A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| Fibrin (Bovine) | Fibrinogen has been used in studies of haemostatic therapy in surgical and massive trauma patients. These studies have shown that fibrinogen may prove to be more superior in stopping blood loss when compared to using fresh frozen plasma (FFP). Group: Biochemicals. Alternative Names: Factor I. Grades: Molecular Biology Grade. CAS No. 9001-31-4. Pack Sizes: 1g. US Biological Life Sciences. |  Worldwide |
| Fibrinogen Binding Inhibitor Peptide | Fibrinogen Binding Inhibitor Peptide is a dodecapeptide (HHLGGAKQAGDV, H12), which is a fibrinogen γ-chain carboxy-terminal sequence (γ400-411). Fibrinogen Binding Inhibitor Peptide is a specific binding site of the ligand for activated glycoprotein (GP) IIb/IIIa. Uses: Scientific research. Group: Peptides. CAS No. 89105-94-2. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P1507. |  |
| Fibrinogen Binding Inhibitor Peptide | Fibrinogen Binding Inhibitor Peptide is an effective inhibitor of the binding of fibrinogen, fibronectin and von Willebrand factor to thrombin- or ADP-stimulated platelets. It is also a synthetic dodecapeptide that represents the specific platelet receptor recognition site for the human fibrinogen G-chain (residues 400-411). Synonyms: H-His-His-Leu-Gly-Gly-Ala-Lys-Gln-Ala-Gly-Asp-Val-OH; L-histidyl-L-histidyl-L-leucyl-glycyl-glycyl-L-alanyl-L-lysyl-L-glutaminyl-L-alanyl-glycyl-L-alpha-aspartyl-L-valine; fibrinogen-γ fragment 400-411. Grades: ≥95%. CAS No. 89105-94-2. Molecular formula: C50H80N18O16. Mole weight: 1189.28. |  |
| Fibrinogen-Binding Peptide | Fibrinogen-Binding Peptide (designed by the anti-complementarity hypothesis) is a presumptive peptide mimic of the vitronectin binding site on the fibrinogen receptor. It binds to fibrinogen and inhibits platelet adhesion to fibrinogen and platelet aggregation, as well as platelet adhesion to hyalonectin. Synonyms: H-EHIPA-OH; L-alpha-glutamyl-L-histidyl-L-isoleucyl-L-prolyl-L-alanine; N-(1-(N-(N-L-alpha-glutamyl-L-histidyl)-L-isoleucyl)-L-prolyl)-L-Alanine; EHIPA. Grades: ≥95%. CAS No. 137235-80-4. Molecular formula: C25H39N7O8. Mole weight: 565.62. | |
| Fibrinogen-Binding Peptide | Fibrinogen-Binding Peptide (designed by anticomplementarity hypothesis) is a presumptive peptide mimic of the vitronectin binding site on the fibrinogen receptor. Fibrinogen-Binding Peptide binds fibrinogen and inhibits both the adhesion of platelets to fibrinogen and platelet aggregation, and also inhibits the adhesion of platelets to vitronectin [1]. Uses: Scientific research. Group: Peptides. CAS No. 137235-80-4. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P1741. | |
| Fibrinogen-Binding Peptide butyl acetate | Fibrinogen-Binding Peptide (designed by the anti-complementarity hypothesis) is a presumptive peptide mimic of the vitronectin binding site on the fibrinogen receptor. It binds to fibrinogen and inhibits platelet adhesion to fibrinogen and platelet aggregation, as well as platelet adhesion to vitronectin. Synonyms: Fibrinogen-Binding Peptide (fb-acetate); H-Glu-His-Ile-Pro-Ala-OH butyl acetate; EHIPA butyl acetate; L-alpha-glutamyl-L-histidyl-L-isoleucyl-L-prolyl-L-alanine butyl acetate. Grades: ≥95%. Molecular formula: C31H51N7O10. Mole weight: 681.80. | |
| Fibrinogen (Bovine) | Fibrinogen (Bovine) is a selective proteolytic molecule that can be activated by thrombin to assemble fibrin clots. Fibrinogen can regulate the activation of NF-KB in endothelial cells and upregulate the expression of inflammatory chemokines MCP-1 and MCP-1. Fibrinogen plays a key role in blood clotting, thrombosis, atherosclerosis and the pathological development of venous grafts, and can be used in the study of blood clotting and vascular diseases [1] [2] [3]. Uses: Scientific research. Group: Biochemical assay reagents. CAS No. 9001-32-5. Pack Sizes: 50 mg; 100 mg. Product ID: HY-125864. | |
| Fibrinopeptide A, human | Fibrinopeptide A, human, located at the NH2-termini of the Aα chain, is a short peptide with 16 residues cleaved from fibrinogen by thrombin. Synonyms: Human fibrinopeptide A; H-Ala-Asp-Ser-Gly-Glu-Gly-Asp-Phe-Leu-Ala-Glu-Gly-Gly-Gly-Val-Arg-OH; L-alanyl-L-alpha-aspartyl-L-seryl-glycyl-L-alpha-glutamyl-glycyl-L-alpha-aspartyl-L-phenylalanyl-L-leucyl-L-alanyl-L-alpha-glutamyl-glycyl-glycyl-glycyl-L-valyl-L-arginine. Grades: ≥95%. CAS No. 25422-31-5. Molecular formula: C63H97N19O26. Mole weight: 1536.56. | |
| Fibrinopeptide A, human TFA | Fibrinopeptide A, human TFA is a 16-residue short polypeptide cleaved from fibrinogen by thrombin. Fibrinopeptide A, human locates at the NH 2 -termini of the Aα chain [1]. Uses: Scientific research. Group: Peptides. Alternative Names: Human fibrinopeptide A TFA. CAS No. 61533-47-9. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P1538A. | |
| Fibrinopeptide B | Synonyms: Fibrinopeptide B, human. Grades: >95%. CAS No. 36204-23-6. Molecular formula: C66H93N19O25. Mole weight: 1552.56. | |
| Fibrinopeptide b(human),1-L-glutamic acid-(9ci) | Heterocyclic Organic Compound. Alternative Names: GLU-GLY-VAL-ASN-ASP-ASN-GLU-GLU-GLY-PHE-PHE-SER-ALA-ARG;GLU-GLY-VAL-ASN-ASP-ASN-GLU-GLU-GLY-PHE-SER-ALA-ARG;(GLU1)-FIBRINOPEPTIDE B;[GLU1]-FIBRINOPEPTIDE B HUMAN;H-GLU-GLY-VAL-ASN-ASP-ASN-GLU-GLU-GLY-PHE-PHE-SER-ALA-ARG-OH. CAS No. 103213-49-6. Molecular formula: C66H95N19O26. Mole weight: 1570.57. Purity: 0.96. IUPACName: [Glu1]-Fibrinopeptide B. Canonical SMILES: CC (C)C (C (=O)NC (CC (=O)N)C (=O)NC (CC (=O)O)C (=O)NC (CC (=O)N)C (=O)NC (CCC (=O)O)C (=O)NC (CCC (=O)O)C (=O)NCC (=O)NC (CC1=CC=CC=C1)C (=O)NC (CC2=CC=CC=C2)C (=O)NC (CO)C (=O)NC (C)C (=O)NC (CCCNC (=N)N)C (=O)O)NC (=O)CNC (=O)C (CCC (=O)O)N. Density: 1.561 g/cm³. Catalog: ACM103213496. |  |
| Fibroblast Cell, 3T3/A31 | Cellular protein preparation from murine 3T3 fibroblasts. Group: Biologicals. Grades: Lysate. Pack Sizes: 50ul, 100ul. US Biological Life Sciences. | Worldwide |
| Fibroblast Cell, 3T3 L1 Adipocytes, Control Extract, LIF- | Fibroblast Cell, 3T3 L1 Adipocytes, Control Extract, LIF-. Group: Molecular Biology. Grades: Lysate. Pack Sizes: 80ul. US Biological Life Sciences. | Worldwide |
| Fibroblast Growth Factor | Fibroblast Growth Factors are a family of cell signalling proteins produced by macrophages, consisting of 23 members in humans. They have various functions so that is involved in multiple processes, regulating fundamental developmental pathways. Synonyms: FGF. | |
| FIBROBLAST GROWTH FACTOR-4 HUMAN RECOMBI | Heterocyclic Organic Compound. Alternative Names: FIBROBLAST GROWTH FACTOR-4 HUMAN RECOMBI;fibroblast growth factor-4 human*recombinant cell;FIBROBLAST GROWTH FACTOR-4, HUMAN RECOMB INANT, CELL CULTURE TESTED. CAS No. 123584-45-2. Catalog: ACM123584452. | |
| Fibroblastgrowth factor 7 (human clone 32/49 protein moiety reduced) (9CI) | Heterocyclic Organic Compound. CAS No. 126469-10-1. Catalog: ACM126469101. | |
| Fibroblast growthfactor, basic | Heterocyclic Organic Compound. CAS No. 106096-93-9. Catalog: ACM106096939. | |
| Fibroblast Growth Factor-Basic | Fibroblast Growth Factor-Basic is a growth factor encoded by the FGF2 gene. It is found in basement membranes and sub-endothelial extracellular matrix. FGF2 specifically binds to fibroblast growth factor receptor (FGFR) proteins. Synonyms: hBFGF; FGF-Basic; Basic fibroblast growth factor; bFGF. CAS No. 106096-93-9. | |
| FIBROBLAST GROWTH FACTOR, BASIC*FRAGMENT106-120 AC | Heterocyclic Organic Compound. CAS No. 114752-18-0. Molecular formula: C29H30N2O8. Mole weight: 534.5571;g/mol. Purity: 0.96. IUPACName: butan-2-yl7-(4-methoxyphenyl)-2-methyl-4-(6-nitro-1,3-benzodioxol-5-yl)-5-oxo-4,6,7,8-tetrahydro-1H-quinoline-3-carboxylate. Canonical SMILES: CCC (C)OC (=O)C1=C (NC2=C (C1C3=CC4=C (C=C3[N+] (=O)[O-])OCO4)C (=O)CC (C2)C5=CC=C (C=C5)OC)C. Catalog: ACM114752180. | |
| Fibroblast Transfection Kit | Transfection Reagent for Fibroblast Cell Lines and Primary Fibroblasts. Optimized transfection protocol provided for transfection of siRNA, DNA, mRNA, and microRNA. Transfection Reagents. Transfection Enhancer. Complex Condenser. Uses: Transfection of DNA, RNA, protein and small molecules. Product ID: 1756. |  Nevada, Texas, USA |
| fibrolase | A 23-kDa, non-hemorrhagic enzyme from the venom of the southern copperhead snake (Agkistrodon contortix contortix). In peptidase family M12 (astacin family). Group: Enzymes. Synonyms: fibrinolytic proteinase; Agkistrodon contortrix contortrix metalloproteinase; Agkistrodon contortrix contortrix venom metalloproteinase. Enzyme Commission Number: EC 3.4.24.72. CAS No. 116036-70-5. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4356; fibrolase; EC 3.4.24.72; 116036-70-5; fibrinolytic proteinase; Agkistrodon contortrix contortrix metalloproteinase; Agkistrodon contortrix contortrix venom metalloproteinase. Cat No: EXWM-4356. |  |
| Fibronectin | Fibronectin, a glycoprotein present in blood as well as in cells, is a biomarker of tissue injury. Fibronectin binds to membrane-spanning receptor proteins called integrins. Fibronectin also binds to other extracellular matrix proteins such as collagen, fibrin, and heparan sulfate proteoglycans [1]. Uses: Scientific research. Group: Natural products. CAS No. 86088-83-7. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P3160. | |
| Fibronectin adhesion-promoting peptide | Heterocyclic Organic Compound. CAS No. 125720-21-0. Molecular formula: C47H74N16O10. Mole weight: 1023.19. Catalog: ACM125720210. | |
| Fibronectin Adhesion-promoting Peptide | It is a heparin-binding amino acid sequence found in the heparin-binding domain at the carboxy-terminal of fibronectin. Synonyms: Heparin Binding Peptide; H-Trp-Gln-Pro-Pro-Arg-Ala-Arg-Ile-OH; L-tryptophyl-L-glutaminyl-L-prolyl-L-prolyl-L-arginyl-L-alanyl-L-arginyl-L-isoleucine. Grades: ≥97% by HPLC. CAS No. 125720-21-0. Molecular formula: C47H74N16O10. Mole weight: 1023.19. | |
| Fibronectin Adhesion-promoting Peptide acetate | It is a heparin-binding amino acid sequence found in the heparin-binding domain at the carboxy-terminal of fibronectin. Synonyms: Heparin Binding Peptide acetate. Molecular formula: C49H78N16O12. Mole weight: 1083.25. | |
| Fibronectin-binding protein peptide d3 | Heterocyclic Organic Compound. Alternative Names: FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPK V; FIBRONECTIN-BINDING PROTEIN;FIBRONECTIN BINDING PROTEIN PEPTIDE;FIBRONECTIN-BINDING PROTEIN PEPTIDE D3;H-PHE-ASN-LYS-HIS-THR-GLU-ILE-ILE-GLU-GLU-ASP-THR-ASN-LYS-ASP-LYS-PRO-SER-TYR-GLN-PHE-GLY-GLY-HIS-ASN-SER-VAL-ASP. CAS No. 119977-20-7. Molecular formula: C190H283N49O66. Catalog: ACM119977207. | |
| Fibronectin CS1 Peptide | Fibronectin CS1 Peptide lacks a domain containing Arg-Gly-Asp, and it can effectively inhibit tumor metastasis in both spontaneous and experimental metastatic models. Synonyms: Fibronectin CS-1 Fragment (1978-1985); H-Glu-Ile-Leu-Asp-Val-Pro-Ser-Thr-OH; L-alpha-glutamyl-L-isoleucyl-L-leucyl-L-alpha-aspartyl-L-valyl-L-prolyl-L-seryl-L-threonine; (3S,6S,9S,12S,15S)-15-amino-12-sec-butyl-3-((S)-2-((S)-1-((1S,2R)-1-carboxy-2-hydroxypropylamino)-3-hydroxy-1-oxopropan-2-ylcarbamoyl)pyrrolidine-1-carbonyl)-6-(carboxymethyl)-9-isobutyl-2-methyl-5,8,11,14-tetraoxo-4,7,10,13-tetraazaoctadecan-18-oic acid. Grades: ≥95%. CAS No. 136466-51-8. Molecular formula: C38H64N8O15. Mole weight: 872.96. | |
| Fibronectin CS1 Peptide acetate | Fibronectin CS1 Peptide lacks a domain containing Arg-Gly-Asp, and it can effectively inhibit tumor metastasis in both spontaneous and experimental metastatic models. Synonyms: H-Glu-Ile-Leu-Asp-Val-Pro-Ser-Thr-OH.CH3CO2H; L-alpha-glutamyl-L-isoleucyl-L-leucyl-L-alpha-aspartyl-L-valyl-L-prolyl-L-seryl-L-threonine acetic acid. Grades: ≥95%. CAS No. 2760881-56-7. Molecular formula: C40H68N8O17. Mole weight: 933.01. | |
| Fibronectin type iii connecting segment fragment 90 | Heterocyclic Organic Compound. CAS No. 107978-81-4. Molecular formula: C107H158N28O34. Mole weight: 2380.57. Purity: 0.96. Catalog: ACM107978814. | |
| Fibrostatin A | Fibrostatin A is a proline hydroxylase inhibitor produced by Strptomyces catenulae. Synonyms: L-Cysteine, N-acetyl-S-((5,8-dihydro-1-hydroxy-3-methoxy-7-methyl-5,8-dioxo-2-naphthalenyl)methyl)-. CAS No. 91776-42-0. Molecular formula: C18H19NO7S. Mole weight: 393.41. | |
| Fibrostatin B | Fibrostatin B is a proline hydroxylase inhibitor produced by Strptomyces catenulae. Synonyms: L-Cysteine, N-acetyl-S-((5,8-dihydro-1-hydroxy-3,6-dimethoxy-7-methyl-5,8-dioxo-2-naphthalenyl)methyl)-. CAS No. 91776-48-6. Molecular formula: C19H21NO8S. Mole weight: 423.44. | |
| Fibrostatin C | Fibrostatin C is a proline hydroxylase inhibitor produced by Strptomyces catenulae. Synonyms: N-Acetyl-S-((5,8-dihydro-1-hydroxy-3,6-dimethoxy-5,8-dioxo-2-naphthalenyl)methyl)-L-cysteine. Grades: >98%. CAS No. 91776-47-5. Molecular formula: C18H19NO8S. Mole weight: 409.41. | |
| Fibrostatin D | Fibrostatin D is a proline hydroxylase inhibitor produced by Strptomyces catenulae. Synonyms: L-Cysteine, N-acetyl-S-((5,8-dihydro-1,3-dihydroxy-6-methoxy-7-methyl-5,8-dioxo-2-naphthalenyl)methyl)-. CAS No. 91776-46-4. Molecular formula: C18H19NO8S. Mole weight: 409.41. | |
| Fibrostatin E | Fibrostatin E is a proline hydroxylase inhibitor produced by Strptomyces catenulae. Synonyms: L-Cysteine, N-acetyl-S-((5,8-dihydro-1-hydroxy-7-(hydroxymethyl)-3-methoxy-5,8-dioxo-2-naphthalenyl)methyl)-. CAS No. 91776-44-2. Molecular formula: C18H19NO8S. Mole weight: 409.41. | |
| Fibrostatin F | Fibrostatin F is a proline hydroxylase inhibitor produced by Strptomyces catenulae. Synonyms: L-Cysteine, N-acetyl-S-((5,8-dihydro-3,6-dimethoxy-5,8-dioxo-1-hydroxy-7-(hydroxymethyl)-2-naphthalenyl)methyl)-. CAS No. 91776-45-3. Molecular formula: C19H21NO9S. Mole weight: 439.44. | |
| ficain | The major proteolytic component of the latex of fig, Ficus glabrata. Cysteine endopeptidases with similar properties are present in other members of the large genus Ficus. In peptidase family C1 (papain family). Group: Enzymes. Synonyms: ficin; debricin; higueroxyl delabarre. Enzyme Commission Number: EC 3.4.22.3. CAS No. 9001-33-6. Ficin. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4204; ficain; EC 3.4.22.3; 9001-33-6; ficin; debricin; higueroxyl delabarre. Cat No: EXWM-4204. | |
| Ficain | Ficain is an enzyme extract composed of several proteases that can be isolated from Ficus hispida L. and the latex of fig ( Ficus carica ). Ficain has different specificities in different proportions during fruit ripening. Ficain is widely used in protein hydrolysis, food, production of bioactive peptides and antibody fragments [1] [2]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: Ficin. CAS No. 9001-33-6. Pack Sizes: 1 g. Product ID: HY-P3028. | |
| Ficellomycin | Ficellomycin is a peptide antibiotic produced by Streptomyces ficellus. Activity against gram-positive bacteria. Synonyms: Antibiotic U 47929. Grades: >98%. CAS No. 59458-27-4. Molecular formula: C13H24N6O3. Mole weight: 312.37. | |
| Ficin | Ficin. Group: Molecular Biology. CAS No. 9001-33-6. Pack Sizes: 25g. US Biological Life Sciences. | Worldwide |
| Ficin froM Fig Tree Latex | Ficin froM Fig Tree Latex. Synonyms: E.C. 3.4.4.12;FIG TREE LATEX;FICIN;EC 3.4.22.3;EC: 3.4.22.3;DIGEST-ALL(TM) 1;FICIN,POWDER;Ficin Agarose from fig tree latex. CAS No. 9001-33-6. Pack Sizes: 1 g. Product ID: CDF4-0051. Category: Enzyme Preparations. Product Keywords: Food Ingredients; Enzyme Preparations; Ficin froM Fig Tree Latex; CDF4-0051; 9001-33-6; 9001-33-6; 9001-33-6. Purity: 0.99. Color: tan. EC Number: 9001-33-6. Physical State: Suspension. Storage: -20°C. |  |
| Ficlatuzumab | Ficlatuzumab is a monoclonal antibody (McAb) targeting human hepatocyte growth factor ( HGF ). Ficlatuzumab blocks the activation of the HGF/c-Met signaling pathway, and inhibits c-Met receptor-mediated cancer cell proliferation, migration, and invasion [1]. Uses: Scientific research. Group: Inhibitory antibodies. CAS No. 1174900-84-5. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P99196. | |
| Ficlatuzumab | Ficlatuzumab is a humanized monoclonal antibody that binds to hepatocyte growth factor (HGF), resulting in inhibtion of c-Met signaling pathway. Ficlatuzumab has been approved for the treatment of head and neck cancer. CAS No. 1174900-84-5. | |
| Ficoll ® 400 | 25g Pack Size. Group: Analytical Reagents, Carbohydrates, Diagnostic Raw Materials. Formula: [C12H22O11. C3H5ClO]n. CAS No. 26873-85-8. Prepack ID 24153174-25g. Molecular Weight ca 400,000. See USA prepack pricing. |  |
| Ficonalkib | Ficonalkib is a potent inhibitor of Anaplastic lymphoma kinase (ALK) , the tyrosine kinase receptor. Ficonalkib, can be used as an antineoplastic agent [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2233574-95-1. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-152845. | |
| FICT-FF-FMK | FICT-FF-FMK is a fluorescein isothiocyanate (FITC)-conjugated inhibitor of cathepsin B and cathepsin L, which can be used for detecting cathepsin B and cathepsin L in live cells. Synonyms: FICT-Phe-Phe-FMK; FICT-Phe-Phe-Fluoromethylketone. Grades: >95%. Molecular formula: C41H34FN3O6S. Mole weight: 715.80. | |
| FICZ | High affinity aryl hydrocarbon receptor (AhR) agonist (Kd = 70 p M). Proposed to be an endogenous AhR ligand. Induces transient expression of cytochrome P450-1A1 (CYP1A1) in vitro. Synonyms: Indolo[3,2-b]carbazole-6-carboxaldehyde, 5,11-dihydro-; 5,11-Dihydroindolo[3,2-b]carbazole-6-carboxaldehyde; 6-Formylindolo[3,2-b]carbazole. Grades: >98%. CAS No. 172922-91-7. Molecular formula: C19H12N2O. Mole weight: 284.31. | |
| FICZ | FICZ. Group: Biochemicals. Grades: Purified. CAS No. 172922-91-7. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| Fidarestat | Fidarestat is a aldose reductase inhibitor originated by Sanwa Kagaku Kenkyusho. It was very effective in significantly alleviating some symptoms of diabetic polyneuropathy. Long-term treatment with SNK-860 has a beneficial preventive effect on the development of experimental diabetic neuropathy. In addition, Fidarestat is also a promising drug targeting autophagy in Colorectal Carcinoma. Uses: Diabetic neuropathies. Synonyms: SNK860; SNK-860; SNK 860; SK860; SK-860; SK 860; Fidarestat; Aldos. (2S,4S)-6-fluoro-2',5'-dioxospiro[chromane-4,4'-imidazolidine]-2-carboxamide; Aldos;SNK 860. Grades: 98%. CAS No. 136087-85-9. Molecular formula: C12H10FN3O4. Mole weight: 279.23. | |
| Fidarestat | Fidarestat (SNK 860) is an inhibitor of aldose reductase , with IC 50 s of 26 nM, 33 μM, and 1.8 μM for aldose reductase, AKR1B10 and V301L AKR1B10, respectively; Fidarestat (SNK 860) has the potential to treat diabetic disease. Uses: Scientific research. Group: Signaling pathways. Alternative Names: SNK 860. CAS No. 136087-85-9. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg. Product ID: HY-105185. | |
| Fidaxomicin | 100mg Pack Size. Group: Antibiotics, Bioactive Small Molecules, Research Organics & Inorganics. Formula: C52H74Cl2O18. CAS No. 873857-62-6. Prepack ID 90018462-100mg. Molecular Weight 1058.04. See USA prepack pricing. | |
| Fidaxomicin | Fidaxomicin (OPT-80), a macrocyclic antibiotic , is an orally active and potent RNA polymerase inhibitor. Fidaxomicin has a narrow spectrum of antibacterial activity and a good anti- Clostridium difficile activity (MIC 90 =0.12?μg/mL). Fidaxomicin can be used for Clostridium difficile infection (CDI) research [1] [2] [3]. Uses: Scientific research. Group: Natural products. Alternative Names: OPT-80; PAR-101. CAS No. 873857-62-6. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-17580. | |
| Fidaxomicin-d7 | A labeled macrocyclic antibiotic. A non-systemic, bactericidal used to treat Clostridium difficile infections. Group: 2h labeled compounds. CAS No. 873857-62-6. Molecular formula: C52H67D7Cl2O18. Mole weight: 1065.08. Catalog: ACM873857626. | |
| Fidaxomicin Impurity 4 | Fidaxomicin Impurity 4. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: (2R,3S,4S,5S,6R)-6-(((3E,5E,8S,9E,11S,12R,13E,15E,18S)-11-ethyl-8,12-dihydroxy-18-((R)-1-hydroxyethyl)-9,13,15-trimethyl-2-oxooxacyclooctadeca-3,5,9,13,15-pentaen-3-yl)methoxy)-4-hydroxy-5-methoxy-2-methyltetrahydro-2H-pyran-3-yl 3,5-dichloro-2-ethyl-4,6-dihydroxybenzoate. Molecular Formula: C41H56Cl2O13. Mole Weight: 826.31. Catalog: APB06319. |  |
| Fidaxomicin Impurity 5 | Fidaxomicin Impurity 5. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: (2R,3S,4S,5S,6R)-6-(((3E,5E,9E,11S,12R,13E,15E,18S)-12-(((2R,3S,4R,5S)-3,4-dihydroxy-5-(isobutyryloxy)-6,6-dimethyltetrahydro-2H-pyran-2-yl)oxy)-11-ethyl-18-((R)-1-hydroxyethyl)-9,13,15-trimethyl-2,8-dioxooxacyclooctadeca-3,5,9,13,15-pentaen-3-yl)methoxy)-4-hydroxy-5-methoxy-2-methyltetrahydro-2H-pyran-3-yl 3,5-dichloro-2,4-dihydroxy-6-methylbenzoate. Molecular Formula: C51H70Cl2O18. Mole Weight: 1040.39. Catalog: APB06320. | |
| Fidaxomicin Impurity 6 | Fidaxomicin Impurity 6. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: (2R,3S,4S,5S,6R)-6-(((3E,5E,9E,11S,12R,13E,15E,18S)-12-(((2R,3S,4R,5S)-3,4-dihydroxy-5-(isobutyryloxy)-6,6-dimethyltetrahydro-2H-pyran-2-yl)oxy)-11-ethyl-18-((R)-1-hydroxyethyl)-9,13,15-trimethyl-2-oxooxacyclooctadeca-3,5,9,13,15-pentaen-3-yl)methoxy)-4-hydroxy-5-methoxy-2-methyltetrahydro-2H-pyran-3-yl 3,5-dichloro-2-ethyl-4,6-dihydroxybenzoate. Molecular Formula: C52H74Cl2O17. Mole Weight: 1040.43. Catalog: APB06318. | |
| Fidaxomicin Impurity 7 | Fidaxomicin Impurity 7. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: (2R,3S,4S,5S,6R)-6-(((3E,5E,8S,9E,11S,12R,13E,15E,18S)-12-(((2R,3S,4S,5S)-3,5-dihydroxy-4-(isobutyryloxy)-6,6-dimethyltetrahydro-2H-pyran-2-yl)oxy)-11-ethyl-8-hydroxy-18-((R)-1-hydroxyethyl)-9,13,15-trimethyl-2-oxooxacyclooctadeca-3,5,9,13,15-pentaen-3-yl)methoxy)-4-hydroxy-5-methoxy-2-methyltetrahydro-2H-pyran-3-yl 3,5-dichloro-2-ethyl-4,6-dihydroxybenzoate. CAS No. 106008-69-9. Molecular Formula: C52H74Cl2O18. Mole Weight: 1056.43. Catalog: APB106008699. | |
| Fidaxomicin Impurity 8 | Fidaxomicin Impurity 8. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: (2R,3S,4S,5S,6R)-6-(((3E,5E,8S,9E,11S,12R,13E,15E,18S)-12-(((2R,3S,4R,5S)-3,4-dihydroxy-5-(isobutyryloxy)-6,6-dimethyltetrahydro-2H-pyran-2-yl)oxy)-11-ethyl-8-hydroxy-18-((R)-1-hydroxyethyl)-9,13,15-trimethyl-2-oxooxacyclooctadeca-3,5,9,13,15-pentaen-3-yl)methoxy)-4-hydroxy-5-methoxy-2-methyltetrahydro-2H-pyran-3-yl 3,5-dichloro-2,4-dihydroxy-6-methylbenzoate. Molecular Formula: C51H72Cl2O18. Mole Weight: 1042.41. Catalog: APB06317. | |
| Fidaxomicin Impurity 9 | Fidaxomicin Impurity 9. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: (2R,3S,4S,5S,6R)-6-(((3E,5E,8S,9E,11S,12R,13E,15E,18S)-12-(((2R,3S,4R,5S)-3,4-dihydroxy-5-(isobutyryloxy)-6,6-dimethyltetrahydro-2H-pyran-2-yl)oxy)-11-ethyl-8-hydroxy-18-((R)-1-hydroxyethyl)-9,13,15-trimethyl-2-oxooxacyclooctadeca-3,5,9,13,15-pentaen-3-yl)methoxy)-4-hydroxy-5-methoxy-2-methyltetrahydro-2H-pyran-3-yl 3,5-dichloro-2,4-dihydroxy-6-isopropylbenzoate. Molecular Formula: C53H76Cl2O18. Mole Weight: 1070.44. Catalog: APB06316. | |
| Fidaxomicin (Lipiarmycin) | Fidaxomicin is a non-absorbed macrocyclic antibiotic, and is the first antimicrobial to be approved by the FDA for the treatment of Clostridium difficile infection (CDI) in 20 years. Fidaxomicin works by inhibiting sporulation by CDI, sustaining clinical response and reducing recurrences of this pathogen. Group: Biochemicals. Alternative Names: 3E, 5E, 8S, 9E, 11S, 12R, 13E, 15E, 18S)-3-[[[6-Deoxy-4-O-(3, 5-dichloro-2-ethyl-4, 6-dihydroxybenzoyl)-2-O-methyl- β -D-mannopyranosyl] oxy] methyl] -12- [ [6-deoxy-5-C-methyl-4-O- (2-methyl-1-oxopropyl) - β-D-lyxo-hexopyranosyl]oxy]-11-ethyl-8-hydroxy-18-[(1R)-1-hydroxyethyl]-9,13,15-trimethyl-oxacyclooctadeca-3,5,9,13,15-pentaen-2-one; Clostomicin B1; Dificid; Dificlir; Fidaxomicin; Fidaxomycin; Lipiarmicin; Lipiarmycin; Lipiarmycin A 3; OPT 80; PAR 01; PAR 101; R-Tiacumicin B; Tiacumicin. Grades: Highly Purified. CAS No. 873857-62-6. Pack Sizes: 5mg, 10mg, 25mg, 50mg, 100mg. Molecular Formula: C??H??Cl?O??, Molecular Weight: 1058.04. US Biological Life Sciences. | Worldwide |
| Fidaxomicin Metabolite OP-1118 | Fidaxomicin Metabolite OP-1118. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: (2R,3S,4S,5S,6R)-6-(((3E,5E,8S,9E,11S,12R,13E,15E,18S)-11-ethyl-8-hydroxy-18-((R)-1-hydroxyethyl)-9,13,15-trimethyl-2-oxo-12-(((2R,3S,4S,5S)-3,4,5-trihydroxy-6,6-dimethyltetrahydro-2H-pyran-2-yl)oxy)oxacyclooctadeca-3,5,9,13,15-pentaen-3-yl)methoxy)-4-hydroxy-5-methoxy-2-methyltetrahydro-2H-pyran-3-yl 3,5-dichloro-2-ethyl-4,6-dihydroxybenzoate. CAS No. 1030825-28-5. Molecular Formula: C48H68Cl2O17. Mole Weight: 986.38. Catalog: APB1030825285. | |
| Fidrisertib | ALK2-IN-1 is a activin receptor-like kinase-2 ( ALK2 ) inhibitor extracted from patent WO2017181117A1, Compound 876, has an IC 50 of <10 nM [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: BLU-782; IPN-60130; ALK2-IN-1. CAS No. 2141955-96-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg. Product ID: HY-117887. | |
| Fiduxosin | Fiduxosin is a potent antagonist of α1-adrenoceptor, with Ki= 0.160 nM, 24.9 nM, and 0.920 nM for α1a-, α1b-, and α1d-adrenoceptors, respectively. Fiduxosin was found to have improved uroselectivity relative to tamsulosin. Synonyms: 3-[4-[(3aR,9bR)-9-methoxy-3,3a,4,9b-tetrahydro-1H-chromeno[3,4-c]pyrrol-2-yl]butyl]-8-phenyl-1H-pyrazino[1,2]thieno[3,4-b]pyrimidine-2,4-dione; 3-(4-(9-methoxy-1,2,3,3a,4,9b-hexahydro(1)benzopyran(3,4-c)pyrrol-2-yl)butyl)-8-phenylpyrazino(2',3'-4,5)thieno(3,2-d)pyrimidine-2,4(1H,3H)-dione; ABT 980; ABT-980; ABT980; fiduxosin. CAS No. 208993-54-8. Molecular formula: C30H29N5O4S. Mole weight: 555.65. | |
| Fiduxosin hydrochloride | Fiduxosin hydrochloride is an alpha(1)-adrenoceptor antagonist used for the treatment of benign prostatic hyperplasia. Synonyms: 3-[4-[(3aR,9bR)-9-methoxy-3,3a,4,9b-tetrahydro-1H-chromeno[3,4-c]pyrrol-2-yl]butyl]-8-phenyl-1H-pyrazino[1,2]thieno[3,4-b]pyrimidine-2,4-dione;hydrochloride; Fiduxosin hydrochloride; Fiduxosin HCl; 208993-54-8 (Fiduxosin) ; 208992-74-9 ( Fiduxosin Hydrochlride). Grades: >98%. CAS No. 208992-74-9. Molecular formula: C30H29N5O4S.HCl. Mole weight: 592.11. | |
| Figitumumab | Figitumumab (CP-751871) is a potent and fully human monoclonal anti - insulin-like growth factor 1 receptor ( IGF1R ) antibody. Figitumumab prevents IGF1 from binding to IGF1R with an IC 50 of 1.8 nM [1]. Uses: Scientific research. Group: Inhibitory antibodies. Alternative Names: CP-751871. CAS No. 943453-46-1. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P99197. | |
| Figitumumab | Figitumumab is a monoclonal antibody that targets the insulin-like growth factor type I receptor (IGF1R). Figitumumab binds to IGF1R, resulting in a reduction in receptor expression on tumor cells that express IGF1R and inhibition of tumor growth. Synonyms: CP-751871. CAS No. 943453-46-1. | |
| Fig P.E. 10:1 | Fig P.E. 10:1. |  CA, FL & NJ |
| FIIN-1 | FIIN-1 is a potent, irreversible and selective FGFR inhibitor with IC50s of 9.2, 6.2, 11.9 and 189 nM against FGFR1/2/3/4, respectively. FIIN-1 binds to FGFR1/2/3/4 and Flt1/4 with Kds of 2.8, 6.9, 5.4, 120 nM and 32, 120 nM, respectively. Synonyms: FGFR irreversible inhibitor-1; N-[3-[[3-(2,6-Dichloro-3,5-dimethoxyphenyl)-7-[[4-(diethylamino)butyl]amino]-3,4-dihydro-2-oxopyrimido[4,5-d]pyrimidin-1(2H)-yl]methyl]phenyl]-2-propenamide; Fibroblast Growth Factor Receptor Irreversible Inhibitor 1; N-[3-[[3-(2,6-Dichloro-3,5-dimethoxyphenyl)-7-[[4-(diethylamino)butyl]amino]-3,4-dihydro-2-oxopyrimido[4,5-d]pyrimidin-1(2H)-yl]methyl]phenyl]acrylamide. Grades: ≥95%. CAS No. 1256152-35-8. Molecular formula: C32H39Cl2N7O4. Mole weight: 656.60. | |
| FIIN 1 hydrochloride | FIIN 1 hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 1256152-35-8. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| FIIN-2 | FIIN-2 is a potent, selective, irreversible and the next-generation covalent FGFR inhibitor. FIIN-2 is the first inhibitor that can potently inhibit the proliferation of cells dependent upon the gatekeeper mutants of FGFR1 or FGFR2, which confer resistance to first-generation clinical FGFR inhibitors such as NVP-BGJ398 and AZD4547. Synonyms: FIIN2; FIIN 2; FIIN-2. Grades: 98%. CAS No. 1633044-56-0. Molecular formula: C35H38N8O4. Mole weight: 634.73. | |
| FIIN-3 | FIIN-3 is a potent, selective, irreversible and the next-generation covalent FGFR inhibitor. FIIN-3 is the first inhibitor that can potently inhibit the proliferation of cells dependent upon the gatekeeper mutants of FGFR1 or FGFR2, which confer resistance to first-generation clinical FGFR inhibitors such as NVP-BGJ398 and AZD4547. Synonyms: FIIN3; FIIN 3; FIIN-3. Grades: 98%. CAS No. 1637735-84-2. Molecular formula: C34H36Cl2N8O4. Mole weight: 691.61. | |
Our database is helping our users find suppliers everyday.
