American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
Panclicin D It is produced by the strain of Str. sp. NR 0619. It's an enzyme inhibitor. Synonyms: (-)-Panclicin D. CAS No. 160669-44-3. Molecular formula: C25H45NO5. Mole weight: 439.63. BOC Sciences 12
Panclicin E It is produced by the strain of Str. sp. NR 0619. It's an enzyme inhibitor. Synonyms: Glycine, N-formyl-, (1S)-1-[[(2S,3S)-3-dodecyl-4-oxo-2-oxetanyl]methyl]octyl ester; Glycine, N-formyl-, 1-[(3-dodecyl-4-oxo-2-oxetanyl)methyl]octyl ester, [2S-[2a(R*),3b]]-; (-)-Panclicin E. CAS No. 160669-45-4. Molecular formula: C27H49NO5. Mole weight: 467.68. BOC Sciences 12
Pancreas, Rabbit Pancreas, Rabbit. Group: Biologicals. Grades: Tissue. Pack Sizes: 25Ea. US Biological Life Sciences. USBiological 1
Worldwide
Pancreas-targeted In Vivo Kit Pancreas-targeted in vivo transfection kit. Functionally tested in mice tissue-targeted delivery of siRNA and pDNA via IV,IP,IT administrations. Kit includes: Transfection Reagents. Transfection Enhancer reagent. Protocol for mice and rats. Uses: Transfection of DNA, RNA, protein and small molecules. Product ID: 5051. Altogen
Nevada, Texas, USA
Pancreatic Cancer Antibody Drug Conjugate Pancreatic Cancer Antibody Drug Conjugate. Group: Single wall cnt. >95% (SWNT). Alfa Chemistry Materials 3
pancreatic elastase Formed by activation of proelastase from mammalian pancreas by trypsin. In peptidase family S1 (trypsin family). Formerly included in EC 3.4.21.11. Group: Enzymes. Synonyms: pancreatopeptidase E; pancreatic elastase I; elastase; elaszym; serine elastase. Enzyme Commission Number: EC 3.4.21.36. CAS No. 9004-6-2. ELA1. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4130; pancreatic elastase; EC 3.4.21.36; 9004-06-2; pancreatopeptidase E; pancreatic elastase I; elastase; elaszym; serine elastase. Cat No: EXWM-4130. Creative Enzymes
pancreatic elastase II A peptidase of family S1 (trypsin family) formed by activation of proelastase II from mammalian pancreas by trypsin. Usually, only one of the pancreatic elastases (see also EC 3.4.21.36) is expressed in a given species; human pancreatic elastase is of type II. Group: Enzymes. Synonyms: pancreatic elastase 2. Enzyme Commission Number: EC 3.4.21.71. CAS No. 75603-19-9. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4163; pancreatic elastase II; EC 3.4.21.71; 75603-19-9; pancreatic elastase 2. Cat No: EXWM-4163. Creative Enzymes
pancreatic endopeptidase E A peptidase of family S1 (trypsin family) from pancreatic juice. Unlike elastases, has an acidic pI. Binds cholesterol. Group: Enzymes. Synonyms: cholesterol-binding proteinase; proteinase E; cholesterol-binding serine proteinase; pancreatic protease E; pancreatic proteinase E; cholesterol-binding pancreatic proteinase; CBPP; pancreas E proteinase. Enzyme Commission Number: EC 3.4.21.70. CAS No. 68073-27-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4162; pancreatic endopeptidase E; EC 3.4.21.70; 68073-27-8; cholesterol-binding proteinase; proteinase E; cholesterol-binding serine proteinase; pancreatic protease E; pancreatic proteinase E; cholesterol-binding pancreatic proteinase; CBPP; pancreas E proteinase. Cat No: EXWM-4162. Creative Enzymes
Pancreatic Microvascular Endothelial Cells, Human (Frozen) Passage 3 cells are shipped in proliferating culture with a confluence of >90%. ENDO-Growth medium containing 5% serum and growth supplement is recommended for culture. Cells have an average population doubling level of >16 when cultured. Group: Biologicals. Grades: Cell Culture Grade. Pack Sizes: 1ml. US Biological Life Sciences. USBiological 9
Worldwide
Pancreatic Microvascular Endothelial Cells, Human (T-25 flask) Passage 3 cells are shipped in proliferating culture with a confluence of >90%. ENDO-Growth medium containing 5% serum and growth supplement is recommended for culture. Cells have an average population doubling level of >16 when cultured. Group: Biologicals. Grades: Cell Culture Grade. Pack Sizes: T-25 flask. US Biological Life Sciences. USBiological 9
Worldwide
Pancreatic polypeptide Pancreatic polypeptide is a peptide secreted by the endocrine PP cells of the pancreas that regulates pancreatic secretory activity and also affects hepatic glycogen stores and gastrointestinal secretion [1]. Uses: Scientific research. Group: Peptides. CAS No. 59763-91-6. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P4060. MedChemExpress MCE
Pancreatic Polypeptide, bovine Pancreatic Polypeptide, bovine, a straight chain polypeptide containing 36 amino acids, derived primarily from the pancreas, and stimulates pancreatic secretion by inhibiting secretin and cholecystokinin. As the NPY receptor agonist, it has a high affinity at NPYR4. Synonyms: Ala-Pro-Leu-Glu-Pro-Glu-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Glu-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2; Pancreatic polypeptide (pig), 6-L-glutamic acid-; Bovine pancreatic polypeptide. Grade: ≥95%. CAS No. 179986-89-1. Molecular formula: C186H287N53O56S2. Mole weight: 4225.78. BOC Sciences
Pancreatic polypeptide(human) Pancreatic polypeptide(human). Uses: Designed for use in research and industrial production. Additional or Alternative Names: PANCREATIC POLYPEPTIDE;PANCREATIC POLYPEPTIDE, HUMAN;PP, HUMAN;APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2;H-ALA-PRO-LEU-GLU-PRO-VAL-TYR-PRO-GLY-ASP-ASN-ALA-THR-PRO-GLU-GLN-MET-ALA-GLN-TYR-ALA-ALA-ASP-LEU-ARG-ARG-TYR-ILE-ASN-MET-LEU-THR-ARG-PRO-ARG-TYR-NH2. Product Category: Heterocyclic Organic Compound. CAS No. 59763-91-6. Molecular formula: C185H287N53O54S2. Product ID: ACM59763916. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 5
Pancreatic Polypeptide (human) Pancreatic Polypeptide (human). Group: Biochemicals. Grades: Purified. CAS No. 75976-10-2. Pack Sizes: 200ug. US Biological Life Sciences. USBiological 5
Worldwide
Pancreatic Polypeptide, human Pancreatic Polypeptide, human is a C-terminally amidated 36 amino acid peptide, which acts as a neuropeptide Y ( NPY ) Y4 / Y5 receptor agonist. Uses: Scientific research. Group: Peptides. Alternative Names: Human pancreatic polypeptide. CAS No. 75976-10-2. Pack Sizes: 500 μg; 1 mg; 5 mg. Product ID: HY-P0199. MedChemExpress MCE
Pancreatic Polypeptide, human Pancreatic polypeptide is an agonist of neuropeptide Y (NPY) receptors that reduces forskolin-induced cAMP accumulation in L-M(TK-) cells recombinantly expressing human and rat Y4 receptors (EC50s = 87.1 and 36.3 pM, respectively). It is believed to play an important role in the function of the gastrointestinal tract. Uses: Gastrointestinal agents. Synonyms: Human pancreatic polypeptide; L-alanyl-L-prolyl-L-leucyl-L-alpha-glutamyl-L-prolyl-L-valyl-L-tyrosyl-L-prolyl-glycyl-L-alpha-aspartyl-L-asparagyl-L-alanyl-L-threonyl-L-prolyl-L-alpha-glutamyl-L-glutaminyl-L-methionyl-L-alanyl-L-glutaminyl-L-tyrosyl-L-alanyl-L-alanyl-L-alpha-aspartyl-L-leucyl-L-arginyl-L-arginyl-L-tyrosyl-L-isoleucyl-L-asparagyl-L-methionyl-L-leucyl-L-threonyl-L-arginyl-L-prolyl-L-arginyl-L-tyrosinamide; Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2. Grade: ≥95%. CAS No. 75976-10-2. Molecular formula: C185H287N53O54S2. Mole weight: 4181.71. BOC Sciences
Pancreatic Polypeptide, rat Pancreatic Polypeptide, rat is an agonist of NPY receptor with high affinity at NPYR4. Synonyms: Rat pancreatic polypeptide; Ala-Pro-Leu-Glu-Pro-Met-Tyr-Pro-Gly-Asp-Tyr-Ala-Thr-His-Glu-Gln-Arg-Ala-Gln-Tyr-Glu-Thr-Gln-Leu-Arg-Arg-Tyr-Ile-Asn-Thr-Leu-Thr-Arg-Pro-Arg-Tyr-NH2; L-alanyl-L-prolyl-L-leucyl-L-alpha-glutamyl-L-prolyl-L-methionyl-L-tyrosyl-L-prolyl-glycyl-L-alpha-aspartyl-L-tyrosyl-L-alanyl-L-threonyl-L-histidyl-L-alpha-glutamyl-L-glutaminyl-L-arginyl-L-alanyl-L-glutaminyl-L-tyrosyl-L-alpha-glutamyl-L-threonyl-L-glutaminyl-L-leucyl-L-arginyl-L-arginyl-L-tyrosyl-L-isoleucyl-L-asparagyl-L-threonyl-L-leucyl-L-threonyl-L-arginyl-L-prolyl-L-arginyl-L-tyrosinamide. Grade: ≥95%. CAS No. 90419-12-8. Molecular formula: C195H298N58O57S. Mole weight: 4398.87. BOC Sciences
pancreatic ribonuclease Specifically, the enzymes are involved in endonucleolytic cleavage of 3'-phosphomononucleotides and 3'-phosphooligonucleotides ending in C-P or U-P with 2',3'-cyclic phosphate intermediates. Ribonuclease can unwind the RNA helix by complexing with single-stranded RNA; the complex arises by an extended multi-site cation-anion interaction between lysine and arginine residues of the enzyme and phosphate groups of the nucleotides. Group: Enzymes. Synonyms: RNase; RNase I; RNase A; pancreatic RNase; ribonuclease I; endoribonuclease I; ribonucleic phosphatase; alkaline ribonuclease; ribonuclease; gene S glycoproteins; Ceratitis capitata alkaline ribonuclease; SLSG glycoproteins; gen. glycoproteins; ribonucleate 3'-pyrimidino-oligonucleotidohydrolase. Enzyme Commission Number: EC 3.1.27.5. CAS No. 9001-99-4. Rnase. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3603; pancreatic ribonuclease; EC 3.1.27.5; 9001-99-4; RNase; RNase I; RNase A; pancreatic RNase; ribonuclease I; endoribonuclease I; ribonucleic phosphatase; alkaline ribonuclease; ribonuclease; gene S glycoproteins; Ceratitis capitata alkaline ribonuclease; SLSG glycoproteins; gene S locus-specific glycoproteins; S-genotype-asssocd. glycoproteins; ribonucleate 3'-pyrimidino-oligonucleotidohydrolase. Cat No: EXWM-3603. Creative Enzymes
Pancreatin 100g Pack Size. Group: Analytical Reagents, Biochemicals, Research Organics & Inorganics. CAS No. 8049-47-6. Prepack ID 90029842-100g. See USA prepack pricing. Molekula Americas
Pancreatin Pancreatin is the porcine pancreas extract (PPE) which contains the main pancreatic digestive enzymes. Uses: Scientific research. Group: Signaling pathways. CAS No. 8049-47-6. Pack Sizes: 500 mg; 1 g. Product ID: HY-B2118. MedChemExpress MCE
Pancreatin Pancreatin. Alternative Names: beefviokase;diastasevera;ilozyme;intrazyme;PANCREATIN;PANCREATIN, 3X;PANCREATIN 4X NF. CAS No. 8049-47-6. Product ID: PIPE-0360. EINECS: 232-468-9. SMILES: C1COCCN1C(=O)CS(=O)(=O)CC2=CC=CC=C2. Appearance: Powder. Standard: USP. Category: Natural Extract. Protheragen
PANCREATIN PANCREATIN. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PANCREATIN, 3X. Product Category: Heterocyclic Organic Compound. CAS No. 9046-39-3. Purity: 0.96. Product ID: ACM9046393. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 4
Pancreatin, 5% Aqueous, Laboratory Grade, 500 mL Notes: Keep refrigerated. Health Risk: 1. Flammability: 1. Reactivity: 1. Grades: chem-grade laboratory. CAS No. 8049-47-6. Product ID: 878953. -- SOLD FOR EDUCATIONAL USE ONLY -- Carolina Biological Supply Company
Pancreatin amylase and protease United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards. Alfa Chemistry Analytical Products
Pancreatin from porcine pancreas ?3 × USP specifications. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Pancreatin lipase United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards. Alfa Chemistry Analytical Products
Pancreatin, Powder, Laboratory Grade, 100 g Notes: Keep refrigerated. Health Risk: 1. Flammability: 1. Reactivity: 0. Grades: chem-grade laboratory. CAS No. 8049-47-6. Product ID: 878929. -- SOLD FOR EDUCATIONAL USE ONLY -- Carolina Biological Supply Company
Pancuronium bromide United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards. Alfa Chemistry Analytical Products 2
Pancuronium bromide Related Compound A United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards. Alfa Chemistry Analytical Products 2
Pancuronium bromide Related Compound B United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards. Alfa Chemistry Analytical Products 2
Pancuronium bromide Related Compound C United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards. Alfa Chemistry Analytical Products 2
Pancuronium dibromide Pancuronium dibromide. Group: Biochemicals. Grades: Purified. CAS No. 15500-66-0. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
Pancuronium dibromide Pancuronium dibromide, a bis-quaternary steroid, is a neuromuscular relaxant. Pancuronium dibromide inhibits neuromuscular transmission by competing with acetylcholine for binding sites on nACh receptors. Pancuronium dibromide also inhibits cardiac muscarinic receptors and has a sympathomimetic action [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. CAS No. 15500-66-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-B0429. MedChemExpress MCE
Pancuronium Dibromide (1,1'-(3alpha,17beta-Dihydroxy-2alpha,5beta-androstan-2-beta,16beta-ylene) bis[1-methylpiperidinium] Diacetate Dibromide, Nicotinic Acetylchorine Receptor Antagonist, Pancuronium Dibromide, nAChR Antagonist, Pancuronium Dibromide) A highly potent competitive antagonist selective for nAChRs (IC50 = 5.5nM). A very potent non-depolarizing skeletal muscle relaxant but no sedative or analgesic effects. Group: Biochemicals. Grades: Highly Purified. CAS No. 15500-66-0. Pack Sizes: 10mg. Molecular Formula: C??H??N?O? Br?. US Biological Life Sciences. USBiological 4
Worldwide
Pandan Leaf Powder Pandan Leaf Powder is made of pandan leaf as raw material and processed by spray drying technology. Product ID: CDF4-0227. Category: Flavour. Product Keywords: Flavor Enhancers; Pandan Leaf Powder; CDF4-0227; Flavour;. Grade: Food Grade. Color: Green powder. Physical State: powder. Storage: Room Temperature. Applications: Widely used in baking, pastry, meal replacement powder. CD Formulation
Pandinin-1 Pandinin-1 is an antimicrobial peptide found in Pandinus imperator (Emperor scorpion), and has antibacterial activity. Synonyms: pandinin 1; pin 1; Recombinant Pandinus imperator Pandinin-1. Grade: >85%. Molecular formula: C220H350N58O62. Mole weight: 4799.55. BOC Sciences 11
Pandinin-2 Pandinin-2 is an antimicrobial peptide found in Pandinus imperator (Emperor scorpion), and has antibacterial activity. Synonyms: pandinin 2; pin 2; Recombinant Pandinus imperator Pandinin-2; Phe-Trp-Gly-Ala-Leu-Ala-Lys-Gly-Ala-Leu-Lys-Leu-Ile-Pro-Ser-Leu-Phe-Ser-Ser-Phe-Ser-Lys-Lys-Asp. Grade: ≥97%. Molecular formula: C126H195N29O31. Mole weight: 2612.11. BOC Sciences 11
Pandinotoxin-K? >99%, powder. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
Panduratin Panduratin. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Panduratin;Panduratin A;rel-(2,6-Dihydroxy-4-methoxyphenyl)[(1R,2S,6R)-3-methyl-2-(3-methyl-2-buten-1-yl)-6-phenyl-3-cyclohexen-1-yl]methanone. Product Category: Heterocyclic Organic Compound. CAS No. 89837-52-5. Molecular formula: C26H30O4. Mole weight: 0. Density: 1.128. Product ID: ACM89837525. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 3
Panepoxydone from Lentinus conatus, ?95% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
Pangelin Pangelin is a coumarin that can be found in Ducrosia anethifolia. Pangelin exhibits anti-mycobacterial and anti-tumor activities [1] [2]. Uses: Scientific research. Group: Natural products. CAS No. 33783-80-1. Pack Sizes: 1 mg; 5 mg. Product ID: HY-N8131. MedChemExpress MCE
Pangelin Pangelin is a coumarin that can be found in Ducrosia anethifolia. Pangelin exhibits anti-mycobacterial and anti-tumor activities. Uses: Designed for use in research and industrial production. Product Category: Inhibitors. Appearance: Solid. CAS No. 33783-80-1. Molecular formula: C16H14O5. Mole weight: 286.28. Purity: ≥99.0%. Canonical SMILES: O=C1C=CC2=C(OC[C@H](O)C(C)=C)C3=C(OC=C3)C=C2O1. Product ID: ACM33783801. Alfa Chemistry — ISO 9001:2015 Certified. Categories: Pangelinan. Alfa Chemistry.
Paniculal Paniculal. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 7-methoxy-8-formylcoumarine; 7-methoxy-8-formylcoumarin; 8-formyl-7-methoxycoumarin; paniculal; 7-methoxy-2-oxo-2H-chromene-8-carbaldehyde. Product Category: Heterocyclic Organic Compound. CAS No. 6724-42-1. Molecular formula: C11H8O4. Mole weight: 204.179. Purity: 0.96. IUPACName: 7-methoxy-2-oxo-2H-chromene-8-carbaldehyde. Product ID: ACM6724421. Alfa Chemistry — ISO 9001:2015 Certified. Categories: Panicularia. Alfa Chemistry. 3
Paniculidine A Paniculidine A is isolated from the herbs of Murraya exotica L. Synonyms: 1H-Indole-3-butanoic acid,R-methyl-,methyl ester,(RR)-; 1H-Indole-3-butanoic acid, α-methyl-, methyl ester, (αR)-. Grade: 97%. CAS No. 97399-93-4. Molecular formula: C14H17NO2. Mole weight: 231.3. BOC Sciences 9
Paniculidine B Paniculidine B is isolated from the herbs of Murraya exotica L. Synonyms: (2R)-4-(1-Methoxy-1H-indol-3-yl)-2-methyl-1-butanol. Grade: > 95%. CAS No. 97399-94-5. Molecular formula: C14H19NO2. Mole weight: 233.3. BOC Sciences 9
Paniculidine C Paniculidine C is isolated from the herbs of Murraya exotica L. Synonyms: (R)-2-Methyl-4-(1H-indole-3-yl)-1-butanol. CAS No. 97399-95-6. Molecular formula: C13H17NO. Mole weight: 203.3. BOC Sciences 9
Paniculoside I Paniculoside I is isolated from the herbs of Stevia rebaudiana. Synonyms: (4alpha,15beta)-15-Hydroxykaur-16-en-18-oic acid beta-D-glucopyranosyl ester; 1-O-[(5β,8α,9β,10α,13α,15β)-15-Hydroxy-18-oxokaur-16-en-18-yl]-β- D-glucopyranose. Grade: > 95%. CAS No. 60129-63-7. Molecular formula: C26H40O8. Mole weight: 480.6. BOC Sciences 9
Paniculoside II Paniculoside II is a natural diterpenoid found in the herbs of Stevia rebaudiana. Synonyms: (4R,15R)-11β,15-Dihydroxykaur-16-en-18-oic acid [β-D-glucopyranosyl] ester; Kaur-16-en-18-oic acid, 11,15-dihydroxy-, β-D-glucopyranosyl ester, (4α,11β,15β)-. Grade: >97%. CAS No. 60129-64-8. Molecular formula: C26H40O9. Mole weight: 496.59. BOC Sciences 9
Paniculoside III Paniculoside III is a natural diterpenoid compound found in several plants. . Synonyms: (4R)-11β-Hydroxy-15-oxokaur-16-en-18-oic acid β-D-glucopyranosyl ester. Grade: >95%. CAS No. 60129-65-9. Molecular formula: C26H38O9. Mole weight: 494.57. BOC Sciences 9
Panipenem-betamipron Panipenem-betamipron. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Carbenin, Panipenem-betamipron, Papm-BP, Carbenin (TN), PAPM/BP, Panipenem mixture with betamipron, CID115235, LS-186953, D02509, 138240-65-0, 3-(1-(Acetimidoylpyrrolidin-3-yl)thio)-6-(1-hydroxyethyl)-7-oxo-1-azabicyclo(3.2.0)hept-2-ene-2-carboxylic acid combination with N-benzoyl-beta-alanine, beta-Alanine, N-benzoyl-, mixt. with (5R,6S)-6-((1R)-1-hydroxyethyl)-3-(((3S)-1-(1-iminoethyl)-3-pyrrolidinyl)thio)-7-oxo-1-azabicyclo(3.2.o)hept-2-ene-2-carboxylic acid, beta-Alanine, N-benzoyl-, mixt. with (5R-(3(S*),5alpha,6alpha(R*)))-6-(1-hydroxyethyl)-3-((1-(1-iminoethyl)-3-pyrrolidinyl)thio)-7-oxo-1-azabicyclo(3.2.o)hept-2-ene-2-carboxylic acid. Product Category: Heterocyclic Organic Compound. CAS No. 138240-65-0. Molecular formula: C25H32N4O7S. Mole weight: 532.609180 [g/mol]. Purity: 0.96. IUPACName: 3-benzamidopropanoic acid; (5R,6S)-3-[(3S)-1-ethanimidoylpyrrolidin-3-yl]sulfanyl-6-[(1R)-1-hydroxyethyl]-7-oxo-1-azabicyclo[3.2.0]hept-2-ene-2-carboxylic acid. Canonical SMILES: CC(C1C2CC(=C(N2C1=O)C(=O)O)SC3CCN(C3)C(=N)C)O.C1=CC=C(C=C1)C(=O)NCCC(=O)O. Product ID: ACM138240650. Alfa Chemistry — ISO 9001:2015 Certified. Categories: Panipenem/betamipron. Alfa Chemistry. 3
p-Anisaldehyde primary reference standard. Group: Herbal medicinal products standards. Alfa Chemistry Analytical Products
p-Anisaldehyde p-Anisaldehyde. Group: Biochemicals. Alternative Names: Aubepine. Grades: Plant Grade. CAS No. 123-11-5. Pack Sizes: 100mg. Molecular Formula: C8H8O2, Molecular Weight: 136.148. US Biological Life Sciences. USBiological 9
Worldwide
P-Anisaldehyde Liquid;Liquid;Liquid;colourless to slightly yellow liquid with a Intensely sweet, floral odour. Group: Liquid crystal (lc) building blocks. Alternative Names: Anisaldehyde; Benzaldehyde, 4-methoxy-; FEMA No. 2670. CAS No. 123-11-5. Product ID: 4-Methoxybenzaldehyde. Molecular formula: 136.15. Mole weight: C8H8O2. COC1=CC=C(C=C1)C=O. ZRSNZINYAWTAHE-UHFFFAOYSA-N. InChI=1S/C8H8O2/c1-10-8-4-2-7 (6-9)3-5-8/h2-6H, 1H3. 98%. Alfa Chemistry Materials 5
p-Anisaldehyde (4-Methoxybenzaldehyde) 100g Pack Size. Group: Analytical Reagents, Aroma Chemicals, Biochemicals, Building Blocks, Flavours and Fragrance Materials. Formula: C8H8O2. CAS No. 123-11-5. Prepack ID 51572749-100g. Molecular Weight 136.15. See USA prepack pricing. Molekula Americas
p-Anisaldehyde (4-Methoxybenzaldehyde) 500g Pack Size. Group: Analytical Reagents, Aroma Chemicals, Biochemicals, Building Blocks, Flavours and Fragrance Materials. Formula: C8H8O2. CAS No. 123-11-5. Prepack ID 51572749-500g. Molecular Weight 136.15. See USA prepack pricing. Molekula Americas
p-Anisaldehyde dimethyl acetal p-Anisaldehyde dimethyl acetal. Group: Biochemicals. Alternative Names: 4-Methoxybenzaldehyde dimethyl acetal. Grades: Highly Purified. CAS No. 2186-92-7. Pack Sizes: 50g, 100g. US Biological Life Sciences. USBiological 6
Worldwide
p-Anisaldehyde dimethyl acetal 98+% (GC) p-Anisaldehyde dimethyl acetal 98+% (GC). Group: Biochemicals. Grades: GC. Pack Sizes: 5g, 25g, 100g. US Biological Life Sciences. USBiological 5
Worldwide
p-Anisaldehyde, Reagent Liquid;Liquid;Liquid;colourless to slightly yellow liquid with a Intensely sweet, floral odour. Group: Liquid crystal (lc) building blocks. CAS No. 123-11-5. Product ID: 4-methoxybenzaldehyde. Molecular formula: 136.15g/mol. Mole weight: C8H8O2. COC1=CC=C(C=C1)C=O. InChI=1S/C8H8O2/c1-10-8-4-2-7 (6-9)3-5-8/h2-6H, 1H3. ZRSNZINYAWTAHE-UHFFFAOYSA-N. Alfa Chemistry Materials 5
p-Anisic acid 100g Pack Size. Group: Building Blocks, Organics. Formula: CH3OC6H4COOH. CAS No. 100-09-4. Prepack ID 13899923-100g. Molecular Weight 152.15. See USA prepack pricing. Molekula Americas
p-Anisic acid p-Anisic acid (4-Methoxybenzoic acid) is an orally available tyrosinase inhibitor that has antioxidant, anti-anxiety, anti-inflammatory, anti-tumor, anti-diabetic, and preservative properties. p-Anisic acid can be used as a preservative in the cosmetics field [1] [2] [3] [4]. Uses: Scientific research. Group: Natural products. Alternative Names: 4-Methoxybenzoic acid; Draconic acid. CAS No. 100-09-4. Pack Sizes: 10 mM * 1 mL; 5 g; 10 g. Product ID: HY-N1394. MedChemExpress MCE
p-Anisic acid 500g Pack Size. Group: Building Blocks, Organics. Formula: CH3OC6H4COOH. CAS No. 100-09-4. Prepack ID 13899923-500g. Molecular Weight 152.15. See USA prepack pricing. Molekula Americas
p-Anisic acid analytical standard. Group: Flavor and fragrance standardspharma & vet compounds & metabolitespharma & vet compounds & metabolites. Alfa Chemistry Analytical Products 2
P-Anisic Acid Solid;Solid;white crystals with practically no odour. Group: Liquid crystal (lc) building blocks. Alternative Names: Draconic acid. CAS No. 100-09-4. Product ID: 4-Methoxybenzoic acid. Molecular formula: 152.15. Mole weight: C8H8O3. COC1=CC=C(C=C1)C(=O)O. InChI=1S/C8H8O3/c1-11-7-4-2-6 (3-5-7)8 (9)10/h2-5H, 1H3, (H, 9, 10). ZEYHEAKUIGZSGI-UHFFFAOYSA-N. 95%+. Alfa Chemistry Materials 5
p-Anisic acid (Standard) p-Anisic acid (Standard) is the analytical standard of p-Anisic acid. This product is intended for research and analytical applications. p-Anisic acid (4-Methoxybenzoic acid) is one of the isomers of anisic acid, with anti-bacterial and antiseptic properties [1]. Uses: Scientific research. Group: Natural products. Alternative Names: 4-Methoxybenzoic acid (Standard); Draconic acid (Standard). CAS No. 100-09-4. Pack Sizes: 100 mg; 250 mg; 500 mg. Product ID: HY-N1394R. MedChemExpress MCE
p-Anisidine p-Anisidine. Group: Biochemicals. Grades: Highly Purified. CAS No. 104-94-9. Pack Sizes: 10g. Molecular Formula: C7H9NO, Molecular Weight: 123.15. US Biological Life Sciences. USBiological 3
Worldwide
p-Anisil p-Anisil. Group: Polymerization initiatorspolymerization reagents. CAS No. 1226-42-2. Product ID: 1,2-bis(4-methoxyphenyl)ethane-1,2-dione. Molecular formula: 270.28g/mol. Mole weight: C16H14O4. COC1=CC=C (C=C1)C (=O)C (=O)C2=CC=C (C=C2)OC. InChI=1S/C16H14O4/c1-19-13-7-3-11 (4-8-13)15 (17)16 (18)12-5-9-14 (20-2)10-6-12/h3-10H, 1-2H3. YNANGXWUZWWFKX-UHFFFAOYSA-N. Alfa Chemistry Materials 4
p-Anisil p-Anisil is a reagent used in the preparation of novel quinoxaline derivatives with anti-HIV activity. Synonyms: 4,4'-Dimethoxybenzil; Anisil. Grade: 95 %. CAS No. 1226-42-2. Molecular formula: C16H14O4. Mole weight: 270.28. BOC Sciences 9
p-Anisoyl chloride p-Anisoyl chloride. Group: Biochemicals. Grades: Highly Purified. CAS No. 100-07-2. Pack Sizes: 50g, 100g, 250g, 500g, 1kg. US Biological Life Sciences. USBiological 6
Worldwide
p-Anisylidenephthalide Potential antianxiety agent. Group: Biochemicals. Alternative Names: 3- (4-Methoxybenzylidene) phthalide; 3- (4-Methoxybenzal) phthalide; 3-[ (4-Methoxyphenyl) methylene]-1 (3H) -isobenzofuranone. Grades: Highly Purified. CAS No. 4767-61-7. Pack Sizes: 500mg. US Biological Life Sciences. USBiological 2
Worldwide
p-Anisylpyridazone An Intermediate for the synthesis of the drug Gabazine, as well as several analgesic pharmaceuticals. Group: Biochemicals. Alternative Names: 6-(4-Methoxyphenyl)-3(2H)-pyridazinone; 6-(p-Methoxyphenyl)-3(2H)-pyridazinone. Grades: Highly Purified. CAS No. 2166-33-8. Pack Sizes: 500mg. US Biological Life Sciences. USBiological 2
Worldwide

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products