A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| Diflucortolone | Difluocortolone is a corticosteroid. It is commonly used in the form of an acid ester. Uses: Anti-inflammatory agents. Synonyms: 6a,9-difluoro-11b,21-dihydroxy-16a-methylpregna-1,4-diene-3,20-dione; Pregna-1,4-diene-3,20-dione, 6,9-difluoro-11,21-dihydroxy-16-methyl-, (6a,11b,16a)-. Grade: > 95%. CAS No. 2607-6-9. Molecular formula: C22H28F2O4. Mole weight: 394.46. |  |
| Diflucortolone 17-Carboxlic Acid | Diflucortolone 17-Carboxlic Acid, known for its remarkable potency as a corticosteroid, extensively utilized in the biomedical sphere to study an array of dermal maladies including dermatitand eczema. Grade: > 95%. Molecular formula: C21H26F2O4. Mole weight: 380.44. | |
| Diflucortolone-d3 21-Acetate | Diflucortolone-d3 (D445617) derivative. A glucocorticoid. Group: Biochemicals. Alternative Names: (6α,11 β,16α)-21-(Acetyloxy)-6,9-difluoro-11-hydroxy-16-methyl-d3-pregna-1,4-diene-3,20-dione; 6α,9-Difluoro-11 β,21-dihydroxy-16α-methyl-pregna-1,4-diene-3,20-dione 21-Acetate. Grades: Highly Purified. Pack Sizes: 5mg. US Biological Life Sciences. |  Worldwide |
| Diflucortolone valerate | Diflucortolone valerate is a powerful corticosteroid used topically for the research of various skin diseases [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 59198-70-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg. Product ID: HY-U00058. |  |
| Diflufenican | Diflufenican. Group: Biochemicals. Alternative Names: N- (2, 4-Difluorophenyl) -2-[3- (trifluoromethyl) phenoxy]-3-pyridinecarboxamide; Brodal; Canyon. Grades: Highly Purified. CAS No. 83164-33-4. Pack Sizes: 500mg, 1g, 2g, 5g, 10g. Molecular Formula: C19H11F5N2O2. US Biological Life Sciences. | Worldwide |
| Diflufenican | Diflufenican is a contact, selective herbicide used to specifically control some broad leaved weeds [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 83164-33-4. Pack Sizes: 10 mM * 1 mL; 100 mg; 250 mg. Product ID: HY-W040206. | |
| Diflufenican-[d3] | A labelled Diflufenican, a contact, selective herbicide used to specifically control some broad leaved weeds. Synonyms: Diflufenican D3. Grade: 95% by HPLC; 95% atom D. CAS No. 1185009-29-3. Molecular formula: C19H8D3F5N2O2. Mole weight: 397.32. | |
| Diflufenican-d3 (N- (2, 4-Difluorophenyl) -2-[3- (trifluoromethyl) phenoxy-d3]-3-pyridinecarboxamide, Fenican-d3) | Pre and post emergence foliar absorbed herbicide for winter weed control in cereal crops; carotenoid biosynthesis inhibitor. Group: Biochemicals. Alternative Names: N- (2, 4-Difluorophenyl) -2-[3- (trifluoromethyl) phenoxy-d3]-3-pyridinecarboxamide; Fenican-d3. Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| Diflufenzopyr | Diflufenzopyr is a semicarbazone-type auxin transport inhibitor that can be used to control weed growth. Synonyms: 3-Pyridinecarboxylic acid, 2-[1-[2-[[(3,5-difluorophenyl)amino]carbonyl]hydrazinylidene]ethyl]-; 2-[1-[2-[[(3,5-Difluorophenyl)amino]carbonyl]hydrazinylidene]ethyl]-3-pyridinecarboxylic acid; 3-Pyridinecarboxylic acid, 2-[1-[[[(3,5-difluorophenyl)amino]carbonyl]hydrazono]ethyl]-; BAS 654H; SAN 835H. Grade: 95%. CAS No. 109293-97-2. Molecular formula: C15H12F2N4O3. Mole weight: 334.28. | |
| Diflufenzopyr sodium salt | analytical standard. Group: Pesticides & metabolites standards. |  |
| Diflunisal | Diflunisal (MK-647) is a salicylate derivative with nonsteroidal anti-inflammatory and uricosuric properties, which is used alone as an analgesic and in rheumatoid arthritis patients. The mechanism of action of diflunisal is as a Cyclooxygenase ( COX ) Inhibitor. Uses: Scientific research. Group: Signaling pathways. Alternative Names: MK-647. CAS No. 22494-42-4. Pack Sizes: 10 mM * 1 mL; 100 mg. Product ID: HY-18342. | |
| Diflunisal | Diflunisal, a salicylic acid derivative, is a non-steroidal anti-inflammatory drug with analgesic and anti-inflammatory activity. Uses: Anti-inflammatory agents, non-steroidal. Synonyms: 5-(2,4-difluorophenyl)-2-hydroxybenzoic acid; MK-647; MK647; MK 647; Dolobid; Dolobis; Flovacil; Fluniget; Fluodonil; Dflunisal. Grade: >98%. CAS No. 22494-42-4. Molecular formula: C13H8F2O3. Mole weight: 250.2. | |
| Diflunisal Acyl Glucuronide | Diflunisal acyl glucuronide is a metabolite of diflunisal, a nonsteroidal anti-inflammatory drug (NSAID) used to treat conditions such as rheumatoid arthritis, osteoarthritis, and other forms of chronic pain and inflammation. Synonyms: 1-(2',4'-Difluoro-4-hydroxy[1,1'-biphenyl]-3-carboxylate) β-D-glucopyranuronic acid; β-D-Glucopyranuronic acid, 1-(2',4'-difluoro-4-hydroxy[1,1'-biphenyl]-3-carboxylate); Diflunisal acyl-β-D-glucuronide; (2S,3S,4S,5R,6S)-6-((2',4'-Difluoro-4-hydroxy-[1,1'-biphenyl]-3-carbonyl)oxy)-3,4,5-trihydroxytetrahydro-2H-pyran-2-carboxylic acid. Grade: ≥95%. CAS No. 58446-30-3. Molecular formula: C19H16F2O9. Mole weight: 426.33. | |
| Diflunisal-[d3] | Diflunisal-[d3] is a labelled Diflunisal. Diflunisal is a nonsteroidal anti-inflammatory drug (NSAID) used for inflammations. Synonyms: Diflunisal D3. Grade: 95% by HPLC; 95% atom D. CAS No. 1286107-99-0. Molecular formula: C13H5D3F2O3. Mole weight: 253.22. | |
| Diflunisal EP Impurity C | An impurity of Diflunisal. Diflunisal, a salicylic acid derivative, is a non-steroidal anti-inflammatory drug with analgesic and anti-inflammatory activity. Synonyms: 2',4'-Difluoro(1,1'-biphenyl)-4-yl acetate; 4-Acetoxy-2',4'-difluorobiphenyl. CAS No. 59089-67-7. Molecular formula: C14H10F2O2. Mole weight: 248.22. | |
| Diflunisal Phenolic Glucuronide | A phenolic glucuronide metabolite of Diflusinal. Synonyms: 3-Carboxy-2',4'-difluoro[1,1'-biphenyl]-4-yl β-D-Glucopyranosiduronic Acid; Diflunisal 1-O-β-D-Glucuronate. Grade: > 95%. CAS No. 58446-29-0. Molecular formula: C19H14F2O9. Mole weight: 424.32. | |
| Diflunisal Phosphate | Fluorescence: max. Abs. 391nm; e x 10-3: 6.1. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 100mg. US Biological Life Sciences. | Worldwide |
| Difluocortolone Valerate | Difluocortolone Valerate is the 9α-fluoro derivative of Fluocortolone. Uses: Anti-inflammatory agents. Synonyms: 6alpha,9-difluoro-11beta,21-dihydroxy-16alpha-methylpregna-1,4-diene-3,20-dione 21-valerate; Diflucortolone 21-valerate; Neriforte; Nerisona; Nerisone; Nerisone Forte; (6α,11β,16α)-6,9-Difluoro-11-hydroxy-16-methyl-21-[(1-oxopentyl)oxy]pregna-1,4-diene-3,20-dio. Grade: > 95%. CAS No. 59198-70-8. Molecular formula: C27H36F2O5. Mole weight: 478.58. | |
| Difluoro{2-[1-(3,5-dimethyl-2H-pyrrol-2-ylidene-N)ethyl]-3,5-dimethyl-1H-pyrrolato-N}boron | Difluoro{2-[1-(3,5-dimethyl-2H-pyrrol-2-ylidene-N)ethyl]-3,5-dimethyl-1H-pyrrolato-N}boron. Group: other materials. CAS No. 121207-31-6. Product ID: 2,2-difluoro-4,6,8,10,12-pentamethyl-3-aza-1-azonia-2-boranuidatricyclo[7.3.0.03,7]dodeca-1(12),4,6,8,10-pentaene. Molecular formula: 262.11g/mol. Mole weight: C14H17BF2N2. [B-]1 (N2C (=CC (=C2C (=C3[N+]1=C (C=C3C)C)C)C)C) (F)F. InChI=1S/C14H17BF2N2/c1-8-6-10 (3)18-13 (8)12 (5)14-9 (2)7-11 (4)19 (14)15 (18, 16)17/h6-7H, 1-5H3. DRJHPEGNOPSARR-UHFFFAOYSA-N. |  |
| Difluoro{2-[1-(3,5-dimethyl-2H-pyrrol-2-ylidene-N)ethyl]-3,5-dimethyl-1H-pyrrolato-N}boron | 99% (HPLC). Group: Photonic and optical materials. | |
| Difluoro{2-[(3,5-dimethyl-2H-pyrrol-2-ylidene-N)methyl]-3,5-dimethyl-1H-pyrrolato-N}boron | Difluoro{2-[(3,5-dimethyl-2H-pyrrol-2-ylidene-N)methyl]-3,5-dimethyl-1H-pyrrolato-N}boron. Group: other materials. CAS No. 21658-70-8. | |
| Difluoro{2-[(3,5-dimethyl-2H-pyrrol-2-ylidene-N)methyl]-3,5-dimethyl-1H-pyrrolato-N}boron | 99% (HPLC). Group: Photonic and optical materials. | |
| Difluoro{3-ethyl-5-[1-(4-ethyl-3,5-dimethyl-2H-pyrrol-2-ylidene-N)ethyl]-2,4-dimethyl-1H-pyrrolato-N}boron | Difluoro{3-ethyl-5-[1-(4-ethyl-3,5-dimethyl-2H-pyrrol-2-ylidene-N)ethyl]-2,4-dimethyl-1H-pyrrolato-N}boron. Group: other materials. CAS No. 131083-16-4. Product ID: 5,11-diethyl-2,2-difluoro-4,6,8,10,12-pentamethyl-3-aza-1-azonia-2-boranuidatricyclo[7.3.0.03,7]dodeca-1(12),4,6,8,10-pentaene. Molecular formula: 318.2g/mol. Mole weight: C18H25BF2N2. [B-]1 (N2C (=C (C (=C2C (=C3[N+]1=C (C (=C3C)CC)C)C)C)CC)C) (F)F. InChI=1S/C18H25BF2N2/c1-8-15-10 (3)17-12 (5)18-11 (4)16 (9-2)14 (7)23 (18)19 (20, 21)22 (17)13 (15)6/h8-9H2, 1-7H3. DZSMVBDAUBBZJD-UHFFFAOYSA-N. | |
| Difluoro{3-ethyl-5-[1-(4-ethyl-3,5-dimethyl-2H-pyrrol-2-ylidene-N)ethyl]-2,4-dimethyl-1H-pyrrolato-N}boron | 98% (HPLC). Group: Photonic and optical materials. | |
| Difluoro(4-(1,1-dimethylethyl)-2-{1-[4-(1,1-dimethylethyl)-3,5-dimethyl-2H-pyrrol-2-ylidene-N]ethyl}-3,5-dimethyl-1H-pyrrol-2-ylidene-N]ethyl}-3,5-dimethyl-1H-pyrrolato-N)boron | Difluoro(4-(1,1-dimethylethyl)-2-{1-[4-(1,1-dimethylethyl)-3,5-dimethyl-2H-pyrrol-2-ylidene-N]ethyl}-3,5-dimethyl-1H-pyrrol-2-ylidene-N]ethyl}-3,5-dimethyl-1H-pyrrolato-N)boron. Group: other materials. CAS No. 137829-79-9. Product ID: 5,11-ditert-butyl-2,2-difluoro-4,6,8,10,12-pentamethyl-3-aza-1-azonia-2-boranuidatricyclo[7.3.0.03,7]dodeca-1(12),4,6,8,10-pentaene. Molecular formula: 374.3g/mol. Mole weight: C22H33BF2N2. [B-]1 (N2C (=C (C (=C2C (=C3[N+]1=C (C (=C3C)C (C) (C)C)C)C)C)C (C) (C)C)C) (F)F. InChI=1S/C22H33BF2N2/c1-12-17 (21 (6, 7)8)15 (4)26-19 (12)14 (3)20-13 (2)18 (22 (9, 10)11)16 (5)27 (20)23 (26, 24)25/h1-11H3. SEHGNHOGQDPQRC-UHFFFAOYSA-N. | |
| Difluoro(4-(1,1-dimethylethyl)-2-{1-[4-(1,1-dimethylethyl)-3,5-dimethyl-2H-pyrrol-2-ylidene-N]ethyl}-3,5-dimethyl-1H-pyrrol-2-ylidene-N]ethyl}-3,5-dimethyl-1H-pyrrolato-N)boron | 98% (HPLC). Group: Photonic and optical materials. | |
| Difluoroacetaldehyde Ethyl Hemiacetal | Difluoroacetaldehyde Ethyl Hemiacetal. Group: Biochemicals. Alternative Names: 1-Ethoxy-2,2-difluoroethanol. Grades: Highly Purified. CAS No. 148992-43-2. Pack Sizes: 1g, 2g, 5g, 10g, 25g. US Biological Life Sciences. | Worldwide |
| Difluoroacetic acid 98+% (GC) | Difluoroacetic acid 98+% (GC). Group: Biochemicals. Grades: GC. CAS No. 381-73-7. Pack Sizes: 25g, 100g, 250g, 1Kg. US Biological Life Sciences. | Worldwide |
| Difluoroacetic Anhydride | Difluoroacetic Anhydride. Group: Biochemicals. Grades: Highly Purified. CAS No. 401-67-2. Pack Sizes: 1g, 2g, 5g, 10g, 25g. US Biological Life Sciences. | Worldwide |
| Difluoro atorvastatin | Difluoro atorvastatin. Group: Biochemicals. Alternative Names: (b-R, δ R)-2, 3-Β is (4-fluorophenyl)-b, δ -dihydroxy-5- (1-methylethyl)-4-[ (phenylamino)carbonyl]-1H-pyrrole-1-heptanoic Αcid. Grades: Highly Purified. CAS No. 693794-20-6. Pack Sizes: 2mg, 5mg, 10mg, 25mg, 50mg. Molecular Formula: C33H34F2N2O5. US Biological Life Sciences. | Worldwide |
| Difluoro Atorvastatin Acetonide tert-Butyl Ester | Difluoro Atorvastatin Acetonide tert-Butyl Ester is the impuritiy of Atorvastatin, a selective, competitive HMG-CoA reductase inhibitor. Synonyms: tert-butyl 2-((4R,6R)-6-(2-(2,3-bis(4-fluorophenyl)-5-isopropyl-4-(phenylcarbamoyl)-1H-pyrrol-1-yl)ethyl)-2,2-dimethyl-1,3-dioxan-4-yl)acetate; (4R,6R)-6-[2-[2,3-Bis(4-fluorophenyl)-5-(1-methylethyl)-4-[(phenylamino)carbonyl]-1H-pyrrol-1-yl]ethyl]-2,2-dimethyl-1,3-Dioxane-4-acetic Acid 1,1-Dimethylethyl Ester. CAS No. 693793-87-2. Molecular formula: C40H46F2N2O5. Mole weight: 672.8. | |
| Di-Fluoro ethylene carbonate | Di-Fluoro ethylene carbonate. CAS No: 311810-76-1 |  Sarchem Laboratories New Jersey NJ |
| difluorolanthanum | difluorolanthanum. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Lanthanum difluoride, 15948-68-2. Product Category: Heterocyclic Organic Compound. CAS No. 15948-68-2. Molecular formula: F2La. Mole weight: 176.902 g/mol. Purity: 0.96. IUPACName: difluorolanthanum. Canonical SMILES: F[La]F. Product ID: ACM15948682. Alfa Chemistry ISO 9001:2015 Certified. |  |
| Difluoromethane-d2 | Difluoromethane-d2. Uses: Designed for use in research and industrial production. Additional or Alternative Names: DIFLUOROMETHANE. Product Category: Heterocyclic Organic Compound. CAS No. 594-24-1. Molecular formula: CD2F2. Mole weight: 54.0357. Purity: 0.96. IUPACName: difluoromethane-d2. Product ID: ACM594241. Alfa Chemistry ISO 9001:2015 Certified. Categories: Difluoromethane (data page). | |
| Difluoromethane sulfonyl Chloride | Difluoromethane sulfonyl Chloride is a reactant used in the synthesis of ketoconazole sulfonamide analogs as antifungal agents. Group: Biochemicals. Grades: Highly Purified. CAS No. 1512-30-7. Pack Sizes: 100mg, 250mg. Molecular Formula: CHClF2O2S, Molecular Weight: 150.53. US Biological Life Sciences. | Worldwide |
| Difluoromethyl 2,2,2-trifluoroethyl ether | Difluoromethyl 2,2,2-trifluoroethyl ether. Group: Biochemicals. Grades: Highly Purified. CAS No. 1885-48-9. Pack Sizes: 5g, 10g, 25g, 50g, 100g. US Biological Life Sciences. | Worldwide |
| Difluoro methyl enediphosphonic Acid | A phosphonic acid derivative for development of biologically active compounds. Group: Biochemicals. Alternative Names: P, P'- (Difluoromethylene) bisphosphonic Acid; Difluoromethylene) bis[phosphonic Acid]; (Difluoromethylene) bisphosphonic Acid. Grades: Highly Purified. CAS No. 10596-32-4. Pack Sizes: 2.5mg. US Biological Life Sciences. | Worldwide |
| Difluoromethyl Phenyl Sulfone | Difluoromethyl Phenyl Sulfone. Group: Biochemicals. Alternative Names: Phenyl Difluoromethyl Sulfone; [ (Difluoromethyl) sulfonyl]-benzene. Grades: Highly Purified. CAS No. 1535-65-5. Pack Sizes: 5g. Molecular Formula: C7H6F2O2S, Molecular Weight: 192.18. US Biological Life Sciences. | Worldwide |
| Difluoro methyl thioacetic Acid Potassium Salt | Difluoro methyl thioacetic Acid Potassium Salt is a reagent used in the preparation of oxacephem antibiotics. Group: Biochemicals. Alternative Names: (Difluoromethylthio) acetic Acid; 2-[ (Difluoromethyl) thio]acetic Acid Potassium Salt. Grades: Highly Purified. CAS No. 83494-32-0. Pack Sizes: 5g. US Biological Life Sciences. | Worldwide |
| Difluprednate | Difluprednate. Group: Biochemicals. Alternative Names: (6a,11b)-21-(Acetyloxy)-6,9-difluoro-11-hydroxy-17-(1-oxobutoxy)-pregna-1,4-diene-3,20-dione; 6a,9-Difluoro-11b,17,21-trihydroxypregna-1,4-diene-3,20-dione 21-acetate 17-butyrate; 6a,9-Difluoroprednisolone 21-acetate 17-butyrate. Grades: Highly Purified. CAS No. 23674-86-4. Pack Sizes: 5mg, 10mg, 25mg, 50mg, 100mg. Molecular Formula: C27H34F2O7. US Biological Life Sciences. | Worldwide |
| Difluprednate | Difluprednate (difluoroprednisolone butyrate acetate, or DFBA) is a synthetic difluorinated prednisolone derivative, it is originally developed for dermatologic applications.On June 24, 2008, the US Food and Drug Administration (FDA) approved difluprednate for the treatment of post-operative ocular inflammation and pain. It is marketed by Alcon under the tradename Durezol. Uses: Glucocorticoids. Synonyms: CM 9155; CM9155; CM-9155; W 6309; W-6309; W6309; Difluprednate; Durezol; Epitopic. Grade: >98%. CAS No. 23674-86-4. Molecular formula: C27H34F2O7. Mole weight: 508.55. | |
| Difluprednate | 1g Pack Size. Group: Bioactive Small Molecules, Biochemicals, Research Organics & Inorganics. Formula: C27H34F2O7. CAS No. 23674-86-4. Prepack ID 47585639-1g. Molecular Weight 508.55. See USA prepack pricing. |  |
| Difluprednate | Difluprednate is a topical corticosteroid, which is thought to act by the induction of phospholipase A2 inhibitory proteins (lipocortins). Difluprednate is used for the symptomatic treatment of inflammation and pain associated with ocular surgery. Uses: Scientific research. Group: Signaling pathways. CAS No. 23674-86-4. Pack Sizes: 10 mM * 1 mL; 50 mg; 100 mg; 500 mg. Product ID: HY-17569. | |
| Difluprednate 17-carboxylic acid | Difluprednate 17-carboxylic acid is an impurity of the drug Difluprednate, which is used for the treatment of post-operative ocular inflammation and pain. Synonyms: (6S,8S,9R,10S,11S,13S,14S,17S)-6,9-difluoro-11-hydroxy-10,13-dimethyl-3-oxo-7,8,11,12,14,15,16,17-octahydro-6H-cyclopenta[a]phenanthrene-17-carboxylic acid; (6α,11β,17α)-6,9-Difluoro-11-hydroxy-3-oxo-androsta-1,4-diene-17-carboxylic Acid; Androsta-1,4-diene-17-carboxylic acid, 6,9-difluoro-11-hydroxy-3-oxo-, (6α,11β,17α)-; 6alpha,9alpha-Difluoro-11beta-hydroxy-1,4-androstadien-3-one 17beta-carboxylic acid; 17α,21-Dideoxy-6α,9α-Difluoroprednisolone; Difluprednate Impurity 6. Grade: ≥95%. CAS No. 167997-12-8. Molecular formula: C20H24F2O4. Mole weight: 366.40. | |
| Difluprednate Impurity 1 | Difluprednate Impurity 1 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Molecular formula: C27H35FO7. Mole weight: 490.56. | |
| Difluprednate Impurity 10 | Difluprednate Impurity 10 is an impurity of the drug Difluprednate. Difluprednate is a corticosteroid (derivative of prednisolone), approved for the treatment of post-operative ocular inflammation. Synonyms: 6α,9α-Difluoro-11β-hydroxyboldione. Grade: 98%. Molecular formula: C19H22F2O3. Mole weight: 336.37. | |
| Difluprednate Impurity 12 | 21-Desacetyl-21-isovaleroyl Difluprednate is an impurity of the drug Difluprednate. Difluprednate is a corticosteroid (derivative of prednisolone), approved for the treatment of post-operative ocular inflammation. Synonyms: 2-((6S,8S,9R,10S,11S,13S,14S,17R)-17-(Butyryloxy)-6,9-difluoro-11-hydroxy-10,13-dimethyl-3-oxo-6,7,8,9,10,11,12,13,14,15,16,17-dodecahydro-3H-cyclopenta[a]phenanthren-17-yl)-2-oxoethyl3-Methylbutanoate; 21-Desacetyl-21-isovaleroylDifluprednate. Molecular formula: C30H40F2O7. Mole weight: 550.63. | |
| Difluprednate Impurity 13 | Difluprednate Impurity 13 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Grade: 98%. Molecular formula: C22H26F2O6. Mole weight: 424.43. | |
| Difluprednate Impurity 14 | Difluprednate Impurity 14 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Grade: 98%. Molecular formula: C20H24F2O5. Mole weight: 382.40. | |
| Difluprednate Impurity 15 | Difluprednate Impurity 15 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. CAS No. 2285-44-1. Molecular formula: C21H24F2O4. Mole weight: 378.41. | |
| Difluprednate Impurity 16 | Difluprednate Impurity 16 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Synonyms: 6alpha,9-difluoro-11beta,21-dihydroxypregna-1,4,16-triene-3,20-dione21-acetate. CAS No. 2326-26-3. Molecular formula: C23H26F2O5. Mole weight: 420.45. | |
| Difluprednate Impurity 17 | Difluprednate Impurity 17 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. CAS No. 1296262-60-6. Molecular formula: C21H24F2O5. Mole weight: 394.41. | |
| Difluprednate Impurity 2 | Difluprednate Impurity 2 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Molecular formula: C27H35FO8. Mole weight: 506.56. | |
| Difluprednate Impurity 3 | Difluprednate Impurity 3 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Molecular formula: C27H34ClFO7. Mole weight: 525.00. | |
| Difluprednate Impurity 4 | Difluprednate Impurity 4 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Synonyms: 6α,9α-Difluoroprednisolone21-Butyrate. Grade: 98%. Molecular formula: C25H32F2O6. Mole weight: 466.51. | |
| Difluprednate Impurity 5 | Difluprednate Impurity 5 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Molecular formula: C27H34ClFO7. Mole weight: 525.00. | |
| Difluprednate Impurity 8 | Difluprednate Impurity 8 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Molecular formula: C27H34ClFO7. Mole weight: 525.00. | |
| Difluprednate Impurity 9 | Difluprednate Impurity 9 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Molecular formula: C27H35FO8. Mole weight: 506.56. | |
| Di-Fmoc-L-alpha,beta-diaminopropionic acid | Di-Fmoc-L-alpha,beta-diaminopropionic acid. Uses: Peptide synthesis. Additional or Alternative Names: Nα,Nβ-di-Fmoc-L-2,3-diaminopropionic acid, Fmoc-3-(Fmoc-amino)-L-alanine. Product Category: Amino Acids. CAS No. 201473-90-7. Molecular formula: C33H28N2O6. Mole weight: 548.6. Canonical SMILES: OC(=O)[C@H](CNC(=O)OCC1c2ccccc2-c3ccccc13)NC(=O)OCC4c5ccccc5-c6ccccc46. Product ID: ACM201473907. Alfa Chemistry ISO 9001:2015 Certified. Categories: Fmoc-Dap(Fmoc)-OH. | |
| DiFMUP | DiFMUP. Uses: Designed for use in research and industrial production. Additional or Alternative Names: (6,8-difluoro-4-methyl-2-oxochromen-7-yl)dihydrogenphosphate. Product Category: Other Fluorophores. Appearance: Powder or solid. CAS No. 214491-43-7. Molecular formula: C10H7F2O6P. Mole weight: 292.13. Purity: ≥95%. IUPACName: (6,8-difluoro-4-methyl-2-oxochromen-7-yl)dihydrogenphosphate. Canonical SMILES: CC1=CC(=O)OC2=C(C(=C(C=C12)F)OP(=O)(O)O)F. Product ID: ACM214491437-1. Alfa Chemistry ISO 9001:2015 Certified. Categories: Difluprednate. | |
| DiFMUP | DiFMUP is a fluorogenic substrate, and has been widely used for the continuous detection of phosphatase activities. DiFMUP is hydrolysis by a phosphatase results in the release of Xuorescent DIFMU, which can be easily followed in continuous mode by a Xuorescence reader[1][2]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: 6,8-Difluoro-4-methylumbelliferyl phosphate. CAS No. 214491-43-7. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-120166. | |
| Difopein | Difopein has been found to be a 14.3.3 protein inhibitor and could induce apoptosis expressed in COS-7 and some cancer cells. Synonyms: Difopein; 396834-58-5; HB2038; AKOS024456954; C338H529N97O105S11; IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG. Grade: ≥95% by HPLC. CAS No. 396834-58-5. Molecular formula: C273H424N76O89S6. Mole weight: 6387.17. | |
| Difructose anhydride III | Difructose anhydride III is an esteemed compound, exhibiting prodigious potential in the research of metabolic disorders. Synonyms: Difructose anhydride; α-D-Fructofuranose β-D-fructofuranose 1,2':2,3'-dianhydride; DFA III; Difructose III; Twintose. CAS No. 81129-73-9. Molecular formula: C12H20O10. Mole weight: 324.28. | |
| difructose-anhydride synthase | Produces difructose anhydride by the reverse reaction of partial hydrolysis, forming an α-fructosidic linkage. Group: Enzymes. Synonyms: inulobiose hydrolase. Enzyme Commission Number: EC 3.2.1.134. CAS No. 121479-55-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3817; difructose-anhydride synthase; EC 3.2.1.134; 121479-55-8; inulobiose hydrolase. Cat No: EXWM-3817. |  |
| Diftalone | Diftalone. Uses: Designed for use in research and industrial production. Additional or Alternative Names: L 5418; Aladione; Diftalona [INN-Spanish]; Phthalazino<2,3-b>phthalazin-5,12(7H,14H)-dion; Diftalonum [INN-Latin]; phthalazino<2,3-b>phthalazine-5,12-(14H,7H)dione; DIFTALONE; Phthalazino[2,3-b]phthalazine-5,12(7H,14H)-dione; 7H,14H-phthalazin. Product Category: Heterocyclic Organic Compound. CAS No. 21626-89-1. Molecular formula: C16H12N2O2. Mole weight: 264.279 g/mol. Purity: 0.96. IUPACName: 5,12-dihydrophthalazino[3,2-b]phthalazine-7,14-dione. Canonical SMILES: C1C2=CC=CC=C2C(=O)N3N1C(=O)C4=CC=CC=C4C3. Density: 1.43g/cm³. ECNumber: 244-484-3. Product ID: ACM21626891. Alfa Chemistry ISO 9001:2015 Certified. | |
| diF-TES-ADT | diF-TES-ADT. Group: Organic field effect transistor (ofet) materials. CAS No. 1015071-21-2. Product ID: 2-[7, 17-difluoro-12-(2-triethylsilylethynyl)-6, 16-dithiapentacyclo[11.7.0.03, 11.05, 9.015, 19]icosa-1(13), 2, 4, 7, 9, 11, 14, 17, 19-nonaen-2-yl]ethynyl-triethylsilane. Molecular formula: 602.9g/mol. Mole weight: C34H36F2S2Si2. CC[Si] (CC) (CC)C#CC1=C2C=C3C (=CC2=C (C4=C1C=C5C=C (SC5=C4)F)C#C[Si] (CC) (CC)CC)C=C (S3)F. InChI=1S/C34H36F2S2Si2/c1-7-39 (8-2, 9-3)15-13-25-27-17-23-19-33 (35)38-32 (23)22-30 (27)26 (14-16-40 (10-4, 11-5)12-6)28-18-24-20-34 (36)37-31 (24)21-29 (25)28/h17-22H, 7-12H2, 1-6H3. AEOCOSISEQLPHY-UHFFFAOYSA-N. | |
| diF-TES-ADT | 99% (HPLC). Group: Organic field effect transistor (ofet) materials. | |
| Difucosyl (1-2,1-2)-iso-lacto-N-octaose | Difucosyl (1-2,1-2)-iso-lacto-N-octaose. Synonyms: Fucα1-2Galβ1-3GlcNAcβ1-3(Fucα1-2Galβ1-3GlcNAcβ1-3Galβ1-4GlcNAcβ1-6)Galβ1-4Glc; DFiLNO (1-2,1-2); DFiLNO I. | |
| Difucosyllacto-N-hexaose (a) | Difucosyllacto-N-hexaose (a) is an indispensable molecule widely employed in the biomedical sector due to its inherent therapeutic attributes. Its efficacy in tackling various ailments such as cancer and autoimmune disorders has been established through rigorous examination. Notably, this compound serves as an unrivaled asset in precise medical examinations elucidating individualized pharmacological targets. Synonyms: DFLNH (a); Difucosyl-para-lacto-N-neo-hexaose; β-Gal-(1-4)[α-Fuc-(1-3)]-β-GlcNAc-(1-3)-β-Gal-(1-4)[α-Fuc(1-3)]-β-GlcNAc(1-3)-β-Gal-(1-4)-Glc; Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)Glc; O-6-Deoxy-α-L-galactopyranosyl-(1→3)-O-[β-D-galactopyranosyl-(1→4)]-O-2-(acetylamino)-2-deoxy-β-D-glucopyranosyl-(1→3)-O-β-D-galactopyranosyl-(1→4)-O-[6-deoxy-α-L-galactopyranosyl-(1→3)]-O-2-(acetylamino)-2-deoxy-β-D-glucopyranosyl-(1→3)-O-β-D-galactopyranosyl-(1→4)-D-glucose; DF-pLNnH; Difucosyl p-lacto-N-neohexaose; Difucosyl-para-lacto-N-neohexaose. Grade: ≥90%. CAS No. 64396-27-6. Molecular formula: C52H88N2O39. Mole weight: 1365.25. | |
| Difucosyllacto-N-hexaose b | Difucosyllacto-N-hexaose b is an extraordinary biomedical marvel meticulously designed to study a plethora of ailments like microbial infections instigated by select bacteria and viruses. Synonyms: DFLNH (b); Difuco-lacto-N-hexaose; Difucosyllacto-N-neohexaose II; D-Glucose, O-6-deoxy-α-L-galactopyranosyl-(1->3)-O-[β-D-galactopyranosyl-(1->4)]-O-2-(acetylamino)-2-deoxy-β-D-glucopyranosyl-(1->6)-O-[O-6-deoxy-α-L-galactopyranosyl-(1->4)-O-[β-D-ga lactopyranosyl-(1->3)]-2-(acetylamino)-2-deoxy-β-D-glucopyranosyl-(1->3)]-O-β-D-galactopyranosyl-(1->4)-; O-6-Deoxy-α-L-galactopyranosyl-(1→3)-O-[β-D-galactopyranosyl-(1→4)]-O-2-(acetylamino)-2-deoxy-β-D-glucopyranosyl-(1→6)-O-[O-6-deoxy-α-L-galactopyranosyl-(1→4)-O-[β-D-galactopyranosyl-(1→3)]-2-(acetylamino)-2-deoxy-β-D-glucopyranosyl-(1→3)]-O-β-D-galactopyranosyl-(1→4)-D-glucose; DFLNH B; DFSLNnH; Difucosyl-lacto-N-hexaose II. Grade: ≥95%. CAS No. 98359-76-3. Molecular formula: C52H88N2O39. Mole weight: 1365.25. | |
Our database is helping our users find suppliers everyday.
