A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Difluoroacetaldehyde Ethyl Hemiacetal. Group: Biochemicals. Alternative Names: 1-Ethoxy-2,2-difluoroethanol. Grades: Highly Purified. CAS No. 148992-43-2. Pack Sizes: 1g, 2g, 5g, 10g, 25g. US Biological Life Sciences.
Worldwide
Difluoroacetic acid 98+% (GC)
Difluoroacetic acid 98+% (GC). Group: Biochemicals. Grades: GC. CAS No. 381-73-7. Pack Sizes: 25g, 100g, 250g, 1Kg. US Biological Life Sciences.
Worldwide
Difluoroacetic Anhydride
Difluoroacetic Anhydride. Group: Biochemicals. Grades: Highly Purified. CAS No. 401-67-2. Pack Sizes: 1g, 2g, 5g, 10g, 25g. US Biological Life Sciences.
Worldwide
Difluoro atorvastatin
Difluoro atorvastatin. Group: Biochemicals. Alternative Names: (b-R, δ R)-2, 3-Β is (4-fluorophenyl)-b, δ -dihydroxy-5- (1-methylethyl)-4-[ (phenylamino)carbonyl]-1H-pyrrole-1-heptanoic Αcid. Grades: Highly Purified. CAS No. 693794-20-6. Pack Sizes: 2mg, 5mg, 10mg, 25mg, 50mg. Molecular Formula: C33H34F2N2O5. US Biological Life Sciences.
Worldwide
Difluoro Atorvastatin Acetonide tert-Butyl Ester
Difluoro Atorvastatin Acetonide tert-Butyl Ester is the impuritiy of Atorvastatin, a selective, competitive HMG-CoA reductase inhibitor. Synonyms: tert-butyl 2-((4R,6R)-6-(2-(2,3-bis(4-fluorophenyl)-5-isopropyl-4-(phenylcarbamoyl)-1H-pyrrol-1-yl)ethyl)-2,2-dimethyl-1,3-dioxan-4-yl)acetate; (4R,6R)-6-[2-[2,3-Bis(4-fluorophenyl)-5-(1-methylethyl)-4-[(phenylamino)carbonyl]-1H-pyrrol-1-yl]ethyl]-2,2-dimethyl-1,3-Dioxane-4-acetic Acid 1,1-Dimethylethyl Ester. CAS No. 693793-87-2. Molecular formula: C40H46F2N2O5. Mole weight: 672.8.
Di-Fluoro ethylene carbonate
Di-Fluoro ethylene carbonate. CAS No: 311810-76-1
Sarchem Laboratories New Jersey NJ
difluorolanthanum
difluorolanthanum. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Lanthanum difluoride, 15948-68-2. Product Category: Heterocyclic Organic Compound. CAS No. 15948-68-2. Molecular formula: F2La. Mole weight: 176.902 g/mol. Purity: 0.96. IUPACName: difluorolanthanum. Canonical SMILES: F[La]F. Product ID: ACM15948682. Alfa Chemistry ISO 9001:2015 Certified.
Difluoromethane-d2
Difluoromethane-d2. Uses: Designed for use in research and industrial production. Additional or Alternative Names: DIFLUOROMETHANE. Product Category: Heterocyclic Organic Compound. CAS No. 594-24-1. Molecular formula: CD2F2. Mole weight: 54.0357. Purity: 0.96. IUPACName: difluoromethane-d2. Product ID: ACM594241. Alfa Chemistry ISO 9001:2015 Certified. Categories: Difluoromethane (data page).
Difluoromethane sulfonyl Chloride
Difluoromethane sulfonyl Chloride is a reactant used in the synthesis of ketoconazole sulfonamide analogs as antifungal agents. Group: Biochemicals. Grades: Highly Purified. CAS No. 1512-30-7. Pack Sizes: 100mg, 250mg. Molecular Formula: CHClF2O2S, Molecular Weight: 150.53. US Biological Life Sciences.
Worldwide
Difluoromethyl 2,2,2-trifluoroethyl ether
Difluoromethyl 2,2,2-trifluoroethyl ether. Group: Biochemicals. Grades: Highly Purified. CAS No. 1885-48-9. Pack Sizes: 5g, 10g, 25g, 50g, 100g. US Biological Life Sciences.
Worldwide
Difluoro methyl enediphosphonic Acid
A phosphonic acid derivative for development of biologically active compounds. Group: Biochemicals. Alternative Names: P, P'- (Difluoromethylene) bisphosphonic Acid; Difluoromethylene) bis[phosphonic Acid]; (Difluoromethylene) bisphosphonic Acid. Grades: Highly Purified. CAS No. 10596-32-4. Pack Sizes: 2.5mg. US Biological Life Sciences.
Worldwide
Difluoromethyl Phenyl Sulfone
Difluoromethyl Phenyl Sulfone. Group: Biochemicals. Alternative Names: Phenyl Difluoromethyl Sulfone; [ (Difluoromethyl) sulfonyl]-benzene. Grades: Highly Purified. CAS No. 1535-65-5. Pack Sizes: 5g. Molecular Formula: C7H6F2O2S, Molecular Weight: 192.18. US Biological Life Sciences.
Worldwide
Difluoro methyl thioacetic Acid Potassium Salt
Difluoro methyl thioacetic Acid Potassium Salt is a reagent used in the preparation of oxacephem antibiotics. Group: Biochemicals. Alternative Names: (Difluoromethylthio) acetic Acid; 2-[ (Difluoromethyl) thio]acetic Acid Potassium Salt. Grades: Highly Purified. CAS No. 83494-32-0. Pack Sizes: 5g. US Biological Life Sciences.
Worldwide
Difluprednate
Difluprednate (difluoroprednisolone butyrate acetate, or DFBA) is a synthetic difluorinated prednisolone derivative, it is originally developed for dermatologic applications.On June 24, 2008, the US Food and Drug Administration (FDA) approved difluprednate for the treatment of post-operative ocular inflammation and pain. It is marketed by Alcon under the tradename Durezol. Uses: Glucocorticoids. Synonyms: CM 9155; CM9155; CM-9155; W 6309; W-6309; W6309; Difluprednate; Durezol; Epitopic. Grades: >98%. CAS No. 23674-86-4. Molecular formula: C27H34F2O7. Mole weight: 508.55.
Difluprednate
Difluprednate is a topical corticosteroid, which is thought to act by the induction of phospholipase A2 inhibitory proteins (lipocortins). Difluprednate is used for the symptomatic treatment of inflammation and pain associated with ocular surgery. Uses: Scientific research. Group: Signaling pathways. CAS No. 23674-86-4. Pack Sizes: 10 mM * 1 mL; 50 mg; 100 mg; 500 mg. Product ID: HY-17569.
Difluprednate
1g Pack Size. Group: Bioactive Small Molecules, Biochemicals, Research Organics & Inorganics. Formula: C27H34F2O7. CAS No. 23674-86-4. Prepack ID 47585639-1g. Molecular Weight 508.55. See USA prepack pricing.
Difluprednate
Difluprednate. Group: Biochemicals. Alternative Names: (6a,11b)-21-(Acetyloxy)-6,9-difluoro-11-hydroxy-17-(1-oxobutoxy)-pregna-1,4-diene-3,20-dione; 6a,9-Difluoro-11b,17,21-trihydroxypregna-1,4-diene-3,20-dione 21-acetate 17-butyrate; 6a,9-Difluoroprednisolone 21-acetate 17-butyrate. Grades: Highly Purified. CAS No. 23674-86-4. Pack Sizes: 5mg, 10mg, 25mg, 50mg, 100mg. Molecular Formula: C27H34F2O7. US Biological Life Sciences.
Worldwide
Difluprednate Impurity 1
Difluprednate Impurity 1 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Molecular formula: C27H35FO7. Mole weight: 490.56.
Difluprednate Impurity 10
Difluprednate Impurity 10 is an impurity of the drug Difluprednate. Difluprednate is a corticosteroid (derivative of prednisolone), approved for the treatment of post-operative ocular inflammation. Synonyms: 6α,9α-Difluoro-11β-hydroxyboldione. Grades: 98%. Molecular formula: C19H22F2O3. Mole weight: 336.37.
Difluprednate Impurity 12
21-Desacetyl-21-isovaleroyl Difluprednate is an impurity of the drug Difluprednate. Difluprednate is a corticosteroid (derivative of prednisolone), approved for the treatment of post-operative ocular inflammation. Synonyms: 2-((6S,8S,9R,10S,11S,13S,14S,17R)-17-(Butyryloxy)-6,9-difluoro-11-hydroxy-10,13-dimethyl-3-oxo-6,7,8,9,10,11,12,13,14,15,16,17-dodecahydro-3H-cyclopenta[a]phenanthren-17-yl)-2-oxoethyl3-Methylbutanoate; 21-Desacetyl-21-isovaleroylDifluprednate. Molecular formula: C30H40F2O7. Mole weight: 550.63.
Difluprednate Impurity 13
Difluprednate Impurity 13 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Grades: 98%. Molecular formula: C22H26F2O6. Mole weight: 424.43.
Difluprednate Impurity 14
Difluprednate Impurity 14 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Grades: 98%. Molecular formula: C20H24F2O5. Mole weight: 382.40.
Difluprednate Impurity 15
Difluprednate Impurity 15 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. CAS No. 2285-44-1. Molecular formula: C21H24F2O4. Mole weight: 378.41.
Difluprednate Impurity 16
Difluprednate Impurity 16 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Synonyms: 6alpha,9-difluoro-11beta,21-dihydroxypregna-1,4,16-triene-3,20-dione21-acetate. CAS No. 2326-26-3. Molecular formula: C23H26F2O5. Mole weight: 420.45.
Difluprednate Impurity 17
Difluprednate Impurity 17 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. CAS No. 1296262-60-6. Molecular formula: C21H24F2O5. Mole weight: 394.41.
Difluprednate Impurity 2
Difluprednate Impurity 2 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Molecular formula: C27H35FO8. Mole weight: 506.56.
Difluprednate Impurity 3
Difluprednate Impurity 3 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Molecular formula: C27H34ClFO7. Mole weight: 525.00.
Difluprednate Impurity 4
Difluprednate Impurity 4 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Synonyms: 6α,9α-Difluoroprednisolone21-Butyrate. Grades: 98%. Molecular formula: C25H32F2O6. Mole weight: 466.51.
Difluprednate Impurity 5
Difluprednate Impurity 5 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Molecular formula: C27H34ClFO7. Mole weight: 525.00.
Difluprednate Impurity 8
Difluprednate Impurity 8 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Molecular formula: C27H34ClFO7. Mole weight: 525.00.
Difluprednate Impurity 9
Difluprednate Impurity 9 is an impurity of Difluprednate, which is shown to have anti-inflammatory activity. Molecular formula: C27H35FO8. Mole weight: 506.56.
Di-Fmoc-L-alpha,beta-diaminopropionic acid
Di-Fmoc-L-alpha,beta-diaminopropionic acid. Uses: Peptide synthesis. Additional or Alternative Names: Nα,Nβ-di-Fmoc-L-2,3-diaminopropionic acid, Fmoc-3-(Fmoc-amino)-L-alanine. Product Category: Amino Acids. CAS No. 201473-90-7. Molecular formula: C33H28N2O6. Mole weight: 548.6. Canonical SMILES: OC(=O)[C@H](CNC(=O)OCC1c2ccccc2-c3ccccc13)NC(=O)OCC4c5ccccc5-c6ccccc46. Product ID: ACM201473907. Alfa Chemistry ISO 9001:2015 Certified. Categories: Fmoc-Dap(Fmoc)-OH.
DiFMUP
DiFMUP. Uses: Designed for use in research and industrial production. Additional or Alternative Names: (6,8-difluoro-4-methyl-2-oxochromen-7-yl)dihydrogenphosphate. Product Category: Other Fluorophores. Appearance: Powder or solid. CAS No. 214491-43-7. Molecular formula: C10H7F2O6P. Mole weight: 292.13. Purity: ≥95%. IUPACName: (6,8-difluoro-4-methyl-2-oxochromen-7-yl)dihydrogenphosphate. Canonical SMILES: CC1=CC(=O)OC2=C(C(=C(C=C12)F)OP(=O)(O)O)F. Product ID: ACM214491437-1. Alfa Chemistry ISO 9001:2015 Certified. Categories: Difluprednate.
Difopein
Difopein has been found to be a 14.3.3 protein inhibitor and could induce apoptosis expressed in COS-7 and some cancer cells. Synonyms: Difopein; 396834-58-5; HB2038; AKOS024456954; C338H529N97O105S11; IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSR GKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQR PG. Grades: ≥95% by HPLC. CAS No. 396834-58-5. Molecular formula: C273H424N76O89S6. Mole weight: 6387.17.
Produces difructose anhydride by the reverse reaction of partial hydrolysis, forming an α-fructosidic linkage. Group: Enzymes. Synonyms: inulobiose hydrolase. Enzyme Commission Number: EC 3.2.1.134. CAS No. 121479-55-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3817; difructose-anhydride synthase; EC 3.2.1.134; 121479-55-8; inulobiose hydrolase. Cat No: EXWM-3817.
Diftalone
Diftalone. Uses: Designed for use in research and industrial production. Additional or Alternative Names: L 5418; Aladione; Diftalona [INN-Spanish]; Phthalazino<2,3-b>phthalazin-5,12(7H,14H)-dion; Diftalonum [INN-Latin]; phthalazino<2,3-b>phthalazine-5,12-(14H,7H)dione; DIFTALONE; Phthalazino[2,3-b]phthalazine-5,12(7H,14H)-dione; 7H,14H-phthalazin. Product Category: Heterocyclic Organic Compound. CAS No. 21626-89-1. Molecular formula: C16H12N2O2. Mole weight: 264.279 g/mol. Purity: 0.96. IUPACName: 5,12-dihydrophthalazino[3,2-b]phthalazine-7,14-dione. Canonical SMILES: C1C2=CC=CC=C2C(=O)N3N1C(=O)C4=CC=CC=C4C3. Density: 1.43g/cm³. ECNumber: 244-484-3. Product ID: ACM21626891. Alfa Chemistry ISO 9001:2015 Certified.
Difucosyllacto-N-hexaose (a) is an indispensable molecule widely employed in the biomedical sector due to its inherent therapeutic attributes. Its efficacy in tackling various ailments such as cancer and autoimmune disorders has been established through rigorous examination. Notably, this compound serves as an unrivaled asset in precise medical examinations elucidating individualized pharmacological targets. Synonyms: DFLNH (a); difucosyl-para-lacto-N-neo-hexaose; β -Gal-(1-4)[α -Fuc-(1-3)]-β -GlcNAc-(1-3)-β -Gal-(1-4)[α -Fuc(1-3)]-β -GlcNAc(1-3)-β -Gal-(1-4)-Glc; Fuc (a1-3)[Gal (b1-4)]GlcNAc (b1-3)Gal (b1-4)[Fuc (a1-3)]GlcNAc (b1-3)Gal (b1-4)Glc; 6-deoxy-alpha-L-galacto-hexopyranosyl-(1->3)-[beta-D-galacto-hexopyranosyl-(1->4)]-2-acetamido-2-deoxy-beta-D-gluco-hexopyranosyl-(1->3)-beta-D-galacto-hexopyranosyl-(1->4)-[6-deoxy-alpha-L-galacto-hexopyranosyl-(1->3)]-2-acetamido-2-deoxy-beta-D-gluco-hexopyranosyl-(1->3)-beta-D-galacto-hexopyranosyl-(1->4)-D-gluco-hexopyranose. Grades: ≥90%. CAS No. 64396-27-6. Molecular formula: C52H88N2O39. Mole weight: 1365.25.
Difucosyllacto-N-hexaose b
Difucosyllacto-N-hexaose b is an extraordinary biomedical marvel meticulously designed to study a plethora of ailments like microbial infections instigated by select bacteria and viruses. Synonyms: DFLNH (b); difuco-lacto-N-hexaose; Difucosyllacto-N-neohexaose II; D-Glucose, O-6-deoxy-α-L-galactopyranosyl-(1->3)-O-[β-D-galactopyranosyl-(1->4)]-O-2-(acetylamino)-2-deoxy-β-D-glucopyranosyl-(1->6)-O-[O-6-deoxy-α-L-galactopyranosyl-(1->4)-O-[β-D-ga lactopyranosyl-(1->3)]-2-(acetylamino)-2-deoxy-β-D-glucopyranosyl-(1->3)]-O-β-D-galactopyranosyl-(1->4)-. Grades: ≥95%. CAS No. 98359-76-3. Molecular formula: C52H88N2O39. Mole weight: 1365.25.
Difucosyllacto-N-hexaose (b)
Difucosyllacto-N-hexaose (b) is a compound widely employed sector, used for studying a plethora of afflictions, including cancer and viral infections. As an adjuvant, this compound exerts its influence by amplifying the immune response, thus rendering it indispensable in the realm of drug discovery for immunotherapy and vaccine formulation. Synonyms: DFLNH (b); Cluster Lewis x-Lewis a octasaccharide branched. Molecular formula: C52H88N2O39. Mole weight: 1365.25.
Difucosyllacto-N-hexaose (c)
Difucosyllacto-N-hexaose (c) is a compound skillfully targeting select proteins implicated in cellular adhesion, rendering it extensively employed in the research of anti-inflammatory and anti-infective therapeutic advancements. Synonyms: DFLNH (c); Lewis b octasaccharide branched; O-6-Deoxy-alpha-L-galactopyranosyl-(1?2)-O-beta-D-galactopyranosyl-(1?3)-O-[6-deoxy-alpha-L-galactopyranosyl-(1?4)]-O-2-(acetylamino)-2-deoxy-beta-D-glucopyranosyl-(1?3)-O-[O-beta-D-galactopyranosyl-(1?4)-2-(acetylamino)-2-deoxy-beta-D-glucopyranosyl-(1?6)]-O-beta-D-galactopyranosyl-(1?4)-D-glucose. Grades: 95%. CAS No. 443361-17-9. Molecular formula: C52H88N2O39. Mole weight: 1365.25.
Difucosyllacto-N-neohexaose 1
Difucosyllacto-N-neohexaose 1 is an extraordinary compound, acting as a palpable immunostimulant. It potently invigorates the body's intrinsic protective mechanisms, resolutely mounting a formidable defense against the relentless invasion of malignant cells. Synonyms: DFLNnH; Cluster Lewis x octasaccharide branched. CAS No. 178555-60-7. Molecular formula: C52H88N2O39. Mole weight: 1365.25.
Difucosyllacto-N-neohexaose I
Difucosyl-lacto-N-neohexaose I is a remarkable compound, exhibiting immense promise in research of inflammation, immunological aberrations and even malignant neoplasms. Molecular formula: C52H88N2O39. Mole weight: 1365.25.
Difucosyllacto-N-tetraose
Difucosyl-para-lacto-N-hexaose-APD-HSA
Difucosyl-para-lacto-N-hexaose I
Difucosyl-para-lacto-N-hexaose I is an indispensable constituent forged from fucosylated oligosaccharides. Displaying an extraordinary configuration, Difucosyl-para-lacto-N-hexaose I finds applicability in the research of sundry afflictions such as cancer and autoimmune maladies. Synonyms: Lewis b octasaccharide linear; DFpLNH. Molecular formula: C53H91N2O38. Mole weight: 1364.28.
Difucosyl-para-lacto-N-hexaose II
Difucosyl-para-lacto-N-hexaose II, a highly promising biomedicine, stands at the forefront of diverse disease treatments. Showcasing its prowess, this potent compound exhibits immense potential in honing in on selective receptors implicated in cancer metastasis, thus paving the way for the advancement of targeted therapeutic approaches. Moreover, its indispensability arises from its pivotal role in modulating immune responses, offering efficacious treatment to autoimmune maladies. Synonyms: DFpLNH II; Dimeric Lewis a-Lewis x octasaccharide linear. Grades: ≥95%. CAS No. 64309-01-9. Molecular formula: C52H88N2O39. Mole weight: 1365.25.
Difucosyl-para-lacto-N-hexaose III
Difucosyl-para-lacto-N-neohexaose
Difucosyl-para-lacto-N-neohexaose is an innovative compound product renowned for its extraordinary affinity for selectin receptors that renders it a potent modifier of cell adhesion. Synonyms: DFpLNnH. Grades: ≥85%. Molecular formula: C53H91N2O38. Mole weight: 1364.28.
Difurfuryl Disulfide
Difurfuryl Disulfide. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 1,2-Bis(furan-2-ylmethyl)disulfane. Product Category: Furans. CAS No. 4437-20-1. Molecular formula: C10H10O2S2. Mole weight: 226.3. Purity: 98%+. IUPACName: 2-[(Furan-2-ylmethyldisulfanyl)methyl]furan. Canonical SMILES: C1=COC(=C1)CSSCC2=CC=CO2. Density: 1.233 g/mL at 25 °C(lit.). Product ID: ACM4437201. Alfa Chemistry ISO 9001:2015 Certified.
Difurfuryl Ether
Difurfuryl Ether. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 2,2'-(thiodimethylene) Difuran; 2-Furfuryl Monosulfide; Difurfuryl Monosulfide. Product Category: Furans. CAS No. 4437-22-3. Molecular formula: C10H10O3. Mole weight: 178.18. Purity: 0.99. Product ID: ACM4437223. Alfa Chemistry ISO 9001:2015 Certified.
Difurfuryl Sulfide
Difurfuryl Sulfide. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Furfuryl sulfide. Product Category: Furans. CAS No. 13678-67-6. Molecular formula: C10H10O2S. Mole weight: 194.25. Purity: 98%+. IUPACName: 2-(Furan-2-ylmethylsulfanylmethyl)furan. Canonical SMILES: C1=COC(=C1)CSCC2=CC=CO2. Density: 1.108 g/mL at 25 °C(lit.). Product ID: ACM13678676. Alfa Chemistry ISO 9001:2015 Certified.
Difuro[3,4-b:3',4'-d]furan-1,3,5,7-tetrone,tetrahydro-. CAS No: 25574-69-0
Sarchem Laboratories New Jersey NJ
Difurylpropane
Difurylpropane. Group: Polymers.
DIG-11-ddUTP
DIG-11-ddUTP is a novel deoxyuridine triphosphate (dUTP) derivative, serving as a prodigious tool in biomedical exploration for DNA labeling. Widely applicable in cutting-edge methodologies including fluorescence in situ hybridization (FISH) and Southern blotting, this sophisticated compound enables precise detection of specialized DNA sequences and gene expression patterns. Synonyms: Digoxigenin-3-O-methylcarbonyl-ε-aminocaproyl-[5-(3-aminopropargyl) -2',3'-dideoxyuridine-5'-triphosphate], Triethylammoniumsalt. Grades: ≥ 95% by HPLC. Molecular formula: C43H63N4O20P3 (free acid). Mole weight: 1048.90 (free acid).
DIG-11-dUTP
DIG-11-dUTP is an esteemed nucleotide analogue, adroitly employed for the purpose of DNA and RNA labeling. Employing this avant-garde compound alongside sophisticated methodologies including in situ hybridization and polymerase chain reaction (PCR) decidedly furnishes the remarkable ability to scrutinize distinctive nucleic acid sequences. Synonyms: Digoxigenin-X-5-aminoallyl-2'-deoxyuridine-5'-triphosphate, Triethylammonium salt. Grades: ≥ 95% by HPLC. Molecular formula: C43H65N4O21P3 (free acid). Mole weight: 1066.91 (free acid).
DIG-11-UTP
DIG-11-UTP is a modified nucleotide used in biomedical research for the incorporation of digoxigenin (DIG) labels into RNA molecules during transcription. This versatile product allows specific detection and localization of RNA in various applications, including in situ hybridization, Northern blotting and RT-PCR analysis. Synonyms: Digoxigenin-X-5-aminoallyl-uridine-5'-triphosphate, Triethylammonium salt. Grades: ≥ 95% by HPLC. Molecular formula: C43H65N4O22P3 (free acid). Mole weight: 1082.92 (free acid).
Digadolinium oxide silicate
Digadolinium oxide silicate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Digadolinium oxide silicate, EINECS 235-386-1, 12207-95-3. Product Category: Heterocyclic Organic Compound. CAS No. 12207-95-3. Molecular formula: Gd2O5Si. Mole weight: 422.582500 [g/mol]. Purity: 0.96. IUPACName: dioxido(oxo)silane; gadolinium(3+); oxygen(2-). Canonical SMILES: [O-2].[O-2].[O-][Si](=O)[O-].[Gd+3].[Gd+3]. ECNumber: 235-386-1. Product ID: ACM12207953. Alfa Chemistry ISO 9001:2015 Certified.
Digadolinium trimagnesium dodecanitrate
Digadolinium trimagnesium dodecanitrate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: EINECS 283-612-2, Digadolinium trimagnesium dodecanitrate, 84682-75-7. Product Category: Heterocyclic Organic Compound. CAS No. 84682-75-7. Molecular formula: Gd2Mg3N12O36. Mole weight: 1131.473800 [g/mol]. Purity: 0.96. IUPACName: trimagnesium gadolinium(3+) dodecanitrate. Canonical SMILES: [N+](=O)([O-])[O-].[N+](=O)([O-])[O-].[N+](=O)([O-])[O-].[N+](=O)([O-])[O-].[N+](=O)([O-])[O-].[N+](=O)([O-])[O-].[N+](=O)([O-])[O-].[N+](=O)([O-])[O-].[N+](=O)([O-])[O-].[N+](=O)([O-])[O-].[N+](=O)([O-])[O-].[N+](=O)([O-])[O-].[Mg+2].[Mg+2].[Mg+2].[Gd+3].[Gd+3]. ECNumber: 283-612-2. Product ID: ACM84682757. Alfa Chemistry ISO 9001:2015 Certified.
Digalactosylceramide
Digalactosylceramide is a cutting-edge compound, demonstrating prodigious potential for studying a plethora of intricate neurologic afflictions. As a paramount glycosphingolipid, it adeptly augments myelin synthesis within the central nervous system, promulgating neuronal rejuvenation. Synonyms: Galabiosylceramide; 1-O-(4-O-a-D-Galactopyranosyl-b-D-galactopyranosyl)?-ceramide. Grades: 98%. CAS No. 217635-91-1. Molecular formula: C46H87NO13. Mole weight: 862.18.
Digalactosyldiacylglycerol - 10mg/ml in Chloroform-Methanol
Digalactosyldiacylglycerol is a bioactive compound abundant in green plants, emerging as a pivotal player in the intricate realm of photosynthesand lipid metabolism. Synonyms: 1,2-diacyl-3-O-[(a-D-galactosyl(1-6)-b-D-galactosyl]-sn-glycerol; DGDG. CAS No. 1531639-03-8. Molecular formula: C51H84O15. Mole weight: 937.20.
digalactosyldiacylglycerol synthase
Requires Mg2+. Diacylglycerol cannot serve as an acceptor molecule for galactosylation as in the reaction catalysed by EC 2.4.1.46, monogalactosyldiacylglyerol synthase. When phosphate is limiting, phospholipids in plant membranes are reduced but these are replaced, at least in part, by the glycolipids digalactosyldiacylglycerol (DGDG) and sulfoquinovosyldiacylglycerol. While both DGD1 and DGD2 are increased under phosphate-limiting conditions, DGD2 does not contribute significantly under optimal growth conditions. DGD2 is responsible for the synthesis of DGDG molecular species that are rich in C16 fatty acids at sn-1 of diacylglycerol whereas DGD1 leads to molecular specie...tose:MGDG galactosyltransferase; UDP-galactose:3-(β-D-galactosyl)-1,2-diacyl-sn-glycerol 6-α-galactosyltransferase. Enzyme Commission Number: EC 2.4.1.241. CAS No. 69913-00-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2470; digalactosyldiacylglycerol synthase; EC 2.4.1.241; 69913-00-4; DGD1; DGD2; DGDG synthase (ambiguous); UDP-galactose-dependent DGDG synthase; UDP-galactose-dependent digalactosyldiacylglycerol synthase; UDP-galactose:MGDG galactosyltransferase; UDP-galactose:3-(β-D-galactosyl)-1,2-diacyl-sn-glycerol 6-α-galactosyltransferase. Cat No: EXWM-2470.
Digalactosyl diglyceride
Digalactosyl diglyceride, a multifunctional biomedicine agent, manifests indispensable significance in the intricate domain of disease amelioration. Functioning as a prominent lipophilic compound, it exerts profound influence on the intricate network of cellular communication and membrane architecture. By intricately modulating specific enzymatic and receptor-mediated machinery, Digalactosyl diglyceride emerges as an auspicious therapeutic entity, exhibiting potential in the broad spectrum of disorders. Synonyms: Digalactosyl diglyceride; EINECS 296-281-4; Glycerides, C12-24 and C12-24-unsatd. di-, digalactosyl; (2R,3R,4S,5R)-2-(hydroxymethyl)-6-[3-[3-[(3R,4S,5R,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxypropoxy]propoxy]oxane-3,4,5-triol; (2R,2'R,3R,3'R,4S,4'S,5R,5'R)-6,6'-(3,3'-oxybis(propane-3,1-diyl)bis(oxy))bis(2-(hydroxymethyl)tetrahydro-2H-pyran-3,4,5-triol). CAS No. 92457-02-8. Molecular formula: C18H34O13. Mole weight: 458.45.
Digalacturonic acid
Digalacturonic acid. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Digalacturonate, Digalacturonic acid, CID439694, C02273, 5894-59-7. Product Category: Heterocyclic Organic Compound. CAS No. 5894-59-7. Molecular formula: C12H18O13. Mole weight: 370.26. Purity: 0.96. IUPACName: (2S,3R,4S,5R,6S)-6-[(2S,3R,4R,5R)-2-carboxy-4,5,6-trihydroxyoxan-3-yl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid. Canonical SMILES: C1(C(C(OC(C1O)OC2C(C(C(OC2C(=O)O)O)O)O)C(=O)O)O)O. Density: 1.97 g/cm³. Product ID: ACM5894597. Alfa Chemistry ISO 9001:2015 Certified. Categories: D-Galacturonic acid.
Digalacturonic acid
Digalacturonic Acid is a biomedicine product used in the research of gastrointestinal disorders. It acts as a therapeutic agent for combating gastric ulcers and enhancing digestion. Digalacturonic Acid demonstrates anti-inflammatory properties and influences the gastric mucosal defense mechanism, making it an effective treatment option for conditions like gastritis and gastroesophageal reflux disease (GERD). Synonyms: Digalacturonic acid; 5894-59-7; Digalacturonate; C02273; AC1L97UT; alpha-D-galacturonosyl-(1->4)-D-galacturonate; SureCN13589989; SCHEMBL13589989; DTXSID10974440; CHEBI:141006; alpha-D-GalA-(1->4)-D-GalA; alpha-D-GalpA-(1->4)-D-GalpA; alpha-D-GalA-(1-->4)-D-GalA; MFCD00079142; 4-O-Hexopyranuronosylhexopyranuronic acid; 4-(alpha-D-glucopyranosyluronic acid)-D-glucuronic acid; 4-O-alpha-D-galactopyranuronosyl-D-galactopyranuronic acid; alpha-D-galactopyranuronosyl-(1->4)-D-galactopyranuronic acid; (2S,3R,4R,5R)-3-(((2S,3R,4S,5R,6S)-6-Carboxy-3,4,5-trihydroxytetrahydro-2H-pyran-2-yl)oxy)-4,5,6-trihydroxytetrahydro-2H-pyran-2-carboxylic acid; (2S,3R,4R,5R)-3-((2S,3R,4S,5R,6S)-6-carboxy-3,4,5-trihydroxytetrahydro-2H-pyran-2-yloxy)-4,5,6-trihydroxytetrahydro-2H-pyran-2-carboxylic acid; (2S,3R,4S,5R,6S)-6-[(2S,3R,4R,5R)-2-carboxy-4,5,6-trihydroxy-tetrahydropyran-3-yl]oxy-3,4,5-trihydroxy-tetrahydropyran-2-carboxylic acid. CAS No. 5894-59-7. Molecular formula: C12H18O13. Mole weight: 370.26.
Digallic acid
Digallic acid. Group: Biochemicals. Alternative Names: 3, 4-Dihydroxy-5-[ (3, 4, 5-trihydroxybenzoyl) oxy]benzoic acid; NSC 59263; m-Digallic acid. Grades: Highly Purified. CAS No. 536-08-3. Pack Sizes: 1mg, 2mg, 5mg, 10mg. Molecular Formula: C14H10O9. US Biological Life Sciences.
Worldwide
Digallium magnesium tetraoxide
Digallium magnesium tetraoxide. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Digallium magnesium tetraoxide, EINECS 235-059-3, 12064-13-0. Product Category: Heterocyclic Organic Compound. CAS No. 12064-13-0. Molecular formula: Ga2MgO4. Mole weight: 227.748600 [g/mol]. Purity: 0.96. IUPACName: digallium magnesium oxygen(2-). Canonical SMILES: [O-2].[O-2].[O-2].[O-2].[Mg+2].[Ga+3].[Ga+3]. ECNumber: 235-059-3. Product ID: ACM12064130. Alfa Chemistry ISO 9001:2015 Certified.
Diginatigenin
Diginatigenin is an impurity of Digoxin, which is a heart medication. Study indicates that digoxin acts as an inhibitor of HIF-1α synthesis, reduces protein levels and thus suppresses tumor growth in mice. Synonyms: diginatigenin; 559-57-9; UNII-BL7J6ZZ392; BL7J6ZZ392; 3beta,12beta,14,16beta-tetrahydroxy-5beta-card-20(22)-enolide; Card-20(22)-enolide, 3,12,14,16-tetrahydroxy-, (3beta,5beta,12beta,16beta)-; 3- [ (3S, 5R, 8R, 9S, 10S, 12R, 13S, 14S, 16S, 17R) -3, 12, 14, 16-tetrahydroxy-10, 13-dimethyl-1, 2, 3, 4, 5, 6, 7, 8, 9, 11, 12, 15, 16, 17-tetradecahydrocyclopenta [a]phenanthren-17-yl]-2H-furan-5-one; DIGINATIGENIN [MI]; SCHEMBL1516755; CHEBI:38095; DTXSID901024008; LMST01120002; Q27117372; CARD-20(22)-ENOLIDE, 3,12,14,16-TETRAHYDROXY-, (3.BETA.,5.BETA.,12.BETA.,16.BETA.)-. CAS No. 559-57-9. Molecular formula: C23H34O6. Mole weight: 406.51.