer | Calcitonin Paralle Dimer is an impurity of Calcitonin salmon, which is a calcium regulating hormone used to be an effective alternative for the treatment of postmenopausal osteoporosis. Synonyms: 2[H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2] (inter-disulfide bridges between 1,1' and 7,7' cysteines). Molecular formula: C290H480N88O96S4. Mole weight: 6863.79. | |
| Calcitonin (rat) | Calcitonin, a peptide hormone involved in calcium and bone metabolism, is effective in treating hypercalcemia caused by bone metastasis, multiple myeloma and osteitis malformation, and is also effective against osteoporosis. Synonyms: H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Leu-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ser-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bridge: Cys1-Cys7); L-cysteinyl-glycyl-L-asparagyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-methionyl-L-leucyl-glycyl-L-threonyl-L-tyrosyl-L-threonyl-L-glutaminyl-L-alpha-aspartyl-L-leucyl-L-asparagyl-L-lysyl-L-phenylalanyl-L-histidyl-L-threonyl-L-phenylalanyl-L-prolyl-L-glutaminyl-L-threonyl-L-seryl-L-isoleucyl-glycyl-L-valyl-glycyl-L-alanyl-L-prolinamide (1->7)-disulfide. Grades: ≥95%. CAS No. 11118-25-5. Molecular formula: C148H228N40O46S3. Mole weight: 3399.83. | |
| Calcitonin (rat) | Calcitonin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development [1]. Uses: Scientific research. Group: Peptides. CAS No. 11118-25-5. Pack Sizes: 5 mg; 10 mg; 25 mg. Product ID: HY-P4973. | |
| Calcitonin(rat)(9ci) | Heterocyclic Organic Compound. Alternative Names: H-CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR-GLN-ASP-LEU-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-SER-ILE-GLY-VAL-GLY-ALA-PRO-NH2;H-CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR-GLN-ASP-LEU-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-SER-ILE-GLY-VAL-GL. CAS No. 11118-25-5. Molecular formula: C148H228N40O46S3. Mole weight: 3399.83. Catalog: ACM11118255. | |
| Calcitonin salmon | Calcitonin salmon, a calcium regulating hormone, has been shown to be an effective alternative for the treatment of postmenopausal osteoporosis. Synonyms: Salmon calcitonin; H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7); L-cysteinyl-L-seryl-L-asparagyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-asparagyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolinamide (1->7)-disulfide; Calciben; Calcimar; Calcitonin (salmon reduced), cyclic (1?7)-disulfide; Calsyn; Calsynar; Catonin; Karil; Miacalcic; Miacalcin; Miadenil; Prontocalcin; Rulicalcin; Salcatonin; Salmon calcitonin; Salmon calcitonin I; Salmon calcitonin-(1-32); Salmon Thyrocalcitonin; Salmotonin; SMC 021 A/C; Stalcin; Tonocalcin. Grades: 98%. CAS No. 47931-85-1. Molecular formula: C145H240N44O48S2. Mole weight: 3431.85. | |
| Calcitonin (salmon) | Calcitonin (salmon). Group: Biochemicals. Alternative Names: 1,2-Dithia-5,8,11,14,17,20-hexaazacyclotricosane Cyclic Peptide Deriv.; 1: PN: US20130183385 SEQID: 1 Claimed Protein; 1: PN: WO2013067357 SEQID: 1 Claimed Protein; Calciben; Calcimar; Calcitonin (salmon reduced) Cyclic (1?7)-Disulfide; Calcitonin (Salmon reduced) Cyclic (1?7)-Disulfide; Calsyn; Calsynar; Catonin; Karil; L-Prolinamide, L-Cysteinyl-L-Seryl-L-Asparaginyl-L-Leucyl-L-Seryl-L-Threonyl-L-Cysteinyl-L-Valyl-L-Leucylglycyl-L-Lysyl-L-Leucyl-L-Seryl-L-Glutaminyl-L-α-Glutamyl-L-Lucyl-L-Histidyl-L-Lysyl-L-Leucyl-L-Glutaminyl-L-Threonyl-L-Tyrosyl-L-Prolyl-L-Arginyl-L-Threonyl-L-Asparaginyl-L-Threonylglycyl-L-Serylglycyl-L-Threonyl Cyclic (1?7)-disulfide; Miacalcic; Miacalcin; Miadenil; Prontocalcin; Rulicalcin; SMC 021 A/C; Salcatonin; Salmon Thyrocalcitonin; Salmon calcitonin; Salmon calcitonin I; Salmon calcitonin-(1-32); Salmotonin; Stalcin; Tonocalcin. Grades: Highly Purified. CAS No. 47931-85-1. Pack Sizes: 10mg. Molecular Formula: C145H240N44O48S2, Molecular Weight: 3429.5. US Biological Life Sciences. |  Worldwide |
| Calcitonin (salmon) | Calcitonin salmon, a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption. Uses: Scientific research. Group: Peptides. Alternative Names: Salmon calcitonin. CAS No. 47931-85-1. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg. Product ID: HY-P0090. | |
| Calcitonin Salmon-[d10] | Calcitonin Salmon-[d10] is the labelled analogue of Calcitonin Salmon, which is a calcium regulating hormone used to be an effective alternative for the treatment of postmenopausal osteoporosis. Synonyms: H-Cys-Ser-Asn-Leu(D10)-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bond between Cys1 and Cys7); Calcitonin Salmon D10 Impurity. Molecular formula: C145H230D10N44O48S2. Mole weight: 3441.96. | |
| Calcitonin (salmon) trifluoroacetate salt | Calcitonin is a peptide hormone that lowers blood calcium levels and inhibits bone resorption. The binding of salmon calcitonin to the human calcitonin receptor (CTR) is not modulated by receptor activity-modifying proteins (RAMPs), which influences affinity of human calcitonin to CTR. Salmon calcitonin binds to human CTR2 with IC50 values of 0.933, 0.224, 0.134, and 0.317 nM alone and with RAMP1, 2, or 3, respectively. Formulations containing salmon calcitonin have been used to treat hypercalcemia, bone destruction by osteoporosis, and Paget's disease. Synonyms: H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2.TFA (Disulfide bond between Cys1 and Cys7); L-cysteinyl-L-seryl-L-asparagyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-asparagyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolinamide (1->7)-disulfide trifluoroacetate salt; Salmon Calcitonin trifluoroacetate (salt). Grades: ≥95%. CAS No. 171052-37-2. Molecular formula: C145H240N44O48S2.xC2HF3O2. Mole weight: 3431.86 (free base). | |
| Calcitonin(swine) | Calcitonin(swine). CAS No. 12321-44-7. Molecular formula: C159H232N46O45S3. Mole weight: 3604.1. Purity: 0.98. Catalog: ACM12321447. | |
| Calcitoninyl glycine | Calcitoninyl glycine is an impurity of Calcitonin salmon, which is a calcium regulating hormone used to be an effective alternative for the treatment of postmenopausal osteoporosis. Synonyms: H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-Gly-OH (Disulfide bond between Cys1 and Cys7); L-cysteinyl-L-seryl-L-asparagyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-asparagyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolylglycine (1->7)-disulfide; Calcitonin (salmon), 32a-glycine-; 32a-Glycine-Calcitonin (salmon). CAS No. 115472-96-3. Molecular formula: C147H242N44O50S2. Mole weight: 3489.93. | |
| Calcitriol | Calcitriol is the most active metabolite of vitamin D and also a vitamin D receptor ( VDR ) agonist. Uses: Scientific research. Group: Natural products. Alternative Names: 1,25-Dihydroxyvitamin D3. CAS No. 32222-06-3. Pack Sizes: 1 mg; 2 mg; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-10002. | |
| Calcitriol | Calcitriol is the hormonally active form of vitamin D. Synonyms: RO215535, Topitriol. Grades: >98%. CAS No. 32222-06-3. Molecular formula: C27H44O3. Mole weight: 416.64. | |
| Calcitriol | Calcitriol Inhibitor. Uses: Scientific use. Product Category: T6316. CAS No. 32222-06-3. |  |
| Calcitriol | 5mg Pack Size. Group: Bioactive Small Molecules, Biochemicals, Research Organics & Inorganics. Formula: C27H44O3. CAS No. 32222-06-3. Prepack ID 76159527-5mg. Molecular Weight 416.64. See USA prepack pricing. |  |
| Calcitriol-d6 | The biologically active form of vitamin D3. Calcium regulator; vitamin (antirachitic); antihyperparathyroid; antineoplastic; antipsoriatic. Group: Biochemicals. Alternative Names: (1R,3S,5Z)-4-Methylene-5-[(2E)-2-[(1R,3aS,7aS)-octahydro-1-[(1R)-5-hydroxy-1,5-dimethylhexyl]-7a-methyl-4H-inden-4-ylidene]ethylidene]-1,3-cyclohexanediol-d6; (1α,3 β,5Z,7E)- 9,10-Secocholesta-5,7,10(19)-triene-1,3,25-triol-d6; 1 α , 25-Di hydroxycholecalciferol-d6; 1α,25-Dihydroxyvitamin D3-d6; Calcijex-d6; Dihydroxyvitamin D3-d6; Panbonis-d6; Ro 21-5535-d6; Rocaltrol-d6; Silkis-d6; Solbone P-d6; Soltriol-d6; Topitriol-d6; Toptriol. Grades: Highly Purified. CAS No. 78782-99-7. Pack Sizes: 500ug. US Biological Life Sciences. | Worldwide |
| Calcitriol-dehydroxytri methyl silyl-3, 5-O-tert-butyldi methyl silyl-d6 | Calcitriol-dehydroxytri methyl silyl-3, 5-O-tert-butyldi methyl silyl-d6 is an intermediate used in the synthesis of Calcitriol-d6 (C144502), which is the biologically active form of vitamin D3. Calcium regulator; vitamin (antirachitic); antihyperparathyroid; antineoplastic; antipsoriatic. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 500ug, 1mg. Molecular Formula: C42H74D6O3Si3, Molecular Weight: 723.38. US Biological Life Sciences. | Worldwide |
| Calcitriol EP Impurity A | Calcitriol EP Impurity A. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: 5,6-trans Calcitriol; (1R,3S,E)-5-((E)-2-((1R,3aS,7aR)-1-((R)-6-hydroxy-6-methylheptan-2-yl)-7a-methylhexahydro-1H-inden-4(2H)-ylidene)ethylidene)-4-methylenecyclohexane-1,3-diol. CAS No. 73837-24-8. Molecular Formula: C27H44O3. Mole Weight: 416.64. Catalog: APB73837248. |  |
| Calcitriol EP Impurity B | Calcitriol EP Impurity B. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: epi-Calcitriol; (1R,3R,Z)-5-((E)-2-((1R,3aS,7aR)-1-((R)-6-hydroxy-6-methylheptan-2-yl)-7a-methylhexahydro-1H-inden-4(2H)-ylidene)ethylidene)-4-methylenecyclohexane-1,3-diol. CAS No. 66791-71-7. Molecular Formula: C27H44O3. Mole Weight: 416.64. Catalog: APB66791717. | |
| Calcitriol EP Impurity C | Calcitriol EP Impurity C. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: (6aR, 7R, 9aR)-11-((3S, 5R)-3, 5-dihydroxy-2-methylcyclohex-1-en-1-yl)-7-((R)-6-hydroxy-6-methylheptan-2-yl)-6a-methyl-2-phenyl-4a, 5, 6, 6a, 7, 8, 9, 9a-octahydrocyclopenta[f][1, 2, 4]triazolo[1, 2-a]cinnoline-1, 3(2H, 11H)-dione. CAS No. 86307-44-0. Molecular Formula: C35H49N3O5. Mole Weight: 591.78. Catalog: APB86307440. | |
| Calcitriol EP Impurity D | Calcitriol EP Impurity D. Uses: For analytical and research use. Group: Impurity standards. CAS No. 103656-40-2. Molecular Formula: C28H46O3. Mole Weight: 430.66. Catalog: APB103656402. | |
| Calcitriol Impurity 1 | Calcitriol Impurity 1. Uses: For analytical and research use. Group: Impurity standards. CAS No. 96862-25-8. Molecular Formula: C27H44O3. Mole Weight: 416.65. Catalog: APB96862258. | |
| Calcitriol Impurity 1 | Calcitriol Impurity 1 is a derivative of vitamin D3 and an impurity of calcitriol. Calcitriol is a metabolite of vitamin D, and it increases the level of calcium in the blood. Molecular formula: C27H44O3. Mole weight: 416.645. | |
| Calcitriol Impurity 10 | Calcitriol Impurity 10. Uses: For analytical and research use. Group: Impurity standards. CAS No. 139131-74-1. Molecular Formula: C24H46O2Si. Mole Weight: 394.71. Catalog: APB139131741. | |
| Calcitriol Impurity 11 | Calcitriol Impurity 11. Uses: For analytical and research use. Group: Impurity standards. CAS No. 307953-25-9. Molecular Formula: C24H48O2Si. Mole Weight: 396.73. Catalog: APB307953259. | |
| Calcitriol Impurity 12 | Calcitriol Impurity 12. Uses: For analytical and research use. Group: Impurity standards. CAS No. 66774-84-3. Molecular Formula: C18H34O2. Mole Weight: 282.47. Catalog: APB66774843. | |
| Calcitriol Impurity 13 | Calcitriol Impurity 13. Uses: For analytical and research use. Group: Impurity standards. CAS No. 147351-85-7. Molecular Formula: C18H32O. Mole Weight: 264.45. Catalog: APB147351857. | |
| Calcitriol Impurity 14 | Calcitriol Impurity 14. Uses: For analytical and research use. Group: Impurity standards. CAS No. 171011-48-6. Molecular Formula: C19H38O2Si. Mole Weight: 326.6. Catalog: APB171011486. | |
| Calcitriol Impurity 15 | Calcitriol Impurity 15. Uses: For analytical and research use. Group: Impurity standards. CAS No. 214351-86-7. Molecular Formula: C19H37IOSi. Mole Weight: 436.49. Catalog: APB214351867. | |
| Calcitriol Impurity 16 | Calcitriol Impurity 16. Uses: For analytical and research use. Group: Impurity standards. CAS No. 214351-92-5. Molecular Formula: C18H34O2. Mole Weight: 282.47. Catalog: APB214351925. | |
| Calcitriol Impurity 17 | Calcitriol Impurity 17. Uses: For analytical and research use. Group: Impurity standards. Molecular Formula: C30H63IO5Si3. Mole Weight: 714.99. Catalog: APB07207. | |
| Calcitriol Impurity 18 | Calcitriol Impurity 18. Uses: For analytical and research use. Group: Impurity standards. Molecular Formula: C30H63IO5Si3. Mole Weight: 714.99. Catalog: APB07208. | |
| Calcitriol Impurity 19 | Calcitriol Impurity 19. Uses: For analytical and research use. Group: Impurity standards. Molecular Formula: C30H62O5Si3. Mole Weight: 587.08. Catalog: APB07209. | |
| Calcitriol Impurity 2 | Calcitriol Impurity 2. Uses: For analytical and research use. Group: Impurity standards. CAS No. 169900-32-7. Molecular Formula: C39H70O4Si2. Mole Weight: 659.15. Catalog: APB169900327. | |
| Calcitriol Impurity 20 | Calcitriol Impurity 20. Uses: For analytical and research use. Group: Impurity standards. CAS No. 342644-91-1. Molecular Formula: C30H62O5Si3. Mole Weight: 587.08. Catalog: APB342644911. | |
| Calcitriol Impurity 21 | Calcitriol Impurity 21. Uses: For analytical and research use. Group: Impurity standards. CAS No. 200636-50-6. Molecular Formula: C30H61ClO4Si3. Mole Weight: 605.52. Catalog: APB200636506. | |
| Calcitriol Impurity 22 | Calcitriol Impurity 22. Uses: For analytical and research use. Group: Impurity standards. CAS No. 200636-54-0. Molecular Formula: C42H71O5PSi3. Mole Weight: 771.25. Catalog: APB200636540. | |
| Calcitriol Impurity 23 | Calcitriol Impurity 23. Uses: For analytical and research use. Group: Impurity standards. Molecular Formula: C30H63IO5Si3. Mole Weight: 714.99. Catalog: APB07211. | |
| Calcitriol Impurity 24 | Calcitriol Impurity 24. Uses: For analytical and research use. Group: Impurity standards. Molecular Formula: C30H63IO5Si3. Mole Weight: 714.99. Catalog: APB07210. | |
| Calcitriol Impurity 25 | Calcitriol Impurity 25. Uses: For analytical and research use. Group: Impurity standards. Molecular Formula: C30H62O5Si3. Mole Weight: 587.08. Catalog: APB07212. | |
| Calcitriol Impurity 26 | Calcitriol Impurity 26. Uses: For analytical and research use. Group: Impurity standards. Molecular Formula: C27H44O3. Mole Weight: 416.64. Catalog: APB07215. | |
| Calcitriol Impurity 27 | Calcitriol Impurity 27. Uses: For analytical and research use. Group: Impurity standards. Molecular Formula: C42H71O5PSi3. Mole Weight: 771.25. Catalog: APB07213. | |
| Calcitriol Impurity 28 | Calcitriol Impurity 28. Uses: For analytical and research use. Group: Impurity standards. Molecular Formula: C27H44O3. Mole Weight: 416.65. Catalog: APB07214. | |
| Calcitriol Impurity 29 | Calcitriol Impurity 29. Uses: For analytical and research use. Group: Impurity standards. CAS No. 144848-24-8. Molecular Formula: C24H46O2Si. Mole Weight: 394.71. Catalog: APB144848248. | |
| Calcitriol Impurity 30 | Calcitriol Impurity 30. Uses: For analytical and research use. Group: Impurity standards. CAS No. 1101133-55-4. Molecular Formula: C24H46O2Si. Mole Weight: 394.71. Catalog: APB1101133554. | |
| Calcitriol Impurity 31 | Calcitriol Impurity 31. Uses: For analytical and research use. Group: Impurity standards. Molecular Formula: C27H44O3. Mole Weight: 416.65. Catalog: APB07218. | |
| Calcitriol Impurity 32 | Calcitriol Impurity 32. Uses: For analytical and research use. Group: Impurity standards. Molecular Formula: C26H40O2. Mole Weight: 384.6. Catalog: APB07217. | |
| Calcitriol Impurity 33 | Calcitriol Impurity 33. Uses: For analytical and research use. Group: Impurity standards. Molecular Formula: C45H86O3Si3. Mole Weight: 759.44. Catalog: APB07220. | |
| Calcitriol Impurity 34 | Calcitriol Impurity 34. Uses: For analytical and research use. Group: Impurity standards. CAS No. 98728-26-8. Molecular Formula: C33H58O3Si. Mole Weight: 530.91. Catalog: APB98728268. | |
| Calcitriol Impurity 4 | Calcitriol Impurity 4. Uses: For analytical and research use. Group: Impurity standards. CAS No. 64190-52-9. Molecular Formula: C13H24O2. Mole Weight: 212.33. Catalog: APB64190529. | |
| Calcitriol Impurity 40 | Calcitriol Impurity 40. Uses: For analytical and research use. Group: Impurity standards. CAS No. 70550-73-1. Molecular Formula: C18H32O2. Mole Weight: 280.45. Catalog: APB70550731. | |
| Calcitriol Impurity 42 | Calcitriol Impurity 42. Uses: For analytical and research use. Group: Impurity standards. Molecular Formula: C27H44O3. Mole Weight: 416.65. Catalog: APB07216. | |
| Calcitriol Impurity 43 | Calcitriol Impurity 43. Uses: For analytical and research use. Group: Impurity standards. Molecular Formula: C27H44O4. Mole Weight: 432.65. Catalog: APB07219. | |
Our database is helping our users find suppliers everyday.
