A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| GSK864 | GSK864, a chemical probe, is an isocitrate dehydrogenase 1 (IDH1) mutant inhibitor; inhibits IDH1 mutants R132C, R132H, and R132G with IC50 values of 8.8, 15.2 and 16.6 nM. Uses: Scientific research. Category: Signaling pathways. CAS No. 1816331-66-4. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-19540. |  |
| GSK864 | GSK864 is a cell penetrant, selective allosteric inhibitor of isocitrate dehydrogenase 1 (IDH1) mutant with IC50 values of 8.8, 15.2 and 16.6 nM for IDH1 mutants R132C, R132H, and R132G, respectively. Synonyms: (7S)-1-[(4-fluorophenyl)methyl]-3-N-(4-methoxy-3,5-dimethylphenyl)-7-methyl-5-(1H-pyrrole-2-carbonyl)-4,6-dihydropyrazolo[4,3-c]pyridine-3,7-dicarboxamide; GSK 864; GSK-864. CAS No. 1816331-66-4. Molecular formula: C30H31FN6O4. Mole weight: 558.6. |  |
| GSK872 | GSK'872 is a potent and selective RIP3 kinase inhibitor which binds RIP3 kinase domain with high affinity (IC50=1.8 nM) and inhibits kinase activity with IC50 of 1.3 nM. It has minimal cross-reactivity. Group: Inhibitors. Alternative Names: GSK2399872A. CAS No. 1346546-69-7. Pack Sizes: 5mg. Product ID: S8465. Formula: C19H17N3O2S2. Smiles: CC(C)S(=O)(=O)C1=CC2=C(C=CN=C2C=C1)NC3=CC4=C(C=C3)SC=N4. Storage Conditions: 2 years -80 in solvent. |  United States; Europe |
| GSK-872 | GSK-872 is a RIPK3 inhibitor, which binds RIP3 kinase domain with an IC50 of 1.8 nM, and inhibits kinase activity with an IC50 of 1.3 nM. GSK-872 decreases the RIPK3-mediated necroptosis and subsequent cytoplasmic translocation and expression of HMGB1, as well as ameliorates brain edema and neurological deficits in early brain injury[1][2][3]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1346546-69-7. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-101872. | |
| GSK'872 | GSK'872 is a RIPK3 inhibitor, which binds RIP3 kinase domain with high affinity (IC50=1.8 nM), and is approximately >1,000-fold selective over 300 kinases in a fluorescence polarization assay at a concentration of 1 μM. Besides, GSK'872 inhibits kinase activity (IC50=1.3 nM). Synonyms: GSK872; GSK-872; GSK 872; N-(6-propan-2-ylsulfonylquinolin-4-yl)-1,3-benzothiazol-5-amine. CAS No. 1346546-69-7. Molecular formula: C19H17N3O2S2. Mole weight: 383.49. | |
| GSK-872 hydrochloride | GSK-872 hydrochloride is an RIPK3 inhibitor. It binds RIP3 kinase domain with an IC50 of 1.8 nM, and inhibits kinase activity with an IC50 of 1.3 nM. Grade: 99%. CAS No. 2703752-81-0. Molecular formula: C19H18ClN3O2S2. Mole weight: 419.95. | |
| GSK-872 hydrochloride | GSK-872 hydrochloride is a RIPK3 inhibitor, which binds RIP3 kinase domain with an IC50 of 1.8 nM, and inhibits kinase activity with an IC50 of 1.3 nM. GSK-872 hydrochloride decreases the RIPK3-mediated necroptosis and subsequent cytoplasmic translocation and expression of HMGB1, as well as ameliorates brain edema and neurological deficits in early brain injury[1][2][3]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2703752-81-0. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-101872A. | |
| GSK8814 | GSK8814 is a potent and selective ATAD2 bromodomain chemical probe and inhibitor (IC50 = 0.059 μM), with a binding constant pKd = 8.1 and a pKi = 8.9 in BROMOscan. GSK8814 binds to ATAD2 and BRD4 BD1 with pIC50s of 7.3 and 4.6, respectively. GSK8814 shows 500-fold selectivity for ATAD2 over BRD4 BD1. GSK8814 can be researched for cancer associated with ATAD2 bromodomain[1][2][3]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1997369-78-4. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg. Product ID: HY-114204. | |
| GSK894490A | GSK894490A is a non-peptide ghrelin receptor agonist. It crosses the blood/brain barrier and elicit pro-cognitive effects in recognition and spatial learning and memory tests. It may be used as a potential drug target for therapeutic approaches to treat diseases affecting cognition. Uses: Gsk894490a may be used as a potential drug target for therapeutic approaches to treat diseases affecting cognition. Synonyms: Benzenesulfonamide, N-(5-((3R,5S)-3,5-dimethyl-1-piperazinyl)-2-methoxyphenyl)-4-(5-methyl-2-furanyl)-, hydrochloride (1:1), rel-; N-[5-[(3R,5S)-3,5-dimethylpiperazin-1-yl]-2-methoxyphenyl]-4-(5-methylfuran-2-yl)benzenesulfonamide hydrochloride; GSK-894490A. Grade: >98 %. CAS No. 1012035-06-1. Molecular formula: C24H30ClN3O4S. Mole weight: 492.03. | |
| GSK9027 | GSK9027 (GR agonist 23a) is a nonsteroidal glucocorticoid receptor (GR) agonist.GSK9027 is a partial agonist on the 2×GRE reporter gene compared to dexamethasone and is less active than dexamethasone activity. Category: Active pharmaceutical ingredients. CAS No. 1229096-88-1. Product ID: API1229096881. Molecular formula: C27H19F4N3O2S. Mole weight: 525.52. |  |
| GSK 9027 | GSK 9027 is a glucocorticoid receptor agonist (pIC50 = 8) inhibiting production of the proinflammatory mediator IL-6 in vivo. GSK 9027 is used for the treatment of acute and chronic inflammatory conditions. Synonyms: GSK 9027; GSK9027; GSK-9027; N-[4-[1-(4-Fluorophenyl)-1H-indazol-5-yl-3-(trifluoromethyl)phenyl]benzenesulfonamide. Grade: ≥98% by HPLC. CAS No. 1229096-88-1. Molecular formula: C27H19F4N3O2S. Mole weight: 525.52. | |
| GSK923295 | GSK923295. Group: Biochemicals. Alternative Names: GSK-923295, 3-chloro-N- [ (2S) -1- [ [2- (dimethylamino) acetyl]amino]-3- [4- [8- [ (1S) -1hydroxyethyl]imidazo [1, 2-a]pyridin-2-yl]phenyl]propan-2-yl]-4-propan-2-yloxybenzamide. CAS No. 1088965-37-0. Pack Sizes: 5mg, 50mg. Molecular Formula: C32 H38 ClN 5O4 , Molecular Weight: 592.1. US Biological Life Sciences. |  Worldwide |
| GSK-923295 | GSK-923295 is a novel antimitotic inhibitor of centromere-associated protein E (CENP-E) with potential anticancer activity. GSK-923295 demonstrated significant antitumor activity against solid tumor models, inducing CRs in Ewing sarcoma, rhabdoid, and rhabdomyosarcoma xenografts. Clinical study showed that GSK-923295 had dose-proportional pharmacokinetics and a low number of grade 3 or 4 adverse events. The observed incidence of myelosuppression and neuropathy was low. Further investigations may provide a more complete understanding of the potential for GSK-923295 as an antiproliferative agent. Synonyms: GSK923295; GSK 923295; GSK-923295; GSK-923295A; GSK923295A; GSK 923295A. Grade: 98%. CAS No. 1088965-37-0. Molecular formula: C32H38ClN5O4. Mole weight: 592.14. | |
| GSK-923295 | GSK-923295 is a special, allosteric inhibitor of centromere-associated protein-E (CENP-E) kinesin motor ATPase activity, with Ki of 3.2±0.2 nM and 1.6± 0.1 nM for human and canine, respectively. Uses: Scientific research. Category: Signaling pathways. CAS No. 1088965-37-0. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-10299. | |
| GSK 9311 hydrochloride | GSK9311 is a potent inhibitor of the BRPF bromodomain with pIC50 values of 6.0 and 4.3 for BRPF1 and BRPF2, respectively. GSK 9311 is a negative control for the SGC epigenetic probe GSK6853. Synonyms: N-[2,3-Dihydro-1,3-dimethyl-6-[(2R)-2-methyl-1-piperazinyl]-2-oxo-1H-benzimidazol-5-yl]-N-ethyl-2-methoxybenzamide hydrochloride. Grade: ≥98% by HPLC. CAS No. 1923851-49-3. Molecular formula: C24H31N5O3·HCl. Mole weight: 474. | |
| GSK9311 hydrochloride | GSK9311 hydrochloride is a less active analogue of GSK6853 and can be used as a negative control. It inhibits BRPF bromodomain with pIC50s of 6.0 and 4.3 for BRPF1 and BRPF2, respectively. Synonyms: N-{1,3-Dimethyl-6-[(2R)-2-methyl-1-piperazinyl]-2-oxo-2,3-dihydro-1H-benzimidazol-5-yl}-N-ethyl-2-methoxybenzamide hydrochloride (1:1); N-[2,3-Dihydro-1,3-dimethyl-6-[(2R)-2-methyl-1-piperazinyl]-2-oxo-1H-benzimidazol-5-yl]-N-ethyl-2-methoxybenzamide hydrochloride; Benzamide, N-[2,3-dihydro-1,3-dimethyl-6-[(2R)-2-methyl-1-piperazinyl]-2-oxo-1H-benzimidazol-5-yl]-N-ethyl-2-methoxy-, hydrochloride (1:1). CAS No. 2253733-09-2. Molecular formula: C24H32ClN5O3. Mole weight: 474.00. | |
| GSK962 | GSK962 is an inactive enantiomer of GSK963, a novel highly potent and selective RIP1 inhibitor. Synonyms: GSK 962; GSK-962. Grade: >98%. CAS No. 2049872-86-6. Molecular formula: C14H18N2O. Mole weight: 230.31. | |
| GSK 962040 | GSK 962040 is a selective motilin receptor agonist with pEC50 value of 7.9. It is effective as a stimulant of human and rabbit gastrointestinal motility. lt represents a new opportunity as a treatment in diabetic gastroparesis. It is discovered as a therapeutic agent for conditions associated with delayed gastric emptying. It is highly selective against motilin receptor over the human ghrelin receptor and hERG. It also has no significant activity against other receptors including 5-HT, adrenergic, dopamine, histamine and adenosine receptors. It is found to enhance the EFS-induced cholinergic contraction and cause a small muscle contraction at high concentration in rabbit isolated gastric antrum. It also induces the contraction of human-isolated stomach preparations at 10μM. It had no significant activity at a range of other receptors (including ghrelin), ion channels and enzymes in vitro. It was preferred because its initial IC50 values at CYP3A4 were significantly higher than our preferred threshold of 10 μM. It induced phasic contractions, the duration of which was dose-related. It strongly facilitated cholinergic activity in the antrum, with lower activity in fundus and small intestine only. It was developed by glaxosmithkline and has been in Cilinic Phase 2. Uses: Gsk 962040 may be used as a treatment in diabetic gastroparesis. Synonyms: GSK-962040; GSK 962040; GSK962040; Camicinal; 1-[4-(3-fluoroanilino)piperidin-1- | |
| GSK 962040 hydrochloride | GSK 962040 hydrochloride is the hydrochloride form of GSK 962040, which is a selective motilin receptor agonist with pEC50 value of 7.9. It may be used as a treatment in diabetic gastroparesis. It was developed by glaxosmithkline and has been in Cilinic Phase 2. Uses: Gsk 962040 hydrochloride was developed by glaxosmithkline and has been in cilinic phase 2. Synonyms: Camicinal hydrochloride; GSK-962040 hydrochloride; GSK 962040 hydrochloride; GSK962040 hydrochloride; 2-[4-(3-Fluoroanilino)piperidin-1-yl]-1-[4-[[(3S)-3-methylpiperazin-1-yl]methyl]phenyl]ethanone hydrochloride. Grade: >98%. CAS No. 923565-22-4. Molecular formula: C25H34ClFN4O. Mole weight: 461.02. | |
| GSK963 | GSK963 is a potent and selective inhibitor of RIP1 kinase (RIPK1; IC50=29 nM in FP binding assays). GSK963 displays >10?000-fold selective for RIP1 over 339 other kinases. Synonyms: 2,2-dimethyl-1-[(3S)-3-phenyl-3,4-dihydropyrazol-2-yl]propan-1-one. Grade: ≥98%. CAS No. 2049868-46-2. Molecular formula: C14H18N2O. Mole weight: 230.31. | |
| GSK983 | GSK983 is a broad-spectrum antiviral agent. GSK983 inhibits the replication of adenovirus-5 (Ad-5) and polyoma virus SV40. GSK983 inhibits the growth of cell lines immortalized by EBV, HTLV1, HPV. GSK983 induces the expression of interferon-stimulated genes[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 827591-02-6. Pack Sizes: 1 mg; 5 mg. Product ID: HY-119098. | |
| GSK-A1 | GSK-A1 is a selective type III phosphatidylinositol 4-kinase PI4KA (PI4KIIIα) inhibitor with a pIC50 of 8.5-9.8. GSK-A1 inhibits PtdIns(4,5)P2 resynthesis with an IC50 of about 3 nM. GSK-A1 potently decreases the levels of PtdIns(4)P with a negligible effect on PtdIns(4,5)P2. GSK-A1 has the potential for anti-hepatitis C virus (HCV) research[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1416334-69-4. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-125118. | |
| GSK-F1 | PI4KA inhibitor-F1 is a potent PI4KA inhibitor. Synonyms: PI4KA inhibitor-F1. Grade: 98%. CAS No. 1384097-27-1. Molecular formula: C27H18F5N5O4S. Mole weight: 603.5. | |
| GSK J1 | GSK-J1 is a highly potent H3K27 histone demethylase inhibitor with IC50 of 28 nM and 53 nM in cell-free assays for JMJD3 (KDM6B) and UTX (KDM6A), respectively, >10-fold selectivity over other tested demethylases. Synonyms: GSKJ1; GSKJ 1; GSKJ-1. Grade: 98%. CAS No. 1373422-53-7. Molecular formula: C22H23N5O2. Mole weight: 389.45. | |
| GSK-J1 | GSK-J1, a chemical probe, is a potent inhibitor of H3K27me3/me2-demethylases JMJD3/KDM6B and UTX/KDM6A, with IC50 of 60 nM towards KDM6B. Uses: Scientific research. Category: Signaling pathways. CAS No. 1373422-53-7. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15648. | |
| GSK-J1 lithium salt | GSK-J1 lithium salt is a potent inhibitor of H3K27me3/me2-demethylases JMJD3/KDM6B and UTX/KDM6A, with an IC50 of 60 nM towards KDM6B. Synonyms: Lithium 3-{[2-(2-pyridinyl)-6-(1,2,4,5-tetrahydro-3H-3-benzazepin-3-yl)-4-pyrimidinyl]amino}propanoate; β-Alanine, N-[2-(2-pyridinyl)-6-(1,2,4,5-tetrahydro-3H-3-benzazepin-3-yl)-4-pyrimidinyl]-, lithium salt (1:1). Molecular formula: C22H22LiN5O2. Mole weight: 395.38. | |
| GSK-J1 sodium salt | GSK-J1 is a potent and selective inhibitor of the H3K27 histone demethylases JMJD3 and UTX (IC50s = 18 and 56 μM, respectively; IC50 = 60 nM in JMJD3 antibody-based assays). Synonyms: N-[2-(2-pyridinyl)-6-(1,2,4,5-tetrahydro-3H-3-benzazepin-3-yl)-4-pyrimidinyl]-β-alanine, monosodium salt. Grade: ≥95%. CAS No. 1797832-71-3. Molecular formula: C22H22N5O2·Na. Mole weight: 411.4. | |
| GSK-J1 Sodium Salt | GSK-J1 Sodium Salt. Group: Biochemicals. Alternative Names: 3-((6-(4,5-Dihydro-1H-benzo[d]azepin-3(2H)-yl)-2-(pyridin-2-yl)pyrimidin-4-yl)amino)propanoate Monosodium Salt. Grades: Highly Purified. Pack Sizes: 5mg. Molecular Formula: C22H22N5NaO2, Molecular Weight: 411.43. US Biological Life Sciences. | Worldwide |
| GSK-J2 | GSK-J2, a benzazepin derivative, has been found to have poor activity as a JMJD3 inhibitor so that could be used in the biological study of GSK-J1 as a negative control. IC50: > 100 μM. Uses: Gsk-j2 has been found to have poor activity as a jmjd3 inhibitor so that could be used in the biological study of gsk-j1 as a negative control. Synonyms: SK-J2; GSK J2; GSKJ2; 1394854-52-4; SCHEMBL15937902; 3705AH. Grade: 98%. CAS No. 1394854-52-4. Molecular formula: C22H23N5O2. Mole weight: 389.45. | |
| GSK-J2 sodium salt | GSK-J2 is a pyridine regio-isomer of GSK-J1 which poorly inhibits JMJD3 with an IC50 value greater than 100 μM. Synonyms: 3-((6-(4,5-dihydro-1H-benzo[d]azepin-3(2H)-yl)-2-(pyridin-3-yl)pyrimidin-4-yl)amino)propanoic acid, monosodium salt. Grade: ≥90%. CAS No. 2108665-15-0. Molecular formula: C22H23N5O2·Na. Mole weight: 412.4. | |
| GSK-J4 | GSK-J4 Inhibitor. Uses: Scientific use. Product Category: T3100. CAS No. 1373423-53-0. |  |
| GSK-J4 | GSK-J4 is a potent dual inhibitor of H3K27me3/me2-demethylases JMJD3/KDM6B and UTX/KDM6A with IC50s of 8.6 and 6.6 μM, respectively. GSK-J4 inhibits LPS-induced TNF-α production in human primary macrophages with an IC50 of 9 μM. GSK J4 is a cell permeable proagent of GSK-J1[1][2][3]. GSK-J4 induces endoplasmic reticulum stress-related apoptosis[4]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1373423-53-0. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-15648B. | |
| GSK J4 HCl | GSK J4 HCl is a cell permeable prodrug of GSK J1, which is the first selective inhibitor of the H3K27 histone demethylase JMJD3 and UTX with IC50 of 60 nM and inactive against a panel of demethylases of the JMJ family. Synonyms: GSK-J4; 1373423-53-0; GSK J4; Ethyl 3-((6-(4,5-dihydro-1H-benzo[d]azepin-3(2H)-yl)-2-(pyridin-2-yl)pyrimidin-4-yl)amino)propanoateethyl 3-[[2-pyridin-2-yl-6-(1,2,4,5-tetrahydro-3-benzazepin-3-yl)pyrimidin-4-yl]amino]propanoate. Grade: >98%. CAS No. 1373423-53-0. Molecular formula: C24H27N5O2.HCl. Mole weight: 453.96. | |
| GSK-J4 hydrochloride | GSK-J4 (hydrochloride) is an ethyl ester derivative of GSK-J1 which blocks demethylation of histone H3K27 with an IC50 value greater than 50 μM in vitro. Synonyms: N-[2-(2-pyridinyl)-6-(1,2,4,5-tetrahydro-3H-3-benzazepin-3-yl)-4-pyrimidinyl]-β-alanine, ethyl ester, monohydrochloride. Grade: ≥95%. CAS No. 1797983-09-5. Molecular formula: C24H27N5O2·HCl. Mole weight: 454. | |
| GSK-J4 hydrochloride | GSK-J4 hydrochloride is a potent dual inhibitor of H3K27me3/me2-demethylases JMJD3/KDM6B and UTX/KDM6A with IC50s of 8.6 and 6.6 μM, respectively. GSK-J4 hydrochloride inhibits LPS-induced TNF-α production in human primary macrophages with an IC50 of 9 μM. GSK-J4 hydrochloride is a cell permeable proagent of GSK-J1[1][2][3]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1797983-09-5. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15648F. | |
| GSK-J4 Hydrochloride | GSK-J4 Hydrochloride. Group: Biochemicals. Alternative Names: Ethyl 3-((6-(4,5-Dihydro-1H-benzo[d]azepin-3(2H)-yl)-2-(pyridin-2-yl)pyrimidin-4-yl)amino)propanoate Monohydrochloride. Grades: Highly Purified. Pack Sizes: 5mg. Molecular Formula: C24H28ClN5O2, Molecular Weight: 453.96. US Biological Life Sciences. | Worldwide |
| GSK-J4 Hydrochloride | GSK J4 HCl is a cell permeable prodrug of GSK J1, which is the first selective inhibitor of the H3K27 histone demethylase JMJD3 and UTX with IC50 of 60 nM in a cell-free assay and inactive against a panel of demethylases of the JMJ family. Group: Inhibitors. CAS No. 1797983-09-5. Pack Sizes: 10mg. Product ID: S7070. Formula: C24H27N5O2.HCl. Smiles: CCOC(=O)CCNC1=CC(=NC(=N1)C2=CC=CC=N2)N3CCC4=CC=CC=C4CC3.Cl. Storage Conditions: 2 years -80 in solvent. | United States; Europe |
| GSK-J5 | GSK-J5 is a potent inhibitor of Schistosome and worm. GSK-J5 increases schistosomula mortality and adult worm motility and mortality, as well as egg oviposition, in a dose- and time-dependent manner[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1394854-51-3. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15648C. | |
| GSK-J5 hydrochloride | GSK-J5 is a pyridine regio-isomer of GSK-J4 and it is a weak inhibitor of JMJD3 (IC50 > 100 μM), making it an ideal inactive control molecule for elucidating the functional role of JMJD3 inhibition. Synonyms: N-[2-(3-pyridinyl)-6-(1,2,4,5-tetrahydro-3H-3-benzazepin-3-yl)-4-pyrimidinyl]-β-alanine, ethyl ester, monohydrochoride. Grade: ≥95%. CAS No. 1797983-32-4. Molecular formula: C24H27N5O2·HCl. Mole weight: 454. | |
| GSK-J5 Hydrochloride | GSK-J5 Hydrochloride is a selective jumonji H3K27 demethylase inhibitor that modulates the proinflammatory macrophage response. The histone H3 lysine 27 (H3K27) demethylase JMJD3 plays important roles in the transcriptional regulation of cell differentiation, development, the inflammatory response, and cancer.1,2 GSK-J4 (Item No. 12073) is a cell-permeable prodrug which is modified by intracellular esterases to give GSK-J1 (Item No. 12054), an inhibitor of JMJD3. GSK-J5 is a pyridine regio-isomer of GSK-J4. Like GSK-J4, this isomer is cell-permeable and hydrolyzed to a free base.3 However, the free base is a weak inhibitor of JMJD3 (IC50 > 100 μM), making it an ideal inactive control molecule for elucidating the functional role of JMJD3 inhibition.3. Group: Biochemicals. Alternative Names: N-[2-(3-Pyridinyl)-6-(1,2,4,5-tetrahydro-3H-3-benzazepin-3-yl)-4-pyrimidinyl]- β-alanineEthyl Ester Hydochloride. Grades: Highly Purified. CAS No. 1394854-51-3. Pack Sizes: 5mg. US Biological Life Sciences. | Worldwide |
| GSK-LSD1 2HCl | GSK-LSD1 2HCl is an irreversible, and selective LSD1 inhibitor with IC50 of 16 nM, > 1000 fold selective over other closely related FAD utilizing enzymes (i.e. LSD2, MAO-A, MAO-B). Synonyms: GSK LSD1 2HCl; GSK-LSD1 Dihydrochloride. Grade: >98%. CAS No. 1431368-48-7. Molecular formula: C14H22Cl2N2. Mole weight: 289.24. | |
| GSK-LSD1 dihydrochloride | GSK-LSD1 dihydrochloride is a potent, selective and irreversible lysine specific demethylase 1 (LSD1) inhibitor with an IC50 of 16 nM. Uses: Scientific research. Category: Signaling pathways. CAS No. 2102933-95-7. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-100546A. | |
| GSK PERK Inhibitor | GSK PERK Inhibitor is an inhibitors of PERK, an important transmembrane protein of endoplasmic reticulum (ER). GSK PERK Inhibitor can be useful in the treatment of cancer, ocular diseases, and diseases associated with activated unfolded protein response pathways. As a result, GSK PERK Inhibitor has potential use in the treatment of diseases such as Alzheimer's disease, stroke, Type 1 diabetes, Parkinson disease, Huntington's disease, amyotrophic lateral sclerosis, myocardial infarction, cardiovascular disease, atherosclerosis, and arrhythmias, and more specifically cancers of the breast, colon, pancreatic, and lung. Group: Biochemicals. Alternative Names: 1-[5- (4-Amino-7-methyl-7H-pyrrolo[2, 3-d]pyrimidin-5-yl) -2, 3-dihydro-1H-indol-1-yl]-2-[3-fluoro-5- (trifluoromethyl) phenyl]ethanone; 3-Fluoro-GSK2606414. Grades: Highly Purified. CAS No. 1337531-89-1. Pack Sizes: 1mg, 2mg, 5mg, 10mg. US Biological Life Sciences. | Worldwide |
| GSK PERK Inhibitor-d3 | GSK PERK Inhibitor-d3. Group: Biochemicals. Alternative Names: 1-[5- (4-Amino-7-methyl-7H-pyrrolo[2, 3-d]pyrimidin-5-yl) -2, 3-dihydro-1H-indol-1-yl]-2-[3-fluoro-5- (trifluoromethyl) phenyl]ethanone-d3; 3-Fluoro-GSK2606414-d3. Grades: Highly Purified. Pack Sizes: 1mg. Molecular Formula: C24H16D3F4N5O, Molecular Weight: 472.45. US Biological Life Sciences. | Worldwide |
| GSK_WRN4 | GSK_WRN4 is an orally active WRN helicase inhibitor (pIC50=7.6). GSK_WRN4 induces DNA damage markers (p21, p-γH2AX, p-KAP1). GSK_WRN4 selectively inhibits microsatellite-unstable tumor growth in vitro and in vivo by inducing DNA double-strand breaks, particularly at expanded TA repeats and regions of DNA damage[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2923008-66-4. Pack Sizes: 1 mg; 5 mg. Product ID: HY-163942. | |
| GsMTx4 | GsMTx4 is a spider venom peptide that selectively inhibits cationic-permeable mechanosensitive channels (MSCs) belonging to the Piezo and TRP channel families. GsMTx4 also blocks cation-selective stretch-activated channels (SACs) , attenuates lysophosphatidylcholine (LPC)-induced astrocyte toxicity and microglial reactivity. GsMTx4 is an important pharmacological tool for identifying the role of these excitatory MSCs in normal physiology and pathology[1][2][4]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1209500-46-8. Pack Sizes: 500 μg; 1 mg; 5 mg. Product ID: HY-P1410. | |
| GsMTx4 | GsMTx4 (Grammostola spatulata mechanotoxin 4, M-theraphotoxin-Gr1a, M-TRTX-Gr1a) is a spider venom peptide that inhibits cationic mechanosensitive channels (MSCs) belonging to the Piezo and TRP channel families. Group: Peptides. CAS No. 1209500-46-8. Pack Sizes: 1mg. Product ID: P1205. Formula: C185H273N49O45S6. Storage Conditions: 3 years-20°C powder. | United States; Europe |
| GsMTx4 | GsMTx4 is a mechanosensitive and stretch-activated ion channel inhibitor. It is used as a tool for identifying the role of these excitatory MSCs in normal physiology and pathology. Grade: >98%. CAS No. 1209500-46-8. Molecular formula: C185H273N49O45S6. Mole weight: 4095.86. | |
| GsMTx4 TFA | GsMTx4 TFA Inhibitor. Uses: Scientific use. Product Category: TP1300. CAS No.: | |
| GsMTx4 TFA | GsMTx4 is a TRPC1 and TRPC6 blocker, and also blocks stretch-activated cation channels in astrocytes, cardiac cells, and skeletal muscle cells. Synonyms: H-Gly-Cys-Leu-Glu-Phe-Trp-Trp-Lys-Cys-Asn-Pro-Asn-Asp-Asp-Lys-Cys-Cys-Arg-Pro-Lys-Leu-Lys-Cys-Ser-Lys-Leu-Phe-Lys-Leu-Cys-Asn-Phe-Ser-Phe-OH.TFA; glycyl-L-cysteinyl-L-leucyl-L-alpha-glutamyl-L-phenylalanyl-L-tryptophyl-L-tryptophyl-L-lysyl-L-cysteinyl-L-asparagyl-L-prolyl-L-asparagyl-L-alpha-aspartyl-L-alpha-aspartyl-L-lysyl-L-cysteinyl-L-cysteinyl-L-arginyl-L-prolyl-L-lysyl-L-leucyl-L-lysyl-L-cysteinyl-L-seryl-L-lysyl-L-leucyl-L-phenylalanyl-L-lysyl-L-leucyl-L-cysteinyl-L-asparagyl-L-phenylalanyl-L-seryl-L-phenylalanine trifluoroacetic acid. Molecular formula: C185H278N48O46S6. Mole weight: 4103. | |
| GSTO1-IN-1 | GSTO1-IN-1 is a potent glutathione S-transferase omega 1 (GSTO1) inhibitor with an IC50 of 31 nM. Uses: Scientific research. Category: Signaling pathways. CAS No. 568544-03-6. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-111530. | |
| GT-02216 | GT-02216 can bind to GCase allosterically and enhance its activity. GT-02216 enhances the activity of GCase in primary human fibroblasts dose-dependently reduces the accumulation of its substrate, hexosylsphingosine (HexCer). GT-02216 reduces the Tau accumulation in mutant GBA1 fibroblasts. GT-02216 can be used for the study of Parkinsons disease[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2648407-76-3. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-174311. | |
| GT19630 | PROTAC c-Myc degrader-1 (Compound A153) is a multiple target protein degrader (PROTAC). PROTAC c-Myc degrader-1 effective degrades c-MYC, CK1α, GSPT1 and IKZF1/2/3 proteins in a variety of tumor cells. PROTAC c-Myc degrader-1 can be used for c-Myc high expression related disease research, such as cancer, cardiovascular and cerebrovascular diseases, and viral infection (Pink: c-Myc ligand (HY-168685); Blue: E3 ligase ligand (HY-W093472); Black: linker (HY-W015808))[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2883535-99-5. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-148837. | |
| GT1a-Oligosaccharide | GT1a-Oligosaccharide is an advanced oligosaccharide, finding applications in studying intricate neurological afflictions. Its specialized affinity towards toxins and pathogens endows it with unparalleled efficiency in studying viral invasions. Synonyms: Neu5Aca2-8Neu5Aca2-3Galb1-3GalNAcb1-4 (Neu5Aca2-3)Galb1-4Glc. Molecular formula: C59H93N4O45Na3. Mole weight: 1647.34. | |
| GT1b-Ganglioside | GT1b-Ganglioside is demonstrated to protect mouse brain cells against L-cysteine-induced damage of mitochondrial DNA and increased lipid peroxidation, suggested to operate through scavenging of OH radicals promoted by L-cysteine. GT1b-Ganglioside is also demonstrated to suppress seizures, damage to mitochondrial DNA and lipid peroxidation induced by kainic acid. Synonyms: Trisialoganglioside-GT1b (porcine brain); Ganglioside GT1b; Ganglioside G1; GT1b. Grade: >99%. CAS No. 59247-13-1. Molecular formula: C95H174N8O47. Mole weight: 2180.42. | |
| GT1b-Oligosaccharide | GT1b-Oligosaccharide is an extraordinary compound, manifesting promising applications in studying the complexities of neurological disorders and autoimmune diseases. CAS No. 75663-36-4. Molecular formula: C59H96N4O45. Mole weight: 1581.39. | |
| GT1c-Oligosaccharide | GT1c-Oligosaccharide is a remarkable compound widely utilized in studying intricate cellular mechanisms in a spectrum of ailments, such as debilitating cancers and complex neurodegenerative disorders. Synonyms: Galb1-3GalNAcb1-4(Neu5Aca2-8Neu5Aca2-8Neu5Aca2-3)Galb1-4Glc. Molecular formula: C59H93N4O45Na3. Mole weight: 1647.34. | |
| GT 2016 | GT 2016. Group: Biochemicals. Grades: Purified. CAS No. 152241-24-2. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| GT 2016 | GT 2016 is a high affinity and brain-penetrant histamine H3 receptor antagonist (Ki = 43.8 nM). It displays selectivity against H1 and H2 receptors (IC50 >10 μM). GT 2016 increases the release of histamine in the cerebral cortex. GT 2016 exhibits no effect on histamine methyltransferase in vitro at concentrations up to 3 μM. Synonyms: GT-2016,GT2016, GT 2016; 5-Cyclohexyl-1-[4-(1H-imidazol-5-yl)-1-piperidinyl]-1-pentanone. Grade: ≥98% by HPLC. CAS No. 152241-24-2. Molecular formula: C19H31N3O. Mole weight: 317.47. | |
| GT2-Oligosaccharide | GT2-Oligosaccharide is a multifaceted biomedical marvel, effectively aiding in the formidable research of cardiovascular diseases, cancer, and diabetes. Acting as a prowess-inducing inhibitor of α-glucosidases, this spellbinding remedy boasts unprecedented potential in orchestrating the delicate symphony of blood glucose regulation. Synonyms: GalNAcb1-4(Neu5Aca2-8Neu5Aca2-8Neu5Aca2-3)Galb1-4Glc. Molecular formula: C53H83N4O40Na3. Mole weight: 1485.20. | |
| GT3-Oligosaccharide | GT3-Oligosaccharide is an extraordinary biomedical compound emanating from pristine natural sources, acting as a potent antioxidant. It is anti-inflammatory and immunomodulatory crusader, finding applications in studying cancer, cardiovascular ailments and neurodegenerative ravages. Synonyms: Neu5Aca2-8Neu5Aca2-8Neu5Aca2-3Galb1-4Glc. Molecular formula: C45H70N3O35Na3. Mole weight: 1282.01. | |
| GT-653 | GT-653 is a PROTAC degrader for lysine-specific demethylase 5B (KDM5B). GT-653 degrades 68.35% KDM5B at 10 μM in a ubiquitin proteasome-dependent manner, upregulates H3K4me3 levels, and activates the type-I interferon signaling pathway in prostate cancer cells 22RV1. (Pink: KDM5B ligand (HY-158433); Black: Linker (HY-W004896); Blue: E3 ligase ligand (HY-103596))[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 3057627-63-8. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-158432. | |
| GT 949 | GT 949 is a selective excitatory amino acid transporter-2 (EAAT2) positive allosteric modulator with an EC50 of 0.26 nM[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 460330-27-2. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-114381. | |
| GT 949 | GT 949 is a potent and selective EAAT2 positive allosteric modulator (EC50 = 0.26 nM) which exhibits no significant effect on DAT, SERT and NET or NMDA receptors. Synonyms: 3-((4-Cyclohexylpiperazin-1-yl)(1-phenethyl-1H-tetrazol-5-yl)methyl)-6-methoxyquinolin-2(1H)-one. Grade: ≥98%. CAS No. 460330-27-2. Molecular formula: C30H37N7O2. Mole weight: 527.66. | |
| GTA182 | GTA182 (compound 107) is an orally active PRMT5 inhibitor and can be used for study of cancer[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: PRMT5-IN-39. CAS No. 3030464-01-5. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-163588. | |
| GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | It is a derivative of Exendin-4 peptide. Synonyms: Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser. Grade: ≥95%. Molecular formula: C170H262N44O56S. Mole weight: 3850.28. | |
| GTP, 100mM Sodium Solution | Guanosine triphosphate (GTP) is a guanine nucleotide containing three phosphate groups esterified to the sugar moiety. GTP functions as a carrier of phosphates and pyrophosphates involved in channeling chemical energy into specific biosynthetic pathways. GTP activates the signal transducing G proteins which are involved in various cellular processes including proliferation, differentiation, and activation of several intracellular kinase cascades. Proliferation and apoptosis are regulated in part by the hydrolysis of GTP by small GTPases Ras and Rho. Another type of small GTPase, Rab, plays a role in the docking and fusion of vesicles and may also be involved in vesicle formation. In addition to its role in signal transduction, GTP also serves as an energy-rich precursor of mononucleotide units in the enzymatic biosynthesis of DNA and RNA. Synonyms: D-Guanosine 5'-triphosphate; Guanosine triphosphate; Guanosine 5'-triphosphoric acid; pppG; guanosine 5'-O-(triphosphate); [[(2R,3S,4R,5R)-5-(2-amino-6-oxo-1H-purin-9-yl)-3,4-dihydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl] phosphono hydrogen phosphate. Molecular formula: C10H16N5O14P3 (free acid). Mole weight: 523.18 (free acid). | |
| GTP 14564 | GTP 14564. Group: Biochemicals. Grades: Purified. CAS No. 34823-86-4. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| GTP-14564 | GTP-14564 is a specific kinase inhibitor for ITD-FLT3. GTP-14564 inhibited the growth of interleukin-3-independent Ba/F3 expressing ITD-FLT3 at 1 microM, whereas a 30-fold higher concentration of GTP-14564 was required to inhibit FLT3 ligand-dependent growth of Ba/F3 expressing wild type FLT3 (wt-FLT3). Synonyms: GTP 14564; GTP14564; 1-Phenyl-3-H-8-oxa-2,3-diaza-cyclopenta[a]inden. CAS No. 34823-86-4. Molecular formula: C15H10N2O. Mole weight: 234.25. | |
| GTP 3',8-cyclase | The enzyme catalyses an early step in the biosynthesis of the molybdenum cofactor (MoCo). In bacteria and plants the reaction is catalysed by MoaA and Cnx2, respectively. In mammals it is catalysed by the MOCS1A domain of the bifunctional MOCS1 protein, which also catalyses EC 4.6.1.17, cyclic pyranopterin monophosphate synthase. The enzyme belongs to the superfamily of radical S-adenosyl-L-methionine (radical SAM) enzymes, and contains two oxygen-sensitive FeS clusters. Group: Enzymes. Synonyms: MOCS1A (gene name); moaA (gene name); cnx2 (gene name). Enzyme Commission Number: EC 4.1.99.22. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4935; GTP 3',8-cyclase; EC 4.1.99.22; MOCS1A (gene name); moaA (gene name); cnx2 (gene name). Cat No: EXWM-4935. |  |
Our database is helping our users find suppliers everyday.
