A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
It is produced by the strain of Str. sp. NR 0619. It's an enzyme inhibitor. Synonyms: (-)-Panclicin D. CAS No. 160669-44-3. Molecular formula: C25H45NO5. Mole weight: 439.63.
Panclicin E
It is produced by the strain of Str. sp. NR 0619. It's an enzyme inhibitor. Synonyms: Glycine, N-formyl-, (1S)-1-[[(2S,3S)-3-dodecyl-4-oxo-2-oxetanyl]methyl]octyl ester; Glycine, N-formyl-, 1-[(3-dodecyl-4-oxo-2-oxetanyl)methyl]octyl ester, [2S-[2a(R*),3b]]-; (-)-Panclicin E. CAS No. 160669-45-4. Molecular formula: C27H49NO5. Mole weight: 467.68.
Pancreas, Rabbit
Pancreas, Rabbit. Group: Biologicals. Grades: Tissue. Pack Sizes: 25Ea. US Biological Life Sciences.
Worldwide
Pancreas-targeted In Vivo Kit
Pancreas-targeted in vivo transfection kit. Functionally tested in mice tissue-targeted delivery of siRNA and pDNA via IV,IP,IT administrations. Kit includes: Transfection Reagents. Transfection Enhancer reagent. Protocol for mice and rats. Uses: Transfection of DNA, RNA, protein and small molecules. Product ID: 5051.
Nevada, Texas, USA
Pancreatic Cancer Antibody Drug Conjugate
Pancreatic Cancer Antibody Drug Conjugate. Group: Single wall cnt. >95% (SWNT).
pancreatic elastase
Formed by activation of proelastase from mammalian pancreas by trypsin. In peptidase family S1 (trypsin family). Formerly included in EC 3.4.21.11. Group: Enzymes. Synonyms: pancreatopeptidase E; pancreatic elastase I; elastase; elaszym; serine elastase. Enzyme Commission Number: EC 3.4.21.36. CAS No. 9004-6-2. ELA1. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4130; pancreatic elastase; EC 3.4.21.36; 9004-06-2; pancreatopeptidase E; pancreatic elastase I; elastase; elaszym; serine elastase. Cat No: EXWM-4130.
pancreatic elastase II
A peptidase of family S1 (trypsin family) formed by activation of proelastase II from mammalian pancreas by trypsin. Usually, only one of the pancreatic elastases (see also EC 3.4.21.36) is expressed in a given species; human pancreatic elastase is of type II. Group: Enzymes. Synonyms: pancreatic elastase 2. Enzyme Commission Number: EC 3.4.21.71. CAS No. 75603-19-9. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4163; pancreatic elastase II; EC 3.4.21.71; 75603-19-9; pancreatic elastase 2. Cat No: EXWM-4163.
pancreatic endopeptidase E
A peptidase of family S1 (trypsin family) from pancreatic juice. Unlike elastases, has an acidic pI. Binds cholesterol. Group: Enzymes. Synonyms: cholesterol-binding proteinase; proteinase E; cholesterol-binding serine proteinase; pancreatic protease E; pancreatic proteinase E; cholesterol-binding pancreatic proteinase; CBPP; pancreas E proteinase. Enzyme Commission Number: EC 3.4.21.70. CAS No. 68073-27-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4162; pancreatic endopeptidase E; EC 3.4.21.70; 68073-27-8; cholesterol-binding proteinase; proteinase E; cholesterol-binding serine proteinase; pancreatic protease E; pancreatic proteinase E; cholesterol-binding pancreatic proteinase; CBPP; pancreas E proteinase. Cat No: EXWM-4162.
Pancreatic Microvascular Endothelial Cells, Human (Frozen)
Passage 3 cells are shipped in proliferating culture with a confluence of >90%. ENDO-Growth medium containing 5% serum and growth supplement is recommended for culture. Cells have an average population doubling level of >16 when cultured. Group: Biologicals. Grades: Cell Culture Grade. Pack Sizes: 1ml. US Biological Life Sciences.
Worldwide
Pancreatic Microvascular Endothelial Cells, Human (T-25 flask)
Passage 3 cells are shipped in proliferating culture with a confluence of >90%. ENDO-Growth medium containing 5% serum and growth supplement is recommended for culture. Cells have an average population doubling level of >16 when cultured. Group: Biologicals. Grades: Cell Culture Grade. Pack Sizes: T-25 flask. US Biological Life Sciences.
Worldwide
Pancreatic polypeptide
Pancreatic polypeptide is a peptide secreted by the endocrine PP cells of the pancreas that regulates pancreatic secretory activity and also affects hepatic glycogen stores and gastrointestinal secretion [1]. Uses: Scientific research. Group: Peptides. CAS No. 59763-91-6. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P4060.
Pancreatic Polypeptide, bovine
Pancreatic Polypeptide, bovine, a straight chain polypeptide containing 36 amino acids, derived primarily from the pancreas, and stimulates pancreatic secretion by inhibiting secretin and cholecystokinin. As the NPY receptor agonist, it has a high affinity at NPYR4. Synonyms: Ala-Pro-Leu-Glu-Pro-Glu-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Glu-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2; Pancreatic polypeptide (pig), 6-L-glutamic acid-; Bovine pancreatic polypeptide. Grade: ≥95%. CAS No. 179986-89-1. Molecular formula: C186H287N53O56S2. Mole weight: 4225.78.
Pancreatic polypeptide(human)
Pancreatic polypeptide(human). Uses: Designed for use in research and industrial production. Additional or Alternative Names: PANCREATIC POLYPEPTIDE;PANCREATIC POLYPEPTIDE, HUMAN;PP, HUMAN;APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2;H-ALA-PRO-LEU-GLU-PRO-VAL-TYR-PRO-GLY-ASP-ASN-ALA-THR-PRO-GLU-GLN-MET-ALA-GLN-TYR-ALA-ALA-ASP-LEU-ARG-ARG-TYR-ILE-ASN-MET-LEU-THR-ARG-PRO-ARG-TYR-NH2. Product Category: Heterocyclic Organic Compound. CAS No. 59763-91-6. Molecular formula: C185H287N53O54S2. Product ID: ACM59763916. Alfa Chemistry ISO 9001:2015 Certified.
Pancreatic Polypeptide (human)
Pancreatic Polypeptide (human). Group: Biochemicals. Grades: Purified. CAS No. 75976-10-2. Pack Sizes: 200ug. US Biological Life Sciences.
Worldwide
Pancreatic Polypeptide, human
Pancreatic Polypeptide, human is a C-terminally amidated 36 amino acid peptide, which acts as a neuropeptide Y ( NPY ) Y4 / Y5 receptor agonist. Uses: Scientific research. Group: Peptides. Alternative Names: Human pancreatic polypeptide. CAS No. 75976-10-2. Pack Sizes: 500 μg; 1 mg; 5 mg. Product ID: HY-P0199.
Pancreatic Polypeptide, human
Pancreatic polypeptide is an agonist of neuropeptide Y (NPY) receptors that reduces forskolin-induced cAMP accumulation in L-M(TK-) cells recombinantly expressing human and rat Y4 receptors (EC50s = 87.1 and 36.3 pM, respectively). It is believed to play an important role in the function of the gastrointestinal tract. Uses: Gastrointestinal agents. Synonyms: Human pancreatic polypeptide; L-alanyl-L-prolyl-L-leucyl-L-alpha-glutamyl-L-prolyl-L-valyl-L-tyrosyl-L-prolyl-glycyl-L-alpha-aspartyl-L-asparagyl-L-alanyl-L-threonyl-L-prolyl-L-alpha-glutamyl-L-glutaminyl-L-methionyl-L-alanyl-L-glutaminyl-L-tyrosyl-L-alanyl-L-alanyl-L-alpha-aspartyl-L-leucyl-L-arginyl-L-arginyl-L-tyrosyl-L-isoleucyl-L-asparagyl-L-methionyl-L-leucyl-L-threonyl-L-arginyl-L-prolyl-L-arginyl-L-tyrosinamide; Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2. Grade: ≥95%. CAS No. 75976-10-2. Molecular formula: C185H287N53O54S2. Mole weight: 4181.71.
Pancreatic Polypeptide, rat
Pancreatic Polypeptide, rat is an agonist of NPY receptor with high affinity at NPYR4. Synonyms: Rat pancreatic polypeptide; Ala-Pro-Leu-Glu-Pro-Met-Tyr-Pro-Gly-Asp-Tyr-Ala-Thr-His-Glu-Gln-Arg-Ala-Gln-Tyr-Glu-Thr-Gln-Leu-Arg-Arg-Tyr-Ile-Asn-Thr-Leu-Thr-Arg-Pro-Arg-Tyr-NH2; L-alanyl-L-prolyl-L-leucyl-L-alpha-glutamyl-L-prolyl-L-methionyl-L-tyrosyl-L-prolyl-glycyl-L-alpha-aspartyl-L-tyrosyl-L-alanyl-L-threonyl-L-histidyl-L-alpha-glutamyl-L-glutaminyl-L-arginyl-L-alanyl-L-glutaminyl-L-tyrosyl-L-alpha-glutamyl-L-threonyl-L-glutaminyl-L-leucyl-L-arginyl-L-arginyl-L-tyrosyl-L-isoleucyl-L-asparagyl-L-threonyl-L-leucyl-L-threonyl-L-arginyl-L-prolyl-L-arginyl-L-tyrosinamide. Grade: ≥95%. CAS No. 90419-12-8. Molecular formula: C195H298N58O57S. Mole weight: 4398.87.
pancreatic ribonuclease
Specifically, the enzymes are involved in endonucleolytic cleavage of 3'-phosphomononucleotides and 3'-phosphooligonucleotides ending in C-P or U-P with 2',3'-cyclic phosphate intermediates. Ribonuclease can unwind the RNA helix by complexing with single-stranded RNA; the complex arises by an extended multi-site cation-anion interaction between lysine and arginine residues of the enzyme and phosphate groups of the nucleotides. Group: Enzymes. Synonyms: RNase; RNase I; RNase A; pancreatic RNase; ribonuclease I; endoribonuclease I; ribonucleic phosphatase; alkaline ribonuclease; ribonuclease; gene S glycoproteins; Ceratitis capitata alkaline ribonuclease; SLSG glycoproteins; gen. glycoproteins; ribonucleate 3'-pyrimidino-oligonucleotidohydrolase. Enzyme Commission Number: EC 3.1.27.5. CAS No. 9001-99-4. Rnase. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3603; pancreatic ribonuclease; EC 3.1.27.5; 9001-99-4; RNase; RNase I; RNase A; pancreatic RNase; ribonuclease I; endoribonuclease I; ribonucleic phosphatase; alkaline ribonuclease; ribonuclease; gene S glycoproteins; Ceratitis capitata alkaline ribonuclease; SLSG glycoproteins; gene S locus-specific glycoproteins; S-genotype-asssocd. glycoproteins; ribonucleate 3'-pyrimidino-oligonucleotidohydrolase. Cat No: EXWM-3603.
Pancreatin
100g Pack Size. Group: Analytical Reagents, Biochemicals, Research Organics & Inorganics. CAS No. 8049-47-6. Prepack ID 90029842-100g. See USA prepack pricing.
Pancreatin
Pancreatin is the porcine pancreas extract (PPE) which contains the main pancreatic digestive enzymes. Uses: Scientific research. Group: Signaling pathways. CAS No. 8049-47-6. Pack Sizes: 500 mg; 1 g. Product ID: HY-B2118.
PANCREATIN. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PANCREATIN, 3X. Product Category: Heterocyclic Organic Compound. CAS No. 9046-39-3. Purity: 0.96. Product ID: ACM9046393. Alfa Chemistry ISO 9001:2015 Certified.
Pancreatin, 5% Aqueous, Laboratory Grade, 500 mL
Notes: Keep refrigerated. Health Risk: 1. Flammability: 1. Reactivity: 1. Grades: chem-grade laboratory. CAS No. 8049-47-6. Product ID: 878953. -- SOLD FOR EDUCATIONAL USE ONLY --
Pancreatin amylase and protease
United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards.
United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards.
Pancreatin, Powder, Laboratory Grade, 100 g
Notes: Keep refrigerated. Health Risk: 1. Flammability: 1. Reactivity: 0. Grades: chem-grade laboratory. CAS No. 8049-47-6. Product ID: 878929. -- SOLD FOR EDUCATIONAL USE ONLY --
Pancuronium bromide
United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards.
Pancuronium bromide Related Compound A
United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards.
Pancuronium bromide Related Compound B
United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards.
Pancuronium bromide Related Compound C
United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards.
Pancuronium dibromide
Pancuronium dibromide. Group: Biochemicals. Grades: Purified. CAS No. 15500-66-0. Pack Sizes: 10mg, 50mg. US Biological Life Sciences.
Worldwide
Pancuronium dibromide
Pancuronium dibromide, a bis-quaternary steroid, is a neuromuscular relaxant. Pancuronium dibromide inhibits neuromuscular transmission by competing with acetylcholine for binding sites on nACh receptors. Pancuronium dibromide also inhibits cardiac muscarinic receptors and has a sympathomimetic action [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. CAS No. 15500-66-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-B0429.
A highly potent competitive antagonist selective for nAChRs (IC50 = 5.5nM). A very potent non-depolarizing skeletal muscle relaxant but no sedative or analgesic effects. Group: Biochemicals. Grades: Highly Purified. CAS No. 15500-66-0. Pack Sizes: 10mg. Molecular Formula: C??H??N?O? Br?. US Biological Life Sciences.
Worldwide
Pandan Leaf Powder
Pandan Leaf Powder is made of pandan leaf as raw material and processed by spray drying technology. Product ID: CDF4-0227. Category: Flavour. Product Keywords: Flavor Enhancers; Pandan Leaf Powder; CDF4-0227; Flavour;. Grade: Food Grade. Color: Green powder. Physical State: powder. Storage: Room Temperature. Applications: Widely used in baking, pastry, meal replacement powder.
Pandinin-1
Pandinin-1 is an antimicrobial peptide found in Pandinus imperator (Emperor scorpion), and has antibacterial activity. Synonyms: pandinin 1; pin 1; Recombinant Pandinus imperator Pandinin-1. Grade: >85%. Molecular formula: C220H350N58O62. Mole weight: 4799.55.
Pandinin-2
Pandinin-2 is an antimicrobial peptide found in Pandinus imperator (Emperor scorpion), and has antibacterial activity. Synonyms: pandinin 2; pin 2; Recombinant Pandinus imperator Pandinin-2; Phe-Trp-Gly-Ala-Leu-Ala-Lys-Gly-Ala-Leu-Lys-Leu-Ile-Pro-Ser-Leu-Phe-Ser-Ser-Phe-Ser-Lys-Lys-Asp. Grade: ≥97%. Molecular formula: C126H195N29O31. Mole weight: 2612.11.
Panduratin. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Panduratin;Panduratin A;rel-(2,6-Dihydroxy-4-methoxyphenyl)[(1R,2S,6R)-3-methyl-2-(3-methyl-2-buten-1-yl)-6-phenyl-3-cyclohexen-1-yl]methanone. Product Category: Heterocyclic Organic Compound. CAS No. 89837-52-5. Molecular formula: C26H30O4. Mole weight: 0. Density: 1.128. Product ID: ACM89837525. Alfa Chemistry ISO 9001:2015 Certified.
Panepoxydone
from Lentinus conatus, ?95% (HPLC). Group: Fluorescence/luminescence spectroscopy.
Pangelin
Pangelin is a coumarin that can be found in Ducrosia anethifolia. Pangelin exhibits anti-mycobacterial and anti-tumor activities [1] [2]. Uses: Scientific research. Group: Natural products. CAS No. 33783-80-1. Pack Sizes: 1 mg; 5 mg. Product ID: HY-N8131.
Pangelin
Pangelin is a coumarin that can be found in Ducrosia anethifolia. Pangelin exhibits anti-mycobacterial and anti-tumor activities. Uses: Designed for use in research and industrial production. Product Category: Inhibitors. Appearance: Solid. CAS No. 33783-80-1. Molecular formula: C16H14O5. Mole weight: 286.28. Purity: ≥99.0%. Canonical SMILES: O=C1C=CC2=C(OC[C@H](O)C(C)=C)C3=C(OC=C3)C=C2O1. Product ID: ACM33783801. Alfa Chemistry ISO 9001:2015 Certified. Categories: Pangelinan.
Paniculal
Paniculal. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 7-methoxy-8-formylcoumarine; 7-methoxy-8-formylcoumarin; 8-formyl-7-methoxycoumarin; paniculal; 7-methoxy-2-oxo-2H-chromene-8-carbaldehyde. Product Category: Heterocyclic Organic Compound. CAS No. 6724-42-1. Molecular formula: C11H8O4. Mole weight: 204.179. Purity: 0.96. IUPACName: 7-methoxy-2-oxo-2H-chromene-8-carbaldehyde. Product ID: ACM6724421. Alfa Chemistry ISO 9001:2015 Certified. Categories: Panicularia.
Paniculidine A
Paniculidine A is isolated from the herbs of Murraya exotica L. Synonyms: 1H-Indole-3-butanoic acid,R-methyl-,methyl ester,(RR)-; 1H-Indole-3-butanoic acid, α-methyl-, methyl ester, (αR)-. Grade: 97%. CAS No. 97399-93-4. Molecular formula: C14H17NO2. Mole weight: 231.3.
Paniculidine B
Paniculidine B is isolated from the herbs of Murraya exotica L. Synonyms: (2R)-4-(1-Methoxy-1H-indol-3-yl)-2-methyl-1-butanol. Grade: > 95%. CAS No. 97399-94-5. Molecular formula: C14H19NO2. Mole weight: 233.3.
Paniculidine C
Paniculidine C is isolated from the herbs of Murraya exotica L. Synonyms: (R)-2-Methyl-4-(1H-indole-3-yl)-1-butanol. CAS No. 97399-95-6. Molecular formula: C13H17NO. Mole weight: 203.3.
Paniculoside I
Paniculoside I is isolated from the herbs of Stevia rebaudiana. Synonyms: (4alpha,15beta)-15-Hydroxykaur-16-en-18-oic acid beta-D-glucopyranosyl ester; 1-O-[(5β,8α,9β,10α,13α,15β)-15-Hydroxy-18-oxokaur-16-en-18-yl]-β- D-glucopyranose. Grade: > 95%. CAS No. 60129-63-7. Molecular formula: C26H40O8. Mole weight: 480.6.
Paniculoside II
Paniculoside II is a natural diterpenoid found in the herbs of Stevia rebaudiana. Synonyms: (4R,15R)-11β,15-Dihydroxykaur-16-en-18-oic acid [β-D-glucopyranosyl] ester; Kaur-16-en-18-oic acid, 11,15-dihydroxy-, β-D-glucopyranosyl ester, (4α,11β,15β)-. Grade: >97%. CAS No. 60129-64-8. Molecular formula: C26H40O9. Mole weight: 496.59.
Paniculoside III
Paniculoside III is a natural diterpenoid compound found in several plants. . Synonyms: (4R)-11β-Hydroxy-15-oxokaur-16-en-18-oic acid β-D-glucopyranosyl ester. Grade: >95%. CAS No. 60129-65-9. Molecular formula: C26H38O9. Mole weight: 494.57.
Panipenem-betamipron
Panipenem-betamipron. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Carbenin, Panipenem-betamipron, Papm-BP, Carbenin (TN), PAPM/BP, Panipenem mixture with betamipron, CID115235, LS-186953, D02509, 138240-65-0, 3-(1-(Acetimidoylpyrrolidin-3-yl)thio)-6-(1-hydroxyethyl)-7-oxo-1-azabicyclo(3.2.0)hept-2-ene-2-carboxylic acid combination with N-benzoyl-beta-alanine, beta-Alanine, N-benzoyl-, mixt. with (5R,6S)-6-((1R)-1-hydroxyethyl)-3-(((3S)-1-(1-iminoethyl)-3-pyrrolidinyl)thio)-7-oxo-1-azabicyclo(3.2.o)hept-2-ene-2-carboxylic acid, beta-Alanine, N-benzoyl-, mixt. with (5R-(3(S*),5alpha,6alpha(R*)))-6-(1-hydroxyethyl)-3-((1-(1-iminoethyl)-3-pyrrolidinyl)thio)-7-oxo-1-azabicyclo(3.2.o)hept-2-ene-2-carboxylic acid. Product Category: Heterocyclic Organic Compound. CAS No. 138240-65-0. Molecular formula: C25H32N4O7S. Mole weight: 532.609180 [g/mol]. Purity: 0.96. IUPACName: 3-benzamidopropanoic acid; (5R,6S)-3-[(3S)-1-ethanimidoylpyrrolidin-3-yl]sulfanyl-6-[(1R)-1-hydroxyethyl]-7-oxo-1-azabicyclo[3.2.0]hept-2-ene-2-carboxylic acid. Canonical SMILES: CC(C1C2CC(=C(N2C1=O)C(=O)O)SC3CCN(C3)C(=N)C)O.C1=CC=C(C=C1)C(=O)NCCC(=O)O. Product ID: ACM138240650. Alfa Chemistry ISO 9001:2015 Certified. Categories: Panipenem/betamipron.
p-Anisaldehyde. Group: Biochemicals. Alternative Names: Aubepine. Grades: Plant Grade. CAS No. 123-11-5. Pack Sizes: 100mg. Molecular Formula: C8H8O2, Molecular Weight: 136.148. US Biological Life Sciences.
Worldwide
P-Anisaldehyde
Liquid;Liquid;Liquid;colourless to slightly yellow liquid with a Intensely sweet, floral odour. Group: Liquid crystal (lc) building blocks. Alternative Names: Anisaldehyde; Benzaldehyde, 4-methoxy-; FEMA No. 2670. CAS No. 123-11-5. Product ID: 4-Methoxybenzaldehyde. Molecular formula: 136.15. Mole weight: C8H8O2. COC1=CC=C(C=C1)C=O. ZRSNZINYAWTAHE-UHFFFAOYSA-N. InChI=1S/C8H8O2/c1-10-8-4-2-7 (6-9)3-5-8/h2-6H, 1H3. 98%.
p-Anisaldehyde (4-Methoxybenzaldehyde)
100g Pack Size. Group: Analytical Reagents, Aroma Chemicals, Biochemicals, Building Blocks, Flavours and Fragrance Materials. Formula: C8H8O2. CAS No. 123-11-5. Prepack ID 51572749-100g. Molecular Weight 136.15. See USA prepack pricing.
p-Anisaldehyde (4-Methoxybenzaldehyde)
500g Pack Size. Group: Analytical Reagents, Aroma Chemicals, Biochemicals, Building Blocks, Flavours and Fragrance Materials. Formula: C8H8O2. CAS No. 123-11-5. Prepack ID 51572749-500g. Molecular Weight 136.15. See USA prepack pricing.
p-Anisaldehyde dimethyl acetal
p-Anisaldehyde dimethyl acetal. Group: Biochemicals. Alternative Names: 4-Methoxybenzaldehyde dimethyl acetal. Grades: Highly Purified. CAS No. 2186-92-7. Pack Sizes: 50g, 100g. US Biological Life Sciences.
Worldwide
p-Anisaldehyde dimethyl acetal 98+% (GC)
p-Anisaldehyde dimethyl acetal 98+% (GC). Group: Biochemicals. Grades: GC. Pack Sizes: 5g, 25g, 100g. US Biological Life Sciences.
Worldwide
p-Anisaldehyde, Reagent
Liquid;Liquid;Liquid;colourless to slightly yellow liquid with a Intensely sweet, floral odour. Group: Liquid crystal (lc) building blocks. CAS No. 123-11-5. Product ID: 4-methoxybenzaldehyde. Molecular formula: 136.15g/mol. Mole weight: C8H8O2. COC1=CC=C(C=C1)C=O. InChI=1S/C8H8O2/c1-10-8-4-2-7 (6-9)3-5-8/h2-6H, 1H3. ZRSNZINYAWTAHE-UHFFFAOYSA-N.
p-Anisic acid
100g Pack Size. Group: Building Blocks, Organics. Formula: CH3OC6H4COOH. CAS No. 100-09-4. Prepack ID 13899923-100g. Molecular Weight 152.15. See USA prepack pricing.
p-Anisic acid
p-Anisic acid (4-Methoxybenzoic acid) is an orally available tyrosinase inhibitor that has antioxidant, anti-anxiety, anti-inflammatory, anti-tumor, anti-diabetic, and preservative properties. p-Anisic acid can be used as a preservative in the cosmetics field [1] [2] [3] [4]. Uses: Scientific research. Group: Natural products. Alternative Names: 4-Methoxybenzoic acid; Draconic acid. CAS No. 100-09-4. Pack Sizes: 10 mM * 1 mL; 5 g; 10 g. Product ID: HY-N1394.
p-Anisic acid
500g Pack Size. Group: Building Blocks, Organics. Formula: CH3OC6H4COOH. CAS No. 100-09-4. Prepack ID 13899923-500g. Molecular Weight 152.15. See USA prepack pricing.
p-Anisic acid
analytical standard. Group: Flavor and fragrance standardspharma & vet compounds & metabolitespharma & vet compounds & metabolites.
P-Anisic Acid
Solid;Solid;white crystals with practically no odour. Group: Liquid crystal (lc) building blocks. Alternative Names: Draconic acid. CAS No. 100-09-4. Product ID: 4-Methoxybenzoic acid. Molecular formula: 152.15. Mole weight: C8H8O3. COC1=CC=C(C=C1)C(=O)O. InChI=1S/C8H8O3/c1-11-7-4-2-6 (3-5-7)8 (9)10/h2-5H, 1H3, (H, 9, 10). ZEYHEAKUIGZSGI-UHFFFAOYSA-N. 95%+.
p-Anisic acid (Standard)
p-Anisic acid (Standard) is the analytical standard of p-Anisic acid. This product is intended for research and analytical applications. p-Anisic acid (4-Methoxybenzoic acid) is one of the isomers of anisic acid, with anti-bacterial and antiseptic properties [1]. Uses: Scientific research. Group: Natural products. Alternative Names: 4-Methoxybenzoic acid (Standard); Draconic acid (Standard). CAS No. 100-09-4. Pack Sizes: 100 mg; 250 mg; 500 mg. Product ID: HY-N1394R.
p-Anisidine
p-Anisidine. Group: Biochemicals. Grades: Highly Purified. CAS No. 104-94-9. Pack Sizes: 10g. Molecular Formula: C7H9NO, Molecular Weight: 123.15. US Biological Life Sciences.
p-Anisil is a reagent used in the preparation of novel quinoxaline derivatives with anti-HIV activity. Synonyms: 4,4'-Dimethoxybenzil; Anisil. Grade: 95 %. CAS No. 1226-42-2. Molecular formula: C16H14O4. Mole weight: 270.28.
p-Anisoyl chloride
p-Anisoyl chloride. Group: Biochemicals. Grades: Highly Purified. CAS No. 100-07-2. Pack Sizes: 50g, 100g, 250g, 500g, 1kg. US Biological Life Sciences.
Worldwide
p-Anisylidenephthalide
Potential antianxiety agent. Group: Biochemicals. Alternative Names: 3- (4-Methoxybenzylidene) phthalide; 3- (4-Methoxybenzal) phthalide; 3-[ (4-Methoxyphenyl) methylene]-1 (3H) -isobenzofuranone. Grades: Highly Purified. CAS No. 4767-61-7. Pack Sizes: 500mg. US Biological Life Sciences.
Worldwide
p-Anisylpyridazone
An Intermediate for the synthesis of the drug Gabazine, as well as several analgesic pharmaceuticals. Group: Biochemicals. Alternative Names: 6-(4-Methoxyphenyl)-3(2H)-pyridazinone; 6-(p-Methoxyphenyl)-3(2H)-pyridazinone. Grades: Highly Purified. CAS No. 2166-33-8. Pack Sizes: 500mg. US Biological Life Sciences.