American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
Tiopronin Disulfide Tiopronin Disulfide is used in the treatment of mitochondrial dysfunction and postischemic myocardial damage. Tiopronin Disulfide partly prevents and reverses mitochondrial uncoupling and improves deteriorated heart function. Group: Biochemicals. Grades: Highly Purified. CAS No. 21269-37-4. Pack Sizes: 250mg, 2.5g. Molecular Formula: C10H16N2O6S2. US Biological Life Sciences. USBiological 5
Worldwide
Tiospirone Hydrochloride Tiospirone is an atypical antipsychotic agent. Tiospirone is used in the treatment of schizophrenia. Tiospirone acts as a 5-HT1A receptor partial agonist, 5-HT2A, 5-HT2C, and 5-HT7 receptor inverse agonist, and D2, D4, and α1-adrenergic receptor antagonist. Group: Biochemicals. Alternative Names: 8-[4-[4-(1,2-Benzisothiazol-3-yl)-1-piperazinyl]butyl]-8-azaspiro[4.5]decane-7,9-dione Hydrochloride; BMY 13859; BMY 13859-1; MJ 13859-1; Tiaspirone Hydrochloride. Grades: Highly Purified. CAS No. 87691-92-7. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 3
Worldwide
Tiotropium bromide Tiotropium Bromide, an azoniatricyclo derivative, is a mAChR antagonist that could be used as bronchodilation agent and smooth muscle relaxant. Uses: Tiotropium bromide is a machr antagonist that could be used as bronchodilation agent and smooth muscle relaxant. Synonyms: PUR-0200; PUR0200; PUR 0200; BA 679BR; BA-679BR; BA679BR; TIOTROPIUM BROMIDE; Spiriva; Spiriva Respimat; Spiriva Handihaler; Tiotropium (Bromide). Grade: >99%. CAS No. 136310-93-5. Molecular formula: C19H22BrNO4S2. Mole weight: 472.41. BOC Sciences 2
Tiotropium Bromide Tiotropium Bromide. Uses: Designed for use in research and industrial production. Additional or Alternative Names: (1R,2R,4S,5S,7s)-7-(2-Hydroxy-2,2-di(thiophen-2-yl)acetoxy)-9,9-dimethyl-3-oxa-9-azatricyclo[3.3.1.02,4]nonan-9-ium bromide. Product Category: Thiophenes. Appearance: White Solid. CAS No. 136310-93-5. Molecular formula: C19H22BrNO4S2. Mole weight: 472.41. Purity: 0.99. Product ID: ACM136310935. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 2
Tiotropium Bromide Tiotropium Bromide (BA679 BR) is a muscarinic acetylcholine receptor (mAChR) antagonist that blocks the binding of the acetylcholine ligand and subsequent opening of the ligand-gated ion channel. Uses: Scientific research. Group: Signaling pathways. Alternative Names: BA679 BR. CAS No. 136310-93-5. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg; 500 mg. Product ID: HY-17360. MedChemExpress MCE
Tiotropium Bromide Muscarinic receptor antagonist. Bronchodilator. Group: Biochemicals. Alternative Names: (1α,2 β,4 β,5α,7 β )-7-[(2-Hydroxy-2, 2-di-2-thienylacetyl)oxy]-9, 9-dimethyl-3-oxa-9-azoniatricyclo[3. 3. 1. 02, 4]nonane Bromide. Grades: Highly Purified. CAS No. 136310-93-5. Pack Sizes: 5mg. US Biological Life Sciences. USBiological 3
Worldwide
Tiotropium Bromide Hydrate Tiotropium Bromide Hydrate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Tiotropium Bromide Monohydrate; Tiotropium Bromide Xhydrate. Product Category: Thiophenes. Appearance: White to Off-White Solid. CAS No. 139404-48-1. Molecular formula: C19H22NO4S2Br·H2O. Mole weight: 490.43. Purity: 95%+. Product ID: ACM139404481. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 2
Tiotropium bromide monohydrate 100mg Pack Size. Group: Analytical Reagents, Biochemicals, Building Blocks, Organics. Formula: C19H22BrNO4S2.H2O. CAS No. 139404-48-1. Prepack ID 90025485-100mg. Molecular Weight 490.43. See USA prepack pricing. Molekula Americas
Tiotropium bromide monohydrate ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
Tiotropium bromide monohydrate Tiotropium bromide monohydrate. Group: Biochemicals. Grades: Highly Purified. CAS No. 139404-48-1. Pack Sizes: 100mg, 250mg, 500mg, 1g, 2g. Molecular Formula: C19H22NO4S2·H2O·Br. US Biological Life Sciences. USBiological 8
Worldwide
Tiotropium bromide monohydrate Tiotropium bromide (BA-679 BR) monohydrate is a long-acting muscarinic receptor antagonist [1] [2]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: BA-679 BR monohydrate. CAS No. 411207-31-3. Pack Sizes: 10 mM * 1 mL; 50 mg; 100 mg. Product ID: HY-B0460. MedChemExpress MCE
Tiotropium Bromide Monohydrate Used for maintenance treatment of airflow obstruction in patients with chronic obstructive pulmonary disease. It has a role as a muscarinic antagonist and a bronchodilator agent. Alternative Names: Tiotropium bromide hydrate. 411207-31-3. Spiriva. CAS No. 139404-48-1. Product ID: API139404481. Molecular formula: C19H24BrNO5S2. Mole weight: 490.4. SMILES: C[N+]1(C2CC(CC1C3C2O3)OC(=O)C(C4=CC=CS4)(C5=CC=CS5)O)C.O.[Br-]. Category: Bronchiectasis APIs. Protheragen
Tiotropium-[d3] Bromide Tiotropium-[d3] Bromide is the labelled analogue of Tiotropium bromide. Tiotropium bromide is an anticholinergic bronchodilator used in the management of chronic obstructive pulmonary disease. Synonyms: Tiotropium D3 Bromide; (1α,2β,4β,5α,7β)-7-[(2-Hydroxy-2,2-di-2-thienylacetyl)oxy]-9,9-dimethyl-3-oxa-9-azoniatricyclo[3.3.1.02,4]nonane-d3 Bromide. Grade: 98% by HPLC; 99% atom D. CAS No. 1127226-56-5. Molecular formula: C19H19D3BrNO4S2. Mole weight: 475.43. BOC Sciences 2
Tiotropium-d3 Bromide Muscarinic receptor antagonist. Bronchodilator. Group: Biochemicals. Alternative Names: (1α,2 β,4 β,5α,7 β )-7-[(2-Hydroxy-2, 2-di-2-thienylacetyl)oxy]-9, 9-dimethyl-3-oxa-9-azoniatricyclo[3. 3. 1. 02, 4]nonane-d3 Bromide. Grades: Highly Purified. CAS No. 1127226-56-5. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 3
Worldwide
Tiotropium-[d3] Iodide An isotope labelled derivative of Tiotropium bromide. Tiotropium bromide is an anticholinergic bronchodilator used in the management of chronic obstructive pulmonary disease. Synonyms: (1R,2R,4S,5S,7S)-7-{[2-hydroxy-2,2-bis(thiophen-2-yl)acetyl]oxy}-9-(D3)methyl-9-methyl-3-oxa-9-azatricyclo[3.3.1.0,4]nonan-9-ium iodide. Grade: 95% by HPLC; 98% atom D. CAS No. 412010-61-8. Molecular formula: C19H19D3NO4S2I. Mole weight: 522.44. BOC Sciences 2
Tioxidazole Tioxidazole. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Tioxidazole, 61570-90-9, Sch-21480, NCGC00160481-01, methyl 6-propoxy-2-benzothiazolylcarbamate, methyl (6-propoxy-1,3-benzothiazol-2-yl)carbamate, (6-Propoxy-benzothiazol-2-yl)-carbamic acid methyl ester, Tioxidazol, Tioxidazolum, Tiox, Tiox (TN), ChemDivAM_000281, Tioxidazole (USAN/INN), ChemDiv1_000106, Tioxidazol [INN-Spanish], Tioxidazolum [INN-Latin], AC1L2HJ1, DSSTox_CID_26178, DSSTox_RID_81409, UNII-NZW046NI85. Product Category: Heterocyclic Organic Compound. CAS No. 61570-90-9. Molecular formula: C12H14N2O3S. Mole weight: 266.316160 [g/mol]. Purity: 0.96. IUPACName: methyl N-(6-propoxy-1,3-benzothiazol-2-yl)carbamate. Canonical SMILES: CCCOC1=CC2=C(C=C1)N=C(S2)NC(=O)OC. Density: 1.313g/cm³. ECNumber: 262-854-2. Product ID: ACM61570909. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 5
Tioxolone Tioxolone is an inhibitor of the metalloenzyme carbonic anhydrase I and has anti-acne activity. Uses: Scientific research. Group: Signaling pathways. CAS No. 4991-65-5. Pack Sizes: 10 mM * 1 mL; 500 mg; 1 g. Product ID: HY-B0483. MedChemExpress MCE
Tip-39 Tip-39. Uses: Designed for use in research and industrial production. Additional or Alternative Names: H-SER-LEU-ALA-LEU-ALA-ASP-ASP-ALA-ALA-PHE-ARG-GLU-ARG-ALA-ARG-LEU-LEU-ALA-ALA-LEU-GLU-ARG-ARG-HIS-TRP-LEU-ASN-SER-TYR-MET-HIS-LYS-LEU-LEU-VAL-LEU-ASP-ALA-PRO-OH;SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP;TIP-39;TUBEROINFUNDIBULAR NEUROPEPTIDE;H-SER-LEU-ALA-. Product Category: Heterocyclic Organic Compound. CAS No. 277302-47-3. Molecular formula: C202H325N61O54S. Product ID: ACM277302473. Alfa Chemistry — ISO 9001:2015 Certified. Categories: TIP39. Alfa Chemistry. 3
TIP 39, Tuberoinfundibular Neuropeptide TIP 39, Tuberoinfundibular Neuropeptide is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. TIP 39 is highly conserved among species. TIP39 from all species activates adenylyl cyclase and elevates intracellular calcium levels through parathyroid hormone 2 receptor (PTH2R)[1]. Uses: Scientific research. Group: Peptides. CAS No. 277302-47-3. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P1852. MedChemExpress MCE
TIP 39, Tuberoinfundibular Neuropeptide It is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. Synonyms: Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro; TIP 39 (39 mer); L-seryl-L-leucyl-L-alanyl-L-leucyl-L-alanyl-L-alpha-aspartyl-L-alpha-aspartyl-L-alanyl-L-alanyl-L-phenylalanyl-L-arginyl-L-alpha-glutamyl-L-arginyl-L-alanyl-L-arginyl-L-leucyl-L-leucyl-L-alanyl-L-alanyl-L-leucyl-L-alpha-glutamyl-L-arginyl-L-arginyl-L-histidyl-L-tryptophyl-L-leucyl-L-asparagyl-L-seryl-L-tyrosyl-L-methionyl-L-histidyl-L-lysyl-L-leucyl-L-leucyl-L-valyl-L-leucyl-L-alpha-aspartyl-L-alanyl-L-proline. Grade: ≥95% by HPLC. CAS No. 277302-47-3. Molecular formula: C202H325N61O54S. Mole weight: 4504.17. BOC Sciences
Tipelukast ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
Tipelukast Tipelukast (KCA 757) is a sulfidopeptide leukotriene receptor antagonist, an orally bioavailable anti-inflammatory agent and used for the treatment of asthma. Uses: Scientific research. Group: Signaling pathways. Alternative Names: KCA 757; MN 001. CAS No. 125961-82-2. Pack Sizes: 1 mg. Product ID: HY-14938. MedChemExpress MCE
Tipelukast-[d6] Tipelukast-[d6] is the labelled analogue of Tipelukast, which could be used as an oral anti-inflammatory agent and has been found to exhibit potential activities against non-alcoholic fatty liver disease as a leukotriene receptor antagonist. Synonyms: Tipelukast-D6. Molecular formula: C29H32D6O7S. Mole weight: 536.71. BOC Sciences 2
Tipepidine hydrochloride Tipepidine hydrochloride reversibly inhibits dopamine (DA) D 2 receptor-mediated GIRK currents (I DA(GIRK) ) with an IC 50 of 7.0 μM. Tipepidine hydrochloride subsequently activates VTA dopamine neuron [1]. Tipepidine hydrochloride, a non-narcotic antitussive, exerts an antidepressant-like effect [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1449686-84-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-121685A. MedChemExpress MCE
Tiphenylphosphine-3,3',3''-trisulfonic acid trisodium salt Tiphenylphosphine-3,3',3''-trisulfonic acid trisodium salt. Group: Biochemicals. Grades: Highly Purified. CAS No. 63995-70-0. Pack Sizes: 50mg, 100mg, 250mg, 500mg, 1g. Molecular Formula: C18H12Na3O9PS3. US Biological Life Sciences. USBiological 8
Worldwide
Tipifarnib A farnesyltransferase inhibitor. Sensitizes human multiple myeloma cell to proteasome inhibition by blocking degradation of bortezomib-induced aggresomes. Also shown to inhibit the growth of myeloid leukemia cell lines and primary leukemia cells by inducing apoptosis and cell-cycle blockage when combined with rapamycin(R124000). Group: Biochemicals. Alternative Names: 6-[(R)-Amino(4-chlorophenyl)(1-methyl-1H-imidazol-5-yl)methyl]-4-(3-chlorophenyl)-1-methyl-2(1H)-quinolinone; (R)-(+)-R 115777; Zarnestra. Grades: Highly Purified. CAS No. 192185-72-1. Pack Sizes: 2.5mg. US Biological Life Sciences. USBiological 3
Worldwide
Tipifarnib Tipifarnib (IND 58359) binds to and inhibits farnesyltransferase (FTase) with an IC 50 of 0.86 nM. Antineoplastic activity and antiparasitic activity [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: IND 58359; R115777. CAS No. 192185-72-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-10502. MedChemExpress MCE
Tipifarnib ?98% (HPLC). Group: Fluorescence/luminescence spectroscopyenzyme activators, inhibitors & substrates. Alfa Chemistry Analytical Products
Tipiracil Tipiracil is a thymidine phosphorylase ( TPase ) inhibitor. Uses: Scientific research. Group: Signaling pathways. CAS No. 183204-74-2. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 200 mg. Product ID: HY-A0063A. MedChemExpress MCE
Tipiracil hydrochloride Tipiracil (hydrochloride) is a thymidine phosphorylase inhibitor (TPI), used for cancer research. Uses: Scientific research. Group: Signaling pathways. CAS No. 183204-72-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 200 mg. Product ID: HY-A0063. MedChemExpress MCE
Tipiracil hydrochloride ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
Tiplaxtinin ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
Tiplaxtinin Tiplaxtinin is a selective and orally efficacious inhibitor of plasminogen activator inhibitor-1 (PAI-1) with IC50 of 2.7 ?M[1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: PAI-039; Tiplasinin. CAS No. 393105-53-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-15253. MedChemExpress MCE
Tipranavir Storage and Stability. Group: Biochemicals. Alternative Names: N-[3-[(1R)-1-[(6R)-5,6-Dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)-2-pyridinesulfonamide; PNU-140690; Aptivus. Grades: Highly Purified. CAS No. 174484-41-4. Pack Sizes: 1mg, 2mg, 5mg, 10mg, 25mg. US Biological Life Sciences. USBiological 8
Worldwide
Tipranavir Tipranavir (PNU-140690) inhibits the enzymatic activity and dimerization of HIV-1 protease, exerts potent activity against multi-protease inhibitor (PI)-resistant HIV-1 isolates with IC50s of 66-410 nM. Tipranavir inhibits SARS-CoV-2 3CLpro activity. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PNU-140690;Aptivus;N-[3-[(1R)-1-[(6R)-5,6-Dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)-2-pyridinesulfonamide;N-[3-[(1R)-1-[(6R)-2-Hydroxy-4-oxo-6-phenethyl-6-propyl-5H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)pyridine-2-sulfonamide;Tipranavir;Tipranavir(PNU-140690,Aptivus);2-PyridinesulfonaMide,N-[3-[(1R)-1-[(6R)-5,6-dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoroMethyl)-. Product Category: Inhibitors. Appearance: Solid. CAS No. 174484-41-4. Molecular formula: C31H33F3N2O5S. Mole weight: 602.66. Purity: 0.9808. Canonical SMILES: O=C1C([C@H](CC)C2=CC=CC(NS(C3=CC=C(C(F)(F)F)C=N3)(=O)=O)=C2)=C(O)C[C@](CCC4=CC=CC=C4)(CCC)O1. Product ID: ACM174484414. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry.
Tipranavir Tipranavir (PNU-140690) inhibits the enzymatic activity and dimerization of HIV-1 protease , exerts potent activity against multi-protease inhibitor (PI)-resistant HIV-1 isolates with IC 50 s of 66-410 nM [1] [2]. Tipranavir inhibits SARS-CoV-2 3CL pro activity [3]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: PNU-140690. CAS No. 174484-41-4. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg. Product ID: HY-15148. MedChemExpress MCE
Tipranavir-[d4] Tipranavir-[d4] is the labelled analogue of Tipranavir, which is a nonpeptidic HIV protease inhibitor and has been found to be effective as an antiviral. Synonyms: Tipranavir D4; N-[3-[(1R)-1-[(6R)-5,6-Dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)-2-pyridinesulfonamide-d4. Grade: 95% by HPLC; 98% atom D. CAS No. 1217819-15-2. Molecular formula: C31H29D4F3N2O5S. Mole weight: 606.69. BOC Sciences 2
Tipranavir-d4 (N-[3-[(1R)-1-[(6R)-5,6-Dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)-2-pyridinesulfonamide-d4,. PNU-140690-d4, Aptivus-d4,. ) Nonpeptidic HIV protease inhibitor (NPPI). Antiviral. Group: Biochemicals. Alternative Names: N-[3-[(1R)-1-[(6R)-5,6-Dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)-2-pyridinesulfonamide-d4; PNU-140690-d4; Aptivus-d4. Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 1
Worldwide
Tipranavir. (N-[3-[(1R)-1-[(6R)-5,6-Dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)-2-pyridinesulfonamide,. PNU-140690, Aptivus,. ) Nonpeptidic HIV protease inhibitor (NPPI). Antiviral. Group: Biochemicals. Alternative Names: N-[3-[(1R)-1-[(6R)-5,6-Dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)-2-pyridinesulfonamide; PNU-140690; Aptivus. Grades: Highly Purified. CAS No. 174484-41-4. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 1
Worldwide
Tiq-a TIQ-A is a potent TNKS (poly-ART, PARP) inhibitor, with an IC50 of 24 nM for TNKS2. TIQ-A is a potential anti-ischemic agent. Uses: Designed for use in research and industrial production. Additional or Alternative Names: TIQ-A, 4H-Thieno[2,3-c]isoquinolin-5-one, PARP Inhibitor X, TIQ-A, Thieno[2,3-c]isoquinolin-5-one, 420849-22-5, SureCN422013, T2825_SIGMA, CTK1C8658, ZINC00003266, AG-F-49683, Thieno[2,3-c]isoquinolin-5(4H)-one, NCGC00165904-01, FT-0675250, G18. Product Category: Inhibitors. CAS No. 420849-22-5. Molecular formula: C11H7NOS. Mole weight: 201.24. Purity: ≥98%. IUPACName: 4H-thieno[2,3-c]isoquinolin-5-one. Canonical SMILES: C1=CC=C2C(=C1)C3=C(NC2=O)SC=C3. Density: 1.359g/cm³. Product ID: ACM420849225. Alfa Chemistry — ISO 9001:2015 Certified. Categories: TiQal. Alfa Chemistry.
TIQ-A TIQ-A. Group: Biochemicals. Alternative Names: Thieno[2,3-C]isoquinolin-5-one. Grades: Highly Purified. CAS No. 420849-22-5. Pack Sizes: 2mg, 5mg, 10mg, 25mg, 50mg. Molecular Formula: C11H7NOS. US Biological Life Sciences. USBiological 8
Worldwide
TIQ-A ?98% (HPLC), solid. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
TIQ-A (Thieno[2,3-C]isoquinolin-5-one) TIQ-A (Thieno[2,3-C]isoquinolin-5-one). Group: Biochemicals. Alternative Names: Thieno[2,3-C]isoquinolin-5-one. Grades: Highly Purified. Pack Sizes: 5mg. US Biological Life Sciences. USBiological 1
Worldwide
Tiquizium Bromide Tiquizium Bromide is a antimuscarinic agent that was used on airway smooth muscle in vitro and in patients with chronic obstructive pulmonary disease. Group: Biochemicals. Alternative Names: HS 902; HSR 902; Thiaton; (5R, 9aR) -rel-3- (Di-2-thienylmethylene) octahydro-5-methyl-2H-quinolizinium Bromide; trans-3- (Di-2-thienylmethylene) octahydro-5-methyl-2H-quinolizinium Bromide. Grades: Highly Purified. CAS No. 71731-58-3. Pack Sizes: 100mg. US Biological Life Sciences. USBiological 4
Worldwide
Tirabrutinib Tirabrutinib (ONO-4059) is an orally active Brutons Tyrosine Kinase ( BTK ) inhibitor (can cross the blood-brain barrier (BBB)), with an IC 50 of 6.8 nM. Tirabrutinib irreversibly and covalently binds to BTK and inhibits aberrant B cell receptor signaling. Tirabrutinib can be used in studies of autoimmune diseases and hematological malignancies [1] [2] [3] [4]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: ONO-4059; GS-4059. CAS No. 1351636-18-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15771. MedChemExpress MCE
Tirabrutinib hydrochloride Tirabrutinib (ONO-4059) hydrochloride is an orally active Brutons Tyrosine Kinase ( BTK ) inhibitor (can cross the blood-brain barrier (BBB)), with an IC 50 of 6.8 nM. Tirabrutinib hydrochloride irreversibly and covalently binds to BTK and inhibits aberrant B cell receptor signaling. Tirabrutinib hydrochloride can be used in studies of autoimmune diseases and hematological malignancies [1] [2] [3] [4]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: ONO-4059 hydrochloride; GS-4059 hydrochloride. CAS No. 1439901-97-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15771A. MedChemExpress MCE
Tiragolumab Tiragolumab is an immune checkpoint inhibitor binding to T-cell immunoglobulin and ITIM domain ( TIGIT ). Tiragolumab, alone or in combination with the PD-L1 inhibitor Atezolizumab (HY-P9904), may be effective against multiple solid malignancies-most notably non-small cell lung cancer (NSCLC) [1] [2]. Uses: Scientific research. Group: Inhibitory antibodies. Alternative Names: MTIG-7192A; RG-6058. CAS No. 1918185-84-8. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P9986. MedChemExpress MCE
Tirandamycin A Tirandamycin A is originally isolated from Str. tirandis var. tirandis NRRL 3689, and it has anti-gram-positive bacteria effect. Synonyms: NSC 107067; 3-Pyrrolin-2-one, 4-hydroxy-3-(4-methyl-6-(1,2,7-trimethyl-5-oxo-3,9,10-trioxatricyclo(4.3.1.0(sup 2,4))dec-8-yl)-2,4-heptadienoyl)-, (E,E)-. Grade: 95% by HPLC. CAS No. 34429-70-4. Molecular formula: C22H27NO7. Mole weight: 417.45. BOC Sciences
Tirapazamine Tirapazamine (SR259075) is an anticancer agent that shows selective cytotoxicity for hypoxic cells in solid tumors, thereby inducing single-and double-strand breaks in DNA, base damage, and cell death. Tirapazamine is an anticancer and bioreductive agent.Tirapazamine (SR259075) can enhance the cytotoxic effects of ionizing radiation in hypoxic cells [1] [2]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: SR259075; SR4233; Win59075; SML 0552; SR 259075; Tirazone. CAS No. 27314-97-2. Pack Sizes: 10 mM * 1 mL; 50 mg; 100 mg; 200 mg. Product ID: HY-13767. MedChemExpress MCE
Tirapazamine ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
Tirasemtiv Tirasemtiv is an activator of the fast skeletal muscle troponin complex. Tirasemtiv is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Group: Signaling pathways. Alternative Names: CK-2017357. CAS No. 1005491-05-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15964. MedChemExpress MCE
Tiratricol Tiratricol is an orally available thyroid hormone analog that inhibits pituitary thyroid-stimulating hormone secretion. Tiratricol is an intracellular toxin neutralizer that inhibits LPS and lipid A cytotoxicity with IC 50 s of 20 μM and 32 μM, respectively. Tiratricol reduces TNF production in lipopolysaccharide-stimulated macrophages. Tiratricol also has antiviral activity and is an inhibitor of yellow fever virus (Flavivirus). It can bind to the RdRp domain of the viral NS5 protein to hinder YFV replication. [2]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: 3,3',5-Triiodothyroacetic acid. CAS No. 51-24-1. Pack Sizes: 10 mM * 1 mL; 50 mg; 100 mg. Product ID: HY-B1201. MedChemExpress MCE
Tirbanibulin Tirbanibulin (KX2-391) is an inhibitor of Src that targets the peptide substrate site of Src, with GI 50 of 9-60 nM in cancer cell lines. Uses: Scientific research. Group: Signaling pathways. Alternative Names: KX2-391; KX-01. CAS No. 897016-82-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-10340. MedChemExpress MCE
Tirbanibulin dihydrochloride Tirbanibulin (dihydrochloride) (KX2-391 (dihydrochloride)) is an inhibitor of Src that targets the peptide substrate site of Src, with GI 50 of 9-60 nM in cancer cell lines. Uses: Scientific research. Group: Signaling pathways. Alternative Names: KX2-391 dihydrochloride; KX-01 dihydrochloride. CAS No. 1038395-65-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-10340A. MedChemExpress MCE
Tirbanibulin Mesylate Tirbanibulin Mesylate (KX2-391 Mesylate) is an inhibitor of Src that targets the peptide substrate site of Src, with GI 50 of 9-60 nM in cancer cell lines. Uses: Scientific research. Group: Signaling pathways. Alternative Names: KX2-391 Mesylate; KX01 Mesylate. CAS No. 1080645-95-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-10340B. MedChemExpress MCE
Tirilazad Tirilazad is a nonglucocorticoid, 21-aminosteroid that inhibits lipid peroxidation. Tirilazad can attenuate brain or spinal cord injury caused by trauma, stroke, ischemia and reperfusion injury. Tirilazad has antiviral activities against nCoV. Tirilazad is neuroprotective for ischaemic stroke, can be used for subarachnoid hemorrhage research [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: U 74006F free base. CAS No. 110101-66-1. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-132280. MedChemExpress MCE
Tirnovetmab Tirnovetmab (KIND-016) is an antibody. Tirnovetmab can be used for experiment research. Uses: Scientific research. Group: Inhibitory antibodies. Alternative Names: KIND-016. CAS No. 2364504-80-1. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P99557. MedChemExpress MCE
Tirofiban Tirofiban (L700462) is a selective and reversible platelet integrin receptor ( Gp IIb/IIIa ) antagonist that inhibits fibrinogen binding to this receptor and has antithrombotic activity. Tirofiban induces proliferation and migration on endothelial cell by inducing production of VEGF. Tirofiban can significantly reduces myocardial no-reflow and ischemia-reperfusion injury by alleviating myocardial microvascular structural and endothelial dysfunction in the ischemic area [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: L700462; MK383. CAS No. 144494-65-5. Pack Sizes: 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-17369B. MedChemExpress MCE
Tirofiban-butyl-d9, Hydrochloride (N-(Butyl-d9-sulfonyl)-O-[4-(4-piperidynyl)butyl]-L-tyrosine, Hydrochloride) Labeled Tirofiban, a specific nonpeptide platelet fibrinogen receptor (GPIIb/IIIa) antagonist. An antithrombotic used in the treatment of unstable angina. Group: Biochemicals. Alternative Names: N-(Butyl-d9-sulfonyl)-O-[4-(4-piperidynyl)butyl]-L-tyrosine, Hydrochloride. Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 1
Worldwide
Tirofiban hydrochloride Tirofiban hydrochloride. Group: Biochemicals. Grades: Highly Purified. CAS No. 142373-60-2. Pack Sizes: 250mg, 500mg, 1g, 2g, 5g. Molecular Formula: C22H36N2O5S·HCl. US Biological Life Sciences. USBiological 8
Worldwide
Tirofiban Hydrochloride Tyrosine analog and PLATELET GLYCOPROTEIN GPIIB-IIIA COMPLEX antagonist that inhibits PLATELET AGGREGATION and is used in the treatment of ACUTE CORONARY SYNDROME. Alternative Names: Tirofiban hydrochloride monohydrate. TIROFIBAN HYDROCHLORIDE. Tirofiban HCl. Tirofiban hydrochloride hydrate. CAS No. 150915-40-5. Product ID: API150915405. Molecular formula: C22H39ClN2O6S. Mole weight: 495.1. EINECS: 682-504-6. SMILES: CCCCS(=O)(=O)NC(CC1=CC=C(C=C1)OCCCCC2CCNCC2)C(=O)O.O.Cl. Appearance: Solid powder. Category: Cardiovascular and Geriatric Medicine APIs. Protheragen
Tirofiban Hydrochloride Tirofiban Hydrochloride. Uses: For analytical and research use. Group: Impurity standards. CAS No. 150915-40-5. Molecular formula: C22H39ClN2O6S. Mole weight: 495.07. Catalog: APB150915405. Alfa Chemistry Analytical Products 4
Tirofiban hydrochloride hydrate Tirofiban hydrochloride hydrate. Group: Biochemicals. Alternative Names: N-(Butylsulfonyl)-O-[4-(4-piperidynyl)butyl]-L-tyrosine, hydrochloride hydrate. Grades: Highly Purified. CAS No. 150915-40-5. Pack Sizes: 5mg, 10mg, 25mg, 50mg, 100mg. Molecular Formula: C22H39ClN2O6S. US Biological Life Sciences. USBiological 8
Worldwide
Tirofiban, Hydrochloride Hydrate (N-(Butylsulfonyl)-O-[4-(4-piperidynyl)butyl]-L-tyrosine, Hydrochloride Hydrate) A specific nonpeptide platelet fibrinogen receptor (GPIIb/IIIa) antagonist. An antithrombotic used in the treatment of unstable angina. Group: Biochemicals. Alternative Names: N-(Butylsulfonyl)-O-[4-(4-piperidynyl)butyl]-L-tyrosine, Hydrochloride Hydrate. Grades: Highly Purified. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 1
Worldwide
Tirofiban hydrochloride monohydrate ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
Tirofiban hydrochloride monohydrate Tirofiban (L700462) hydrochloride monohydrate is a selective and reversible platelet integrin receptor ( Gp IIb/IIIa ) antagonist that inhibits fibrinogen binding to this receptor and has antithrombotic activity. Tirofiban hydrochloride monohydrate induces proliferation and migration on endothelial cell by inducing production of VEGF. Tirofiban hydrochloride monohydrate can significantly reduces myocardial no-reflow and ischemia-reperfusion injury by alleviating myocardial microvascular structural and endothelial dysfunction in the ischemic area [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: L700462 hydrochloride monohydrate; MK383 hydrochloride monohydrate. CAS No. 150915-40-5. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-17369. MedChemExpress MCE
Tiron Tiron. CAS No. 149-45-1. Richman Chemical
Pennsylvania PA
Tiron Tiron is a non-toxic chelator of a variety of metals. Tiron is cell permeable analog of vitamin E and function as hydroxyl radical and superoxide scavenger. Tiron is an orally active antioxidant. Tiron can be used to alleviate acute metal overload in animals [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. CAS No. 149-45-1. Pack Sizes: 10 mM * 1 mL; 10 g; 25 g. Product ID: HY-D0261. MedChemExpress MCE
Tiron (1,2-Dihydroxybenzene-3,5-disulfonic acid disodium salt) C6H6Na2O9S2 25g Pack Size. Group: Analytical Reagents, Building Blocks, Organics, Stains & Indicators. Formula: C6H6Na2O9S2. CAS No. 149-45-1. Prepack ID 58661995-25g. Molecular Weight 332.22. See USA prepack pricing. Molekula Americas
Tiropramide Tiropramide. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Tiropramide;N-[1-[4-(2-diethylaminoethyloxy)benzyl]-2-(dipropylamino)-2-keto-ethyl]benzamide;N-[3-[4-(2-diethylaminoethyloxy)phenyl]-1-(dipropylamino)-1-oxo-propan-2-yl]benzamide;N-[3-[4-(2-diethylaminoethyloxy)phenyl]-1-(dipropylamino)-1-oxopropan-2-yl]. Product Category: Heterocyclic Organic Compound. CAS No. 55837-29-1. Molecular formula: C28H41N3O3. Mole weight: 467.65. Product ID: ACM55837291. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 4

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products