American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
p-Aminobenzonitrile Liquid crystal intermediate. Synonyms: p-Cyanoaniline. CAS No. 873-74-5. Pack Sizes: 25g, 100g. Product ID: FR-1290. M.P. 84-86. Mole weight: 118.14. Frinton Laboratories Inc
Frinton Laboratories
p-Aminobenzyl 1-thio-?-D-galactopyranoside-Agarose saline suspension. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
p-Aminobenzyl bromide p-Aminobenzyl bromide. Group: Biochemicals. Grades: Highly Purified. CAS No. 63516-03-0. Pack Sizes: 250mg, 500mg, 1g, 2g, 5g. US Biological Life Sciences. USBiological 6
Worldwide
p-Aminobenzyl bromide p-Aminobenzyl bromide. Uses: Designed for use in research and industrial production. Additional or Alternative Names: p-Aminobenzylbromide;4-(bromomethyl)-Benzenamine. Product Category: Bromine Series. CAS No. 63516-03-0. Molecular formula: C7?H8?Br?N?. Mole weight: 0. Product ID: ACM63516030. Alfa Chemistry — ISO 9001:2015 Certified. Categories: 4-(bromomethyl)aniline. Alfa Chemistry.
p-Aminobenzylphosphonic acid p-Aminobenzylphosphonic acid. Group: Self-assembly materials. CAS No. 5424-27-1. Product ID: (4-aminophenyl)methylphosphonic acid. Molecular formula: 187.13g/mol. Mole weight: C7H10NO3P. C1=CC(=CC=C1CP(=O)(O)O)N. InChI=1S/C7H10NO3P/c8-7-3-1-6 (2-4-7)5-12 (9, 10)11/h1-4H, 5, 8H2, (H2, 9, 10, 11). NEKHKXMBGWNTOO-UHFFFAOYSA-N. Alfa Chemistry Materials 5
p-Aminoclonidine hydrochloride solid. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
p-Amino-L-phenylalanine p-Amino-L-phenylalanine is an analog of L-Phenylalanine. Group: Biochemicals. Alternative Names: 4-Amino-L-phenylalanine; L-3-(p-Aminophenyl)alanine; 4-Amino-L-phenylalanine; 4-Aminophenylalanine; Aminophenylalanine; L-(+)-p-Aminophenylalanine; L-4-Aminophenylalanine. Grades: Highly Purified. CAS No. 943-80-6. Pack Sizes: 2.5g. US Biological Life Sciences. USBiological 2
Worldwide
p-Amino-L-phenylalanine hydrochloride p-Amino-L-phenylalanine hydrochloride. Group: Biochemicals. Alternative Names: L-3-(p-Aminophenyl)alanine; 4-Amino-L-phenylalanine; Aminophenylalanine. Grades: Highly Purified. CAS No. 62040-55-5. Pack Sizes: 1g, 2g, 5g, 10g, 25g. Molecular Formula: C9H13ClN2O2. US Biological Life Sciences. USBiological 6
Worldwide
p-Amino-L-phenylalanine, Hydrochloride p-Amino-L-phenylalanine, Hydrochloride. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 2.5g. US Biological Life Sciences. USBiological 1
Worldwide
p-Aminomethylbenzenesulfonamide-Agarose saline suspension. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
p-Amino-N,N-diethylaniline sulfate p-Amino-N,N-diethylaniline sulfate. Group: Biochemicals. Grades: Highly Purified. CAS No. 6283-63-2. Pack Sizes: 50g, 100g, 250g, 500g, 1kg. Molecular Formula: C10H18N2O4S. US Biological Life Sciences. USBiological 6
Worldwide
p-Aminooxanilic acid p-Aminooxanilic acid. Group: Biochemicals. Alternative Names: N-Oxalyl-4-aminoaniline, N-oxalyl-p-phenylenediamine; N-(p-Aminophenyl)oxamic acid; NSC 36978. Grades: Highly Purified. CAS No. 103-92-4. Pack Sizes: 250mg, 500mg, 1g, 2g, 5g. Molecular Formula: C8H8N2O3. US Biological Life Sciences. USBiological 6
Worldwide
p-Aminooxanilic Acid (N-Oxalyl-4-aminoaniline, N-Oxalyl-p-phenylenediamine) p-Aminooxanilic Acid (N-Oxalyl-4-aminoaniline, N-Oxalyl-p-phenylenediamine). Group: Biochemicals. Alternative Names: N-Oxalyl-4-aminoaniline, N-Oxalyl-p-phenylenediamine. Grades: Highly Purified. Pack Sizes: 500mg. US Biological Life Sciences. USBiological 1
Worldwide
p-Aminophenol P-aminophenol appears as white or reddish-yellow crystals or light brown powder. Turns violet when exposed to light. (NTP, 1992);DryPowder;Solid. Group: Liquid crystal (lc) building blocks. CAS No. 123-30-8. Product ID: 4-aminophenol. Molecular formula: 109.13g/mol. Mole weight: C6H7NO. C1=CC(=CC=C1N)O. InChI=1S/C6H7NO/c7-5-1-3-6 (8)4-2-5/h1-4, 8H, 7H2. PLIKAWJENQZMHA-UHFFFAOYSA-N. Alfa Chemistry Materials 5
p-Aminophenol sulfate p-Aminophenol sulfate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 4-Amino-phenol; Sulfat; p-aminophenol sulfate; P-AMINOPHENOL SULFATE. Product Category: Heterocyclic Organic Compound. CAS No. 54646-39-8. Molecular formula: C12H14N2O2·H2SO4. Mole weight: 316.33. Purity: 0.96. IUPACName: 4-amino-phenol, sulfate. Product ID: ACM54646398. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 5
p-Aminophenyl-1-thio-beta-D-glucopyranos ide p-Aminophenyl-1-thio-beta-D-glucopyranos ide. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 2-(4-aminophenyl)sulfanyl-6-(hydroxymethyl)oxane-3,4,5-triol, 129970-93-0, 58737-22-7, 2-[(4-aminophenyl)thio]-6-(hydroxymethyl)oxane-3,4,5-triol, AC1N51OF, AGN-PC-0019EJ, 4-Aminophenyl-b-D-thioglucopranoside, 4-Aminophenyl-b-D-thiomannopranoside, ZINC00402621, FT-0651640, FT-0655496, A805995, A831999, S07-0027, S07-0028, (2S,3R,4R,5R,6R)-2-(4-aminophenyl)sulfanyl-6-(hydroxymethyl)oxane-3,4,5-triol. Product Category: Heterocyclic Organic Compound. CAS No. 58737-22-7. Molecular formula: C12H17NO5S. Mole weight: 287.33208. Purity: 0.96. IUPACName: 2-(4-aminophenyl)sulfanyl-6-(hydroxymethyl)oxane-3,4,5-triol. Canonical SMILES: C1=CC(=CC=C1N)SC2C(C(C(C(O2)CO)O)O)O. Density: 1.54 g/cm³. Product ID: ACM58737227. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 5
p-Aminophenyl Arsenoxide A useful reagent for the study of 2-oxoacid dehydrogenase multienzyme complexes. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 1
Worldwide
p-Aminophenyl dichloroarsine hydrochloride p-Aminophenyl dichloroarsine hydrochloride. Group: Biochemicals. Alternative Names: (4-Aminophenyl)arsonous dichloride monohydrochloride; APA. Grades: Highly Purified. CAS No. 5410-78-6. Pack Sizes: 2mg, 5mg, 10mg, 25mg, 50mg. Molecular Formula: C6H7AsCl3N. US Biological Life Sciences. USBiological 6
Worldwide
p-Aminophenylmercuric acetate p-Aminophenylmercuric acetate is an organomercurial activator of matrix metalloproteinases (MMP). P-Aminophenylmercuric acetate participates in the activation and inhibition of MMP-8 by attacking protein sulfhydryl or inducing cysteine switching reaction. p-Aminophenylmercuric acetate promotes the shedding of betacellulin precursor (pro-BTC). p-Aminophenylmercuric acetate influences the binding of agonists and antagonists to the opiate receptor[1][2][3]. Uses: Scientific research. Group: Biochemical assay reagents. CAS No. 6283-24-5. Pack Sizes: 10 mM * 1 mL; 50 mg; 100 mg; 250 mg; 500 mg; 1 g. Product ID: HY-148905. MedChemExpress MCE
P-AMINOPHENYL-N-ACETYL-B-D-THIOGLUCOSAMI NIDE P-AMINOPHENYL-N-ACETYL-B-D-THIOGLUCOSAMI NIDE. Uses: Designed for use in research and industrial production. Additional or Alternative Names: AC1NA29H, N-[2-(4-aminophenyl)sulfanyl-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl]acetamide, 4-Aminophenyl N-acetyl-|A-D-thioglucosaminide, p-Aminophenyl-2-acetamido-2-deoxy-|A-D-thioglucopyranoside, 52722-51-7. Product Category: Heterocyclic Organic Compound. CAS No. 52722-51-7. Molecular formula: NULL. Mole weight: 328.38. Purity: 0.96. IUPACName: N-[2-(4-aminophenyl)sulfanyl-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl]acetamide. Product ID: ACM52722517. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 3
Pamiparib Pamiparib (BGB-290) is an orally active, potent, highly selective PARP inhibitor, with IC 50 values of 0.9 nM and 0.5 nM for PARP1 and PARP2 , respectively. Pamiparib has potent PARP trapping, and capability to penetrate the brain, and can be used for the research of various cancers including the solid tumor [1] [2]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: BGB-290. CAS No. 1446261-44-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-104044. MedChemExpress MCE
Pamoic acid United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards. Alfa Chemistry Analytical Products 2
Pamoic acid 25g Pack Size. Group: Bioactive Small Molecules. Formula: C23H16O6. CAS No. 130-85-8. Prepack ID 11052449-25g. Molecular Weight 388.37. See USA prepack pricing. Molekula Americas
Pamoic Acid ?97.0% (T). Group: Fluorescence/luminescence spectroscopyimpurity standardspharmaceutical toxicology. Alternative Names: KG 122, NSC 30188, 2,2'-Dihydroxy-1,1'-dinaphthylmethane-3,3'-dicarboxylic acid, 4,4'-Methylenebis[3-hydroxy-2-naphthalenecarboxylic acid], 4-[(3-Carboxy-2-hydroxynaphthalen-1-yl)methyl]-3-hydroxynaphthalene-2-carboxylic acid, 4,4'-Methylenebis[3-hydroxy-2-naphthoic acid], Pamoic Acid,4,4'-Methylenebis[3-hydroxy-2-naphthalenecarboxylic acid], NSC 40132, 2-Naphthoic acid, 4,4'-methylenebis[3-hydroxy- (6CI,7CI,8CI), Bis(2-hydroxy-3-carboxy-1-naphthyl)methane, 4,4'-Methylenebis(3-hydroxy-2-naphthalenecarboxylic acid), Embonic acid. Alfa Chemistry Analytical Products 4
Pamoic Acid Agonist of the orphan G protein-coupled receptor GPR35: a potent activator of extracellular signal-regulated kinase and β-arrestin2 with antinociceptive activity. Used as an inhibitor in the real-time fluorescence enzymatic characterization study of specialized human DNA polymerases. Group: Biochemicals. Grades: Highly Purified. CAS No. 130-85-8. Pack Sizes: 1g. US Biological Life Sciences. USBiological 2
Worldwide
Pamoic acid disodium Pamoic acid disodium is a potent GPR35 agonist with an EC 50 value of 79 nM. Pamoic acid disodium induces GPR35 internalization and activates ERK1/2 with EC 50 values of 22 nM and 65 nM, respectively. Pamoic acid disodium potently recruits β-arrestin2 to GPR35 and has an antinociceptive effect [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 6640-22-8. Pack Sizes: 10 mM * 1 mL; 10 g; 25 g. Product ID: HY-W010907. MedChemExpress MCE
Pamoic acid disodium salt 25g Pack Size. Group: Building Blocks, Organics. Formula: C23H14Na2O6. CAS No. 6640-22-8. Prepack ID 54729581-25g. Molecular Weight 432.33. See USA prepack pricing. Molekula Americas
Pamoic acid disodium salt Pamoic acid disodium salt. Group: Biochemicals. Grades: Purified. CAS No. 6640-22-8. Pack Sizes: 50mg. US Biological Life Sciences. USBiological 5
Worldwide
PAMP-12 (human, porcine) acetate PAMP-12(human, porcine) acetate, a major component of ir-PAMP, is an endogenous peptide agonist of Mas-related GPR X2 (MRGPRX2). Synonyms: H-Phe-Arg-Lys-Lys-Trp-Asn-Lys-Trp-Ala-Leu-Ser-Arg-NH2.CH3CO2H; L-phenylalanyl-L-arginyl-L-lysyl-L-lysyl-L-tryptophyl-L-asparagyl-L-lysyl-L-tryptophyl-L-alanyl-L-leucyl-L-seryl-L-argininamide acetic acid; 9-20-Proadrenomedullin (pig) acetate; Human PAMP(9-20) acetate; Human PAMP-12 acetate; PAMP 9-20 acetate; Porcine PAMP 12 acetate; Porcine PAMP(9-20) acetate. Grade: ≥95%. Molecular formula: C79H123N25O16. Mole weight: 1678.98. BOC Sciences
PAMP-12 (unmodified) PAMP-12 (unmodified) is a potent MRGPRX2 (MrgX2) agonist (EC50=20-50 nM). PAMP-12 (unmodified) is an endogenous peptide that elicit hypotension through inhibiting catecholamine secretion from sympathetic nerve endings and adrenal chromaffin cells[1]. Uses: Scientific research. Group: Peptides. CAS No. 929905-12-4. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P3419. MedChemExpress MCE
PAMP-20 (human) PAMP-20 is an endogenous peptide agonist of Mas related GPR X2 (MRGPRX2). Synonyms: Proadrenomedullin (1-20), human; H-Ala-Arg-Leu-Asp-Val-Ala-Ser-Glu-Phe-Arg-Lys-Lys-Trp-Asn-Lys-Trp-Ala-Leu-Ser-Arg-NH2; L-alanyl-L-arginyl-L-leucyl-L-alpha-aspartyl-L-valyl-L-alanyl-L-seryl-L-alpha-glutamyl-L-phenylalanyl-L-arginyl-L-lysyl-L-lysyl-L-tryptophyl-L-asparagyl-L-lysyl-L-tryptophyl-L-alanyl-L-leucyl-L-seryl-L-argininamide. Grade: ≥95%. CAS No. 150238-87-2. Molecular formula: C112H178N36O27. Mole weight: 2460.84. BOC Sciences
PAM Resin PAM Resin. Group: Unsubstituted resins. Alternative Names: 4- (Hydroxymethyl)phenylacetamidomethyl-polystyene. Pack Sizes: 5g, 25g. Alfa Chemistry Materials 3
Pamufetinib Pamufetinib (TAS-115) is a potent VEGFR and hepatocyte growth factor receptor ( c-Met/HGFR )-targeted kinase inhibitor with IC 50 s of 30 and 32 nM for rVEGFR2 and rMET, respectively. Uses: Scientific research. Group: Signaling pathways. Alternative Names: TAS-115. CAS No. 1190836-34-0. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-12423. MedChemExpress MCE
Pamufetinib mesylate Pamufetinib (TAS-115) mesylate is a potent VEGFR and hepatocyte growth factor receptor ( c-Met/HGFR )-targeted kinase inhibitor, with IC 50 s of 30 and 32 nM for rVEGFR2 and rMET, respectively. Uses: Scientific research. Group: Signaling pathways. Alternative Names: TAS-115 mesylate. CAS No. 1688673-09-7. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-12423A. MedChemExpress MCE
p-Amyl acetophenone p-Amyl acetophenone. Group: Liquid crystal (lc) building blocks. CAS No. 37593-02-5. Product ID: 1-(4-pentylphenyl)ethanone. Molecular formula: 190.28g/mol. Mole weight: C13H18O. CCCCCC1=CC=C(C=C1)C(=O)C. InChI=1S / C13H18O / c1-3-4-5-6-12-7-9-13 (10-8-12) 11 (2) 14 / h7-10H, 3-6H2, 1-2H3. KBKGPMDADJLBEM-UHFFFAOYSA-N. 96.0%(GC). Alfa Chemistry Materials 7
p-Amylpyridine p-Amylpyridine. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 4-n-Amylpyridine;4-Pentyl-pyridine. Product Category: Heterocyclic Organic Compound. CAS No. 2961-50-4. Molecular formula: C10H15N. Mole weight: 149.23. Purity: 0.96. IUPACName: 4-pentylpyridine. Canonical SMILES: CCCCCC1=CC=NC=C1. Density: 0.904g/cm³. ECNumber: 220-994-1. Product ID: ACM2961504. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 4
PAN Metal indicator and spectrophotometric reagent for transition metals. Group: Uv/visible (uv/vis) spectroscopy. Alternative Names: 1-(2-Pyridylazo)-2-naphthol. Alfa Chemistry Analytical Products 2
Panamine diperchlorate It comes from the seeds of the ormosia species. Synonyms: (1S,5R,5a1R,8aS,10S,10aR,15aR)-tetradecahydro-1H,6H,9H,15H-5a,14a,17-triaza-1,5:10,15a-dimethanodibenzo[b,fg]octalene diperchloric acid; (6ξ,18S,20R)-12,20-Cycloormosanine perchlorate (1:2); 15H-1,5-Imino-10,15a-methano-1H,6H,9H-5a,14a-diazadibenz[b,fg]octalene, tetradecahydro-, (1S,5R,8aS,10S,15aR,15bR)-, perchlorate (1:2). CAS No. 6011-96-7. Molecular formula: C20H33N3.2ClHO4. Mole weight: 516.41. BOC Sciences 12
Panaxadiol Panaxadiol (20(R)-Panaxadiol) is an orally active HIF-1α/STAT3 inhibitor. Panaxadiol can suppress HIF-1α and STAT3 then lead to downregulation of programmed cell death-ligand 1 (PD-L1) expression. Panaxadiol shows anticancer, cardioprotective, anti-arrhythmic, and antioxidative activities [1] [2]. Uses: Scientific research. Group: Natural products. Alternative Names: 20(R)-Panaxadiol. CAS No. 19666-76-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg. Product ID: HY-N0596. MedChemExpress MCE
Panaxadiol Panaxadiol. Group: Biochemicals. Alternative Names: NSC 308879; (20R)-20,25-Epoxydammarane-3 β,12 β-diol; (3 β,12 β,20R)-20,25-Epoxydammarane-3,12-diol. Grades: Highly Purified. CAS No. 19666-76-3. Pack Sizes: 10mg. Molecular Formula: C30H52O3, Molecular Weight: 460.73. US Biological Life Sciences. USBiological 3
Worldwide
Panaxadiol Panaxadiol, a triterpenoid compound extracted from roots of Panax ginseng C, a novel antitumor agent that regulates of cell cycle transition and induces apoptotic cells. Inhibites DNA synthesis in a dose-dependent manner (in SK-HEP-1 cells and HeLa cells: Synonyms: (3S,5R,8R,9R,10R,12R,13R,14R,17S)-4,4,8,10,14-pentamethyl-17-[(2R)-2,6,6-trimethyloxan-2-yl]-2,3,5,6,7,9,11,12,13,15,16,17-dodecahydro-1H-cyclopenta[a]phenanthrene-3,12-diol panaxadiol panaxadiol, (3beta,12beta)-isomer. Grade: >98%. CAS No. 19666-76-3. Molecular formula: C30H52O3. Mole weight: 460.73. BOC Sciences 9
Panaxatriol Panaxatriol, a natural product extracted from the roots of Panax ginseng C. A. Mey, with significant antiradiation effects it can relieve myelosuppression induced by radiation injury. It ameliorates I/R-induced myocardial damage by reducing oxidative stre. Synonyms: Dammarane-3,6,12-triol, 20,25-epoxy-,(3β,6β,12β,20R)-; Panoxatriol; (20R)-20,25-Epoxy-5α-dammarane-3β,6α,12β-triol; panaxatriol, (3beta,6alpha,12beta)-isomer. Grade: >98%. CAS No. 32791-84-7. Molecular formula: C30H52O4. Mole weight: 476.73. BOC Sciences 9
Panaxatriol Panaxatriol. Group: Biochemicals. Grades: Highly Purified. CAS No. 32791-84-7. Pack Sizes: 50mg, 100mg, 250mg, 500mg, 1g. Molecular Formula: C30H52O4. US Biological Life Sciences. USBiological 8
Worldwide
Panax ginseng extract Powder, tablets, granules. Health care cosmetics raw materials. Uses: Designed for use in research and industrial production. Product Category: Material of health food. Appearance: Off white powder. CAS No. 22427-39-0. Molecular formula: C42H72O14. Mole weight: 801.01. Product ID: ACM22427390. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry.
Panax Ginseng Extract Ginseng extract powder is prepared from the root of the slow-growing perennial plants Panax ginseng C. A. Mey. a plant of the family Araliaceae. Panax ginseng extract is rich in 18 kinds of ginsenosides, have effect on heart and blood vessel, and many tonic functions. Group: Others. Panax Ginseng Extract; Panax ginseng C. A. Mey. Cat No: EXTC-061. Creative Enzymes
Panax Ginseng P.E. 20% & 80% Ginsenosides UV Panax Ginseng P.E. 20% & 80% Ginsenosides UV. Pharma Resources International LLC
CA, FL & NJ
Panax Ginseng P.E. 4:1 Panax Ginseng P.E. 4:1. Pharma Resources International LLC
CA, FL & NJ
Panax Notoginseng Extract Panax notoginseng extract is prepared from the species of the genus Panax, also known as sanqi extract powder. Panax notoginseng extract powder contain high potency notoginsenoside, Ginsenoside Rb1, Ginsenoside Rg1, Ginsenoside Rd, Ginsenoside Re, and Ginsenoside Rb2, which are most active ingredients impacting on your overall health and nutritionally support healthy heart function, blood circulation, and performance. Group: Others. Mole weight: 933.14. Panax Notoginseng Extract; Panax Pseudo-Ginseng Wall. Var. Cat No: EXTC-016. Creative Enzymes
Panax Notoginseng Root and Rhizome Dry Extract United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards. Alfa Chemistry Analytical Products
Panaxydol Panaxydol. Group: Biochemicals. Alternative Names: 9,10-Epoxy-1-heptadecene-4,6-diyn-3-ol. Grades: Plant Grade. CAS No. 72800-72-7. Pack Sizes: 20mg. Molecular Formula: C17H24O2, Molecular Weight: 260.370999999999. US Biological Life Sciences. USBiological 9
Worldwide
Panaxynol Panaxynol. Group: Biochemicals. Alternative Names: Falcarinol; (R)-(-)-Falcarinol; Carotatoxin; (3R,9Z)-1,9-Heptadecadiene-4,6-diyn-3-ol; 21852-80-2. Grades: Plant Grade. CAS No. 81203-57-8. Pack Sizes: 10mg. Molecular Formula: C17H24O, Molecular Weight: 244.372. US Biological Life Sciences. USBiological 9
Worldwide
PANC-1 Transfection Reagent Transfection Reagent for PANC1 Non-endocrine Pancreatic Cancer Cells. Optimized transfection protocol provided for transfection of siRNA, DNA, mRNA, and microRNA. Transfection Reagents. Transfection Enhancer. Complex Condenser. Uses: Transfection of DNA, RNA, protein and small molecules. Product ID: 3226. Altogen
Nevada, Texas, USA
Panclicin A It is produced by the strain of Str. sp. NR 0619. It's an enzyme inhibitor. Synonyms: L-Alanine, N-formyl-, (1S)-1-[[(2S,3S)-3-(8-methylnonyl)-4-oxo-2-oxetanyl]methyl]octyl ester; L-Alanine, N-formyl-, 1-[[3-(8-methylnonyl)-4-oxo-2-oxetanyl]methyl]octyl ester, [2S-[2a[R*(R*)],3b]]-; (-)-Panclicin A. CAS No. 160669-37-4. Molecular formula: C26H47NO5. Mole weight: 453.65. BOC Sciences 12
Panclicin B It is produced by the strain of Str. sp. NR 0619. It's an enzyme inhibitor. Synonyms: L-Alanine, N-formyl-,(1S)-1-[[(2S,3S)-3-decyl-4-oxo-2-oxetanyl]methyl]octyl ester; L-Alanine, N-formyl-, 1-[(3-decyl-4-oxo-2-oxetanyl)methyl]octyl ester, [2S-[2a[R*(R*)],3b]]-; (-)-Panclicin B. CAS No. 160700-42-5. Molecular formula: C26H47NO5. Mole weight: 453.65. BOC Sciences 12
Panclicin C It is produced by the strain of Str. sp. NR 0619. It's an enzyme inhibitor. Synonyms: Glycine, N-formyl-, (1S)-1-[[(2S,3S)-3-(8-methylnonyl)-4-oxo-2-oxetanyl]methyl]octyl ester; Glycine, N-formyl-, 1-[[3-(8-methylnonyl)-4-oxo-2-oxetanyl]methyl]octyl ester, [2S-[2a(R*),3b]]-; (-)-Panclicin C. CAS No. 160669-43-2. Molecular formula: C25H45NO5. Mole weight: 439.63. BOC Sciences 12
Panclicin D It is produced by the strain of Str. sp. NR 0619. It's an enzyme inhibitor. Synonyms: (-)-Panclicin D. CAS No. 160669-44-3. Molecular formula: C25H45NO5. Mole weight: 439.63. BOC Sciences 12
Panclicin E It is produced by the strain of Str. sp. NR 0619. It's an enzyme inhibitor. Synonyms: Glycine, N-formyl-, (1S)-1-[[(2S,3S)-3-dodecyl-4-oxo-2-oxetanyl]methyl]octyl ester; Glycine, N-formyl-, 1-[(3-dodecyl-4-oxo-2-oxetanyl)methyl]octyl ester, [2S-[2a(R*),3b]]-; (-)-Panclicin E. CAS No. 160669-45-4. Molecular formula: C27H49NO5. Mole weight: 467.68. BOC Sciences 12
Pancreas, Rabbit Pancreas, Rabbit. Group: Biologicals. Grades: Tissue. Pack Sizes: 25Ea. US Biological Life Sciences. USBiological 1
Worldwide
Pancreas-targeted In Vivo Kit Pancreas-targeted in vivo transfection kit. Functionally tested in mice tissue-targeted delivery of siRNA and pDNA via IV,IP,IT administrations. Kit includes: Transfection Reagents. Transfection Enhancer reagent. Protocol for mice and rats. Uses: Transfection of DNA, RNA, protein and small molecules. Product ID: 5051. Altogen
Nevada, Texas, USA
Pancreatic Cancer Antibody Drug Conjugate Pancreatic Cancer Antibody Drug Conjugate. Group: Single wall cnt. >95% (SWNT). Alfa Chemistry Materials 3
pancreatic elastase Formed by activation of proelastase from mammalian pancreas by trypsin. In peptidase family S1 (trypsin family). Formerly included in EC 3.4.21.11. Group: Enzymes. Synonyms: pancreatopeptidase E; pancreatic elastase I; elastase; elaszym; serine elastase. Enzyme Commission Number: EC 3.4.21.36. CAS No. 9004-6-2. ELA1. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4130; pancreatic elastase; EC 3.4.21.36; 9004-06-2; pancreatopeptidase E; pancreatic elastase I; elastase; elaszym; serine elastase. Cat No: EXWM-4130. Creative Enzymes
pancreatic elastase II A peptidase of family S1 (trypsin family) formed by activation of proelastase II from mammalian pancreas by trypsin. Usually, only one of the pancreatic elastases (see also EC 3.4.21.36) is expressed in a given species; human pancreatic elastase is of type II. Group: Enzymes. Synonyms: pancreatic elastase 2. Enzyme Commission Number: EC 3.4.21.71. CAS No. 75603-19-9. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4163; pancreatic elastase II; EC 3.4.21.71; 75603-19-9; pancreatic elastase 2. Cat No: EXWM-4163. Creative Enzymes
pancreatic endopeptidase E A peptidase of family S1 (trypsin family) from pancreatic juice. Unlike elastases, has an acidic pI. Binds cholesterol. Group: Enzymes. Synonyms: cholesterol-binding proteinase; proteinase E; cholesterol-binding serine proteinase; pancreatic protease E; pancreatic proteinase E; cholesterol-binding pancreatic proteinase; CBPP; pancreas E proteinase. Enzyme Commission Number: EC 3.4.21.70. CAS No. 68073-27-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4162; pancreatic endopeptidase E; EC 3.4.21.70; 68073-27-8; cholesterol-binding proteinase; proteinase E; cholesterol-binding serine proteinase; pancreatic protease E; pancreatic proteinase E; cholesterol-binding pancreatic proteinase; CBPP; pancreas E proteinase. Cat No: EXWM-4162. Creative Enzymes
Pancreatic Microvascular Endothelial Cells, Human (Frozen) Passage 3 cells are shipped in proliferating culture with a confluence of >90%. ENDO-Growth medium containing 5% serum and growth supplement is recommended for culture. Cells have an average population doubling level of >16 when cultured. Group: Biologicals. Grades: Cell Culture Grade. Pack Sizes: 1ml. US Biological Life Sciences. USBiological 9
Worldwide
Pancreatic Microvascular Endothelial Cells, Human (T-25 flask) Passage 3 cells are shipped in proliferating culture with a confluence of >90%. ENDO-Growth medium containing 5% serum and growth supplement is recommended for culture. Cells have an average population doubling level of >16 when cultured. Group: Biologicals. Grades: Cell Culture Grade. Pack Sizes: T-25 flask. US Biological Life Sciences. USBiological 9
Worldwide
Pancreatic polypeptide Pancreatic polypeptide is a peptide secreted by the endocrine PP cells of the pancreas that regulates pancreatic secretory activity and also affects hepatic glycogen stores and gastrointestinal secretion [1]. Uses: Scientific research. Group: Peptides. CAS No. 59763-91-6. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P4060. MedChemExpress MCE
Pancreatic Polypeptide, bovine Pancreatic Polypeptide, bovine, a straight chain polypeptide containing 36 amino acids, derived primarily from the pancreas, and stimulates pancreatic secretion by inhibiting secretin and cholecystokinin. As the NPY receptor agonist, it has a high affinity at NPYR4. Synonyms: Ala-Pro-Leu-Glu-Pro-Glu-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Glu-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2; Pancreatic polypeptide (pig), 6-L-glutamic acid-; Bovine pancreatic polypeptide. Grade: ≥95%. CAS No. 179986-89-1. Molecular formula: C186H287N53O56S2. Mole weight: 4225.78. BOC Sciences
Pancreatic polypeptide(human) Pancreatic polypeptide(human). Uses: Designed for use in research and industrial production. Additional or Alternative Names: PANCREATIC POLYPEPTIDE;PANCREATIC POLYPEPTIDE, HUMAN;PP, HUMAN;APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2;H-ALA-PRO-LEU-GLU-PRO-VAL-TYR-PRO-GLY-ASP-ASN-ALA-THR-PRO-GLU-GLN-MET-ALA-GLN-TYR-ALA-ALA-ASP-LEU-ARG-ARG-TYR-ILE-ASN-MET-LEU-THR-ARG-PRO-ARG-TYR-NH2. Product Category: Heterocyclic Organic Compound. CAS No. 59763-91-6. Molecular formula: C185H287N53O54S2. Product ID: ACM59763916. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 5
Pancreatic Polypeptide (human) Pancreatic Polypeptide (human). Group: Biochemicals. Grades: Purified. CAS No. 75976-10-2. Pack Sizes: 200ug. US Biological Life Sciences. USBiological 5
Worldwide
Pancreatic Polypeptide, human Pancreatic polypeptide is an agonist of neuropeptide Y (NPY) receptors that reduces forskolin-induced cAMP accumulation in L-M(TK-) cells recombinantly expressing human and rat Y4 receptors (EC50s = 87.1 and 36.3 pM, respectively). It is believed to play an important role in the function of the gastrointestinal tract. Uses: Gastrointestinal agents. Synonyms: Human pancreatic polypeptide; L-alanyl-L-prolyl-L-leucyl-L-alpha-glutamyl-L-prolyl-L-valyl-L-tyrosyl-L-prolyl-glycyl-L-alpha-aspartyl-L-asparagyl-L-alanyl-L-threonyl-L-prolyl-L-alpha-glutamyl-L-glutaminyl-L-methionyl-L-alanyl-L-glutaminyl-L-tyrosyl-L-alanyl-L-alanyl-L-alpha-aspartyl-L-leucyl-L-arginyl-L-arginyl-L-tyrosyl-L-isoleucyl-L-asparagyl-L-methionyl-L-leucyl-L-threonyl-L-arginyl-L-prolyl-L-arginyl-L-tyrosinamide; Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2. Grade: ≥95%. CAS No. 75976-10-2. Molecular formula: C185H287N53O54S2. Mole weight: 4181.71. BOC Sciences

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products