A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Adrenic Acid. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Cis-7,10,13,16-Docosatetraenoic Acid. Product Category: Heterocyclic Organic Compound. CAS No. 28874-58-0. Molecular formula: C22H36O2. Mole weight: 332.53. Purity: 0.99. Product ID: ACM28874580. Alfa Chemistry ISO 9001:2015 Certified.
Adrenochrome
Adrenochrome (Adraxone) is an oxidation product of Epinephrine. Adrenochrome is a potent coronary constricting agent in the rat heart. Adrenochrome can be used for neurological disorder research [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: Adraxone. CAS No. 54-06-8. Pack Sizes: 5 mg; 10 mg. Product ID: HY-116513.
Adrenochrome
An impurity of Phenylephrine which selectively binds to alpha receptors which cause blood vessels to constrict. Synonyms: Adrenochrome. Grade: > 95%. CAS No. 54-06-8. Molecular formula: C9H9NO3. Mole weight: 179.18.
Adrenochrome Bisulfite Sodium Salt
Adrenochrome Bisulfite Sodium Salt is a derivative of Adrenochrome. Synonyms: Sodium 3-Hydroxy-1-methyl-5,6-dioxo-2,3,3a,4,5,6-hexahydro-1H-indole-3a-sulfonate; Adrenochrome Impurity 1; 3aH-Indole-3a-sulfonic acid, 1,2,3,4,5,6-hexahydro-3-hydroxy-1-methyl-5,6-dioxo-, sodium salt (1:1). Grade: ≥95%. CAS No. 5818-84-8. Molecular formula: C9H10NNaO6S. Mole weight: 283.23.
Adrenochrome Bisulfite Sodium Salt
Adrenochrome Bisulfite Sodium Salt is a derivative of Adrenochrome (A305250), the substance mainly responsible for the red colours produced during the mild oxidation of adrenaline. Group: Biochemicals. Grades: Highly Purified. CAS No. 5818-84-8. Pack Sizes: 10mg, 100mg. Molecular Formula: C9H10NNaO6S. US Biological Life Sciences.
Worldwide
Adrenochrome Bisulfite Sodium Salt
Adrenochrome Bisulfite Sodium Salt. Uses: For analytical and research use. Group: Building blocks. Alternative Names: Adrenochrome bisulfite sodium salt,3aH-Indole-3a-sulfonic acid, 1,2,3,4,5,6-hexahydro-3-hydroxy-1-methyl-5,6-dioxo-, sodium salt (1:1), 3a(4H)-Indolinesulfonic acid, 5,6-dihydro-3-hydroxy-1-methyl-5,6-dioxo-, sodium salt (7CI), 1,2,3,4,5,6-Hexahydro-3-hydroxy-1-methyl-5,6-dioxo-3aH-indole-3a-sulfonic acid sodium salt, 3aH-Indole-3a-sulfonic acid, 1,2,3,4,5,6-hexahydro-3-hydroxy-1-methyl-5,6-dioxo-, monosodium salt (9CI). CAS No. 5818-84-8. Pack Sizes: 10MG. IUPAC Name: sodium;3-hydroxy-1-methyl-5,6-dioxo-3,4-dihydro-2H-indole-3a-sulfonate. Molecular formula: C9H10NO6S.Na. Mole weight: 283.23. Catalog: APS5818848. SMILES: [Na+].CN1CC(O)C2(CC(=O)C(=O)C=C12)S(=O)(=O)[O-]. Format: Neat. Shipping: Room Temperature.
Adrenochrome Impurity 2
Adrenochrome Impurity 2 is an impurity of Adrenochrome, which was first isolated from the products of an enzymatic oxidation. CAS No. 87708-46-1. Molecular formula: C9H9NO3. Mole weight: 179.17.
Adrenochrome monoaminoguanidine mesilate
Adrenochrome monoaminoguanidine mesilate. Group: Biochemicals. Alternative Names: 2- (1, 2, 3, 6-Tetra hydro-3- hydroxy-1- methyl -6-oxo-5H-indol-5-yl ide ne ) -hydrazinecarboximidam ide monomethanesulfonate salt; A-Peest; AMM. Grades: Highly Purified. CAS No. 4009-68-1. Pack Sizes: 1mg, 2mg, 5mg, 10mg, 25mg. Molecular Formula: C11H17N5O5S. US Biological Life Sciences.
Worldwide
Adrenochrome Monoaminoguanidine Mesilate
Adrenochrome Monoaminoguanidine Mesilate is an Adrenochrome derivative. Uses: An adrenochrome derivative; used as hemostatic agent. Synonyms: 2-(1,2,3,6-Tetrahydro-3-hydroxy-1-methyl-6-oxo-5H-indol-5-ylidene)-hydrazinecarboximidamide Monomethanesulfonate Salt; A-Peest; AMM; Adchnon S; S-Adchnon; S-Adchnone. Grade: ≥95%. CAS No. 4009-68-1. Molecular formula: C11H17N5O5S. Mole weight: 331.35.
Adrenochrome monosemicarbazone
Adrenochrome monosemicarbazone is a pharmaceutical compound exhibiting immense promise in studying a myriad of ailments including Parkinson's disease, renowned for its magnificent antioxidant and immunomodulatory attributes. Synonyms: Hydrazinecarboxamide, 2-[1,2,3,5(or 1,2,3,6)-tetrahydro-3-hydroxy-1-methyl-5(or 6)-oxo-6H(or 5H)-indol-6(or 5)-ylidene]-; 5,6-Indolinedione, 3-hydroxy-1-methyl-, monosemicarbazone; 5,6-Indolinedione, 3-hydroxy-1-methyl-, semicarbazone; (1,2,3,5(or 1,2,3,6)-tetrahydro-3-hydroxy-1-methyl-5(or 6)-oxo-6H(or 5H)-indol-6(or 5)-al) semicarbazone. CAS No. 30552-37-5. Molecular formula: C10H12N4O3. Mole weight: 236.23.
Adrenochrome semicarbazone
Adrenochrome semicarbazone. Uses: For analytical and research use. Group: Pharma & vet compounds & metabolites; pharma & vet compounds & metabolites. Alternative Names: Adrenochrome semicarbazone (6CI), Adchnon, Cromosil, 5,6-Indolinedione, 3-hydroxy-1-methyl-, 5-semicarbazone (7CI,8CI), Adroxon, 2-(1,2,3,6-Tetrahydro-3-hydroxy-1-methyl-6-oxo-5H-indol-5-ylidene)hydrazinecarboxamide, Carbazochrom, Adrezon, Carbazochrome, Adrenoxyl, Adrenostazin, 3-Hydroxy-1-methyl-5,6-indolindione 5-semicarbazone, Sangostazin, Adrokson, NSC 73742,Adenochrome semicarbazone, Adrenochrome monosemicarbazone, Cromadrenal, Adedolon, Cartabes, Sangostasin, Hydrazinecarboxamide, 2-(1,2,3,6-tetrahydro-3-hydroxy-1-methyl-6-oxo-5H-indol-5-ylidene)-. CAS No. 69-81-8. Molecular formula: C10H12N4O3. Mole weight: 236.23. Catalog: APS69818. Format: Neat. Shipping: Room Temperature.
Adrenocorticoptropic Hormone Fragment 22 - 39
Adrenocorticoptropic Hormone Fragment 22 - 39. Group: Biochemicals. Grades: Highly Purified. CAS No. 37548-29-1. Pack Sizes: 1mg, 2.5mg. Molecular Formula: C90H125N19O32, Molecular Weight: 1985.06. US Biological Life Sciences.
Worldwide
Adrenocorticotropic hormone
Adrenocorticotropic hormone (ACTH) is a polypeptide tropic hormone produced by the anterior pituitary gland. Adrenocorticotropic hormone regulates cortisol and androgen production [1] [2]. Uses: Scientific research. Group: Peptides. Alternative Names: ACTH; Adrenocorticotrophic hormone. CAS No. 9002-60-2. Pack Sizes: 5 mg; 10 mg. Product ID: HY-106373.
Adrenocorticotropic Hormone (ACTH) (1-39), human
Adrenocorticotropic Hormone (ACTH) (1-39), human is a melanocortin receptor agonist. Uses: Scientific research. Group: Peptides. Alternative Names: 1-39-Corticotropin (human). CAS No. 12279-41-3. Pack Sizes: 5 mg; 10 mg; 25 mg. Product ID: HY-P1211.
Adrenocorticotropic Hormone (ACTH) (1-39), rat
Adrenocorticotropic Hormone (ACTH) (1-39), rat is a potent melanocortin 2 (MC2) receptor agonist. Uses: Scientific research. Group: Peptides. Alternative Names: ACTH (1-39) (mouse, rat). CAS No. 77465-10-2. Pack Sizes: 500 μg; 1 mg; 5 mg; 10 mg. Product ID: HY-P1477.
Adrenocorticotropic Hormone (ACTH) (18-39), human TFA
Adrenocorticotropic Hormone (ACTH) (18-39), human TFA is a corticotropinlike intermediate lobe peptide, which is is produced in the melanotrophs of the intermediate lobe of the pituitary [1]. Uses: Scientific research. Group: Peptides. Alternative Names: CLIP (human) TFA. CAS No. 73724-75-1. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P1476A.
Adrenocorticotropic Hormone Fragment 1-16 human, rat
ACTH (1-16) is an agonist of the melanocortin-1 and 3 receptors (K1 = 0.267 ± 0.116 and 19.0 ± 4.3 nmol/L respectively). Synonyms: ACTH (1-16) (human); H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-OH. CAS No. 5576-42-1. Molecular formula: C89H133N25O22S. Mole weight: 1937.23.
Adrenocorticotropic Hormone Fragment 4-10 human, rat
Adrenocorticotropic Hormone Fragment 7-38 human. Synonyms: Corticostatin; (7-28)-Corticotropin; Acth(7-38); CIP peptide. CAS No. 68563-24-6. Molecular formula: C167H257N47O46. Mole weight: 3659.11.
adrenodoxin-NADP+ reductase
A flavoprotein (FAD). The enzyme, which transfers electrons from NADPH to adrenodoxin molecules, is the first component of the mitochondrial cytochrome P-450 electron transfer systems, and is involved in the biosynthesis of all steroid hormones. Group: Enzymes. Synonyms: adrenodoxin reductase; nicotinamide adenine dinucleotide phosphate-adrenodoxin reductase; AdR; NADPH:adrenal ferredoxin oxidoreductase; NADPH-adrenodoxin reductase. Enzyme Commission Number: EC 1.18.1.6. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1111; adrenodoxin-NADP+ reductase; EC 1.18.1.6; adrenodoxin reductase; nicotinamide adenine dinucleotide phosphate-adrenodoxin reductase; AdR; NADPH:adrenal ferredoxin oxidoreductase; NADPH-adrenodoxin reductase. Cat No: EXWM-1111.
Adrenomedullin (11-50), rat
Adrenomedullin (11-50), rat is the C-terminal fragment (11-50) of the adrenomedullin in rats. Rat adrenomedullin induces selective arterial vasodilation through CGRP1 receptor. Synonyms: Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys4-Cys9). Grade: ≥95%. CAS No. 163648-32-6. Molecular formula: C194H304N58O59S4. Mole weight: 4521.17.
ADRENOMEDULLIN (11-50) (RAT)
ADRENOMEDULLIN (11-50) (RAT). Uses: Designed for use in research and industrial production. Additional or Alternative Names: STGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (DISULFIDE BRIDGE: 4-9);ADRENOMEDULLIN (11-50) (RAT);H-SER-THR-GLY-CYS-ARG-PHE-GLY-THR-CYS-THR-MET-GLN-LYS-LEU-ALA-HIS-GLN-ILE-TYR-GLN-PHE-THR-ASP-LYS-ASP-LYS-ASP-GLY-MET-ALA-PRO-ARG-ASN-LYS-ILE-SER-PRO-GLN-GL. Product Category: Heterocyclic Organic Compound. CAS No. 163648-32-6. Product ID: ACM163648326. Alfa Chemistry ISO 9001:2015 Certified.
Adrenomedullin (1-50), rat
Adrenomedullin (1-50), rat, a 50-amino acid peptide, induces selective arterial vasodilation by activation of the CGRP1 receptor. Synonyms: Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys14-Cys19). Grade: ≥95%. Molecular formula: C248H381N77O75S5. Mole weight: 5729.50.
Adrenomedullin (1-52), human
Adrenomedullin is an antimicrobial peptide produced by adrenal medulla, skin, Homo sapiens (Human). It has antibacterial activity against Gram-positive and Gram-negative bacteria. In addition to controlling fluid-electrolyte homeostasis, adrenomedullin is an effective vasodilatory peptide hormone and can inhibit ACTH secretion of pituitary gland. Synonyms: H-Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys(1)-Arg-Phe-Gly-Thr-Cys(1)-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2; L-tyrosyl-L-arginyl-L-glutaminyl-L-seryl-L-methionyl-L-asparagyl-L-asparagyl-L-phenylalanyl-L-glutaminyl-glycyl-L-leucyl-L-arginyl-L-seryl-L-phenylalanyl-glycyl-L-cysteinyl-L-arginyl-L-phenylalanyl-glycyl-L-threonyl-L-cysteinyl-L-threonyl-L-valyl-L-glutaminyl-L-lysyl-L-leucyl-L-alanyl-L-histidyl-L-glutaminyl-L-isoleucyl-L-tyrosyl-L-glutaminyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-lysyl-L-alpha-aspartyl-L-lysyl-L-alpha-aspartyl-L-asparagyl-L-valyl-L-alanyl-L-prolyl-L-arginyl-L-seryl-L-lysyl-L-isoleucyl-L-seryl-L-prolyl-L-glutaminyl-glycyl-L-tyrosinamide (16->21)-disulfide; Human adrenomedullin; Adrenomedullin (human); Human adrenomedullin-(1-52)-NH2. Grade: >95%. CAS No. 148498-78-6. Molecular formula: C264H406N80O77S3. Mole weight: 6028.82.
Adrenomedullin (16-31), human
Adrenomedullin (16-31), human is the 16-31 fragment of the amino acid residue of human adreomedullin (HADM). Synonyms: H-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-NH2; L-cysteinyl-L-arginyl-L-phenylalanyl-glycyl-L-threonyl-L-cysteinyl-L-threonyl-L-valyl-L-glutaminyl-L-lysyl-L-leucyl-L-alanyl-L-histidyl-L-glutaminyl-L-isoleucyl-L-tyrosinamide (1->6)-disulfide. Grade: ≥95%. CAS No. 318480-38-5. Molecular formula: C82H129N25O21S2. Mole weight: 1865.19.
Adrenomedullin (AM) (13-52), human
Adrenomedullin (AM) (13-52), human is a 40-amino acid peptide that is used as an endothelium-dependent vasodilator agent and a high affinity ligand for the adrenomedullin receptor. Synonyms: Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys16-Cys21). Grade: ≥95%. CAS No. 154765-05-6. Molecular formula: C200H308N58O59S2. Mole weight: 4533.13.
Adrenomedullin (AM) (1-52), human TFA
Adrenomedullin (AM) (1-52), human TFA is an adrenomedullin analogue with NH2 terminus truncation that affects cell proliferation and angiogenesis in cancer. Synonyms: Human adrenomedullin-(1-52)-NH2 (TFA); Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2.TFA (Disulfide bridge: Cys16-Cys21). Grade: >98%. Molecular formula: C266H407F3N80O79S3. Mole weight: 6142.76.
Adrenomedullin (AM) (1-52), human TFA
Adrenomedullin (AM) (1-52), human (TFA) affects cell proliferation and angiogenesis in cancer. Uses: Scientific research. Group: Peptides. Alternative Names: Human adrenomedullin-(1-52)-NH2 TFA. Pack Sizes: 500 ?g; 1 mg. Product ID: HY-P1455A.
Adrenomedullin (AM) (22-52), human
Adrenomedullin (AM) (22-52), human, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist, and also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat[1][2]. Uses: Scientific research. Group: Peptides. Alternative Names: 22-52-Adrenomedullin (human). CAS No. 159899-65-7. Pack Sizes: 500 ?g; 1 mg; 5 mg. Product ID: HY-P1471.
Adrenomedullin (AM) (22-52), human
Adrenomedullin (AM) (22-52), human, an adrenomedullin analogue with NH2 terminus truncation, is an adrenomedullin receptor antagonist that also antagonizes calcitonin-generating peptide (CGRP) receptors in the vascular bed of the hindlimb of cats. Synonyms: 22-52-Adrenomedullin (human); Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2; L-threonyl-L-valyl-L-glutaminyl-L-lysyl-L-leucyl-L-alanyl-L-histidyl-L-glutaminyl-L-isoleucyl-L-tyrosyl-L-glutaminyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-lysyl-L-alpha-aspartyl-L-lysyl-L-alpha-aspartyl-L-asparagyl-L-valyl-L-alanyl-L-prolyl-L-arginyl-L-seryl-L-lysyl-L-isoleucyl-L-seryl-L-prolyl-L-glutaminyl-glycyl-L-tyrosinamide. Grade: ≥95%. CAS No. 159899-65-7. Molecular formula: C159H252N46O48. Mole weight: 3575.97.
Adrenomedullin (rat) is an effective vasodilator peptide. Adrenomedullin is actively secreted by endothelial cells (EC) and vascular smooth muscle cells (VSMC) [1]. Uses: Scientific research. Group: Peptides. CAS No. 161383-47-7. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P4853.
Adrenomedullin (rat)
Adrenomedullin (rat), a synthetic rat adrenomedullin (rADM), induces a potent and sustained hypotensive activity in anesthesized rats. Synonyms: ADM (1-50) (rat); H-Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys14-Cys19). Grade: ≥95%. CAS No. 161383-47-7. Molecular formula: C242H381N77O75S5. Mole weight: 5729.49.
Adrenorphin
Adrenorphin is an opioid octapeptide that acts as an agonist of μ-opioid receptor. Synonyms: L-Valinamide, L-tyrosylglycylglycyl-L-phenylalanyl-L-methionyl-L-arginyl-L-arginyl-; L-Tyrosylglycylglycyl-L-phenylalanyl-L-methionyl-L-arginyl-L-arginyl-L-valinamide; Adrenorphin (human); Adrenorphin (ox); BAM 8; Metaphinamide; Metorphamide; Metorphamide (ox); Metorphinamide; H-Tyr-Gly-Gly-Phe-Met-Arg-Arg-Val-NH2. Grade: >95%. CAS No. 88377-68-8. Molecular formula: C44H69N15O9S. Mole weight: 984.18.
Adrenorphin TFA
Adrenorphin TFA is an opioid octapeptide that acts as an agonist of μ-opioid receptor with a Ki of 12 nM. Synonyms: Adrenorphin (human), trifluoroacetate (salt); L-Tyrosylglycylglycyl-L-phenylalanyl-L-methionyl-L-arginyl-L-arginyl-L-valinamide trifluoroacetate; Adrenorphin (ox) trifluoroacetat; BAM 8 trifluoroacetate; Metaphinamide trifluoroacetate; Metorphamide trifluoroacetate; Metorphamide (ox) trifluoroacetate; Metorphinamide trifluoroacetate; H-Tyr-Gly-Gly-Phe-Met-Arg-Arg-Val-NH2.TFA; Adrenorphin 3TFA. Grade: ≥95%. Molecular formula: C46H70F3N15O11S. Mole weight: 1098.22.
Adrenosterone
Steroid hormone with weak androgenic effects. Group: Biochemicals. Alternative Names: Androst-4-ene-3,11,17-trione; 11-Keto-4-androstene-3,17-dione; 11-Oxo-4-androstene-3,17-dione; Reichstein's substance G; NSC 12166. Grades: Highly Purified. CAS No. 382-45-6. Pack Sizes: 500mg. US Biological Life Sciences.
Worldwide
Adriamycinone
Adriamycinone. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Adriamycinone;Doxorubicinone. Product Category: Heterocyclic Organic Compound. Appearance: Red Solid. CAS No. 24385-10-2. Molecular formula: C21H18O9. Mole weight: 414.36. Product ID: ACM24385102. Alfa Chemistry ISO 9001:2015 Certified.
Adriforant hydrochloride
Adriforant hydrochloride (PF-3893787 hydrochloride) is a novel histamine H4 receptor antagonist binding affinity ( K i =2.4 nM) and is also a functional ( K i =1.56 nM) antagonist. Uses: Scientific research. Group: Signaling pathways. Alternative Names: PF-3893787 hydrochloride. CAS No. 2096455-90-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-19705B.
Adriforant hydrochloride
Adriforant hydrochloride is a novel histamine H4 receptor antagonist with a binding affinity (Ki) value of 2.4 nM. It is also a functional H4 receptor antagonist with a Ki of 1.56 nM. Synonyms: PF-3893787 hydrochloride; N4-(Cyclopropylmethyl)-6-[(3R)-3-(methylamino)-1-pyrrolidinyl]-2,4-pyrimidinediamine trihydrochloride; 2,4-Pyrimidinediamine, N4-(cyclopropylmethyl)-6-[(3R)-3-(methylamino)-1-pyrrolidinyl]-, hydrochloride (1:3). Grade: ≥98%. CAS No. 2096455-90-0. Molecular formula: C13H25Cl3N6. Mole weight: 371.74.
Adrogolide
Adrogolide,a quinoline derivative, has been found to be a dopamine D1 receptor agonist that was once studied in Parkinson's disease. Synonyms: A-86929; 9,10-Dihydroxy-2-propyl-4,5,5a(R),6,7,11b(S)-hexahydrobenzo[f]thieno[2,3-c]quinoline. Grade: 98%. CAS No. 171752-56-0. Molecular formula: C22H25NO4S. Mole weight: 399.51.
Adrogolide hydrochloride
The hydrochloride salt form of Adrogolide,a quinoline derivative, has been found to be a dopamine D1 receptor agonist that was once studied in Parkinson's disease. Synonyms: Adrogolide hydrochloride; ABT-431; ABT 431; ABT431; Adrogolide HCl; UNII-69MG3OZA0H; 69MG3OZA0H; A-93431.1; Benzo(f)thieno(2,3-c)quinoline-9,10-diol, 4,5,5a,6,7,11b-hexahydro-2-propyl-, diacetate (ester), hydrochloride, (5aR-trans)-. Grade: 98%. CAS No. 166591-11-3. Molecular formula: C22H26ClNO4S. Mole weight: 435.96.
Adrogolide hydrochloride
Adrogolide hydrochloride (ABT-431 hydrochloride) is a chemically stable prodrug that can convert to the dopamine D1 receptor agonist A-86929. Adrogolide hydrochloride ameliorates the MPTP (HY-15608)-induced Parkinson's Disease in marmoset model, reduces the dyskinesias tendency. Adrogolide hydrochloride reverses Risperidone (HY-11018)-induced cognitive deficits in monkey [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: ABT-431 hydrochloride; DAS-431 hydrochloride. CAS No. 166591-11-3. Pack Sizes: 1 mg. Product ID: HY-118956.
Adropin (34-76) (human, mouse, rat)
Adropin, a secreted factor involved in energy homeostasis and lipid metabolism, is encoded by the energy homeostasis-related gene (Enho) and expressed in the liver and brain. In diet-induced obesity (DIO) mice, adropin (34-76) reduced hepatosteatosis and insulin resistance, regardless of obesity or food intake. In addition, adropin could be a regulator of endothelial function. Synonyms: H-Cys-His-Ser-Arg-Ser-Ala-Asp-Val-Asp-Ser-Leu-Ser-Glu-Ser-Ser-Pro-Asn-Ser-Ser-Pro-Gly-Pro-Cys-Pro-Glu-Lys-Ala-Pro-Pro-Pro-Gln-Lys-Pro-Ser-His-Glu-Gly-Ser-Tyr-Leu-Leu-Gln-Pro-OH (Disulfide bridge: Cys1-Cys23); L-Cysteinyl-L-histidyl-L-seryl-L-arginyl-L-seryl-L-alanyl-L-alpha-aspartyl-L-valyl-L-alpha-aspartyl-L-seryl-L-leucyl-L-seryl-L-alpha-glutamyl-L-seryl-L-seryl-L-prolyl-L-asparaginyl-L-seryl-L-seryl-L-prolylglycyl-L-prolyl-L-cysteinyl-L-prolyl-L-alpha-glutamyl-L-lysyl-L-alanyl-L-prolyl-L-prolyl-L-prolyl-L-glutaminyl-L-lysyl-L-prolyl-L-seryl-L-histidyl-L-alpha-glutamylglycyl-L-seryl-L-tyrosyl-L-leucyl-L-leucyl-L-glutaminyl-L-proline cyclic (1→23)-disulfide. Grade: ≥95%. CAS No. 1802086-30-1. Molecular formula: C190H293N55O68S2. Mole weight: 4499.82.
Adropin (34-76) (human, mouse, rat)
Adropin (34-76) is a secretory domain of Adropin. Adropin (34-76) can inhibit cAMP level and glucose production in hepatocytes, and has a hypoglycemic effect. Adropin (34-76) plays an antifibrotic role by inhibiting the GLI1 signaling pathway [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 1802086-30-1. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P4860.
ADS032
ADS032 is a sulfonylurea compound that is an NLRP1 and NLRP3 inflammasome inhibitor. ADS032 reduces the secretion of inflammatory factors and inhibits the oligomerization of ASC. ADS032 has anti-inflammatory effects in a variety of inflammatory models and can be used in the study of inflammatory diseases[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2757333-37-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-156798.
ADT-007
ADT-007 is a potent and orally active pan-RAS inhibitor with strong anticancer effects. ADT-007 binds RAS in a nucleotide-free conformation to block GTP activation. ADT-007 potently and selectively inhibits the growth of cancer cells with mutated or hyper-activated wild-type RAS isozymes[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1945941-09-2. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-157887.
a-D-Thiomannose sodium salt
A-D-Thiomannose sodium salt, hailed for its biomedicinal potential, is a chemical compound of great interest. Known for its participation in glycosylation and oligosaccharide synthesis, it is celebrated for its perceived therapeutic value in treating bacterial infections and preventing cancer. While much work remains to be done, it is a substance ripe for further exploration and experimentation. Synonyms: α-D-Mannopyranose, 1-thio-, sodium salt (1:1); α-D-Mannopyranose, 1-thio-, monosodium salt. CAS No. 111057-34-2. Molecular formula: C6H11NaO5S. Mole weight: 218.21.
ADTL-SA1215
ADTL-SA1215 inhibited the proliferation and migration of human breast carcinoma MDA-MB-231 cells by SIRT3-driven autophagy/mitophagy signaling pathways in vitro and in vivo. Synonyms: ADTL SA1215. CAS No. 782387-91-1. Molecular formula: C26H29I2NO3. Mole weight: 657.32.
ADT-OH
ADT-OH is a derivative of anethole dithiolethione (ADT) and synthetic hydrogen sulfide (H2S) donor. ADT is a putative neuroprotectant and antioxidant that increases glutathione levels in cultured astroglial cells. ADT-OH was shown to reduce tPA-enhanced Akt activation and VEGF expression in brain microvascular endothelial cells. Synonyms: 5-(4-hydroxyphenyl)-3H-1,2-dithiole-3-thione; Desmethylanethol trithione; 3H-1,2-Dithiole-3-thione, 5-(4-hydroxyphenyl)-. CAS No. 18274-81-2. Molecular formula: C9H6OS3. Mole weight: 226.326.
ADT-OH
ADT-OH is a hydrogen sulfide-releasing donor. ADT-OH induces apoptosis and upregulates FADD. ADT-OH inhibits FAK/Paxillin. ADT-OH has the potential for the research of cancer diseases [1] [5]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: 5-(4-Hydroxyphenyl)-3H-1,2-dithiole-3-thione; ACS 1. CAS No. 18274-81-2. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-109582.
AdTx1
AdTx1 is a high affinity, selective and non-competitive α1A adrenoceptor antagonist with Ki value of 0.35 nM. It is a 65 amino-acid peptide originally isolated from the venom of the green mamba. It is stabilized by four disulfide bridges and belongs to the family of the three-finger-fold peptide. It displays no significant activity against a range of other GPCRs. It antagonizes effects of phenylephrine on intra-urethral pressure in rats and on isolated rabbit prostate muscle in vitro. It is used as a potent relaxant of smooth muscles. Synonyms: ρ-Da1a. Grade: >98%. Molecular formula: C310H481N87O100S8. Mole weight: 7283.22.
Aducanumab
Aducanumab (BIIB037) is a human monoclonal antibody that selectively targets aggregated amyloid-beta (Aβ). Aducanumab shows brain penetration, and can be used for Alzheimer's disease (AD) research [1]. Uses: Scientific research. Group: Inhibitory antibodies. Alternative Names: BIIB037. CAS No. 1384260-65-4. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P9967.
Aducanumab
Aducanumab is a human monoclonal antibody targeting amyloid-β (Aβ). Aducanumab has been approved for the treatment of Alzheimer's disease (AD). Synonyms: BIIB037. CAS No. 1384260-65-4.
ADU-S100 ammonium salt
ML RR-S2 CDA ammonium salt is an inducer of stimulator of interferon genes (STING). It can increases type I interferon production by THP-1 human monocytes relative to unmodified cyclic di-AMP, indicating the ML enhances its action at human STING. Synonyms: MIW815 ammonium salt; ML RR-S2 CDA ammonium salt; [P(R)]-5'-O-[(R)-hydroxymercaptophosphinyl]-P-thioadenylyl-(2'→5')-adenosine, cyclic nucleotide, diammonium salt; STING Inducer-1. Grade: 98%. CAS No. 1638750-96-5. Molecular formula: C20H30N12O10P2S2. Mole weight: 724.6.
ADU-S100 disodium salt
ADU-S100 disodium salt (MIW815 disodium salt) is an activator of stimulator of interferon genes (STING) for treating cancer. Synonyms: MIW815 disodium salt; ML RR-S2 CDA disodium salt; 2',3'-c-di-AM(PS)2 (Rp,Rp); Adenosine, [P(R)]-5'-O-[(R)-hydroxymercaptophosphinyl]-P-thioadenylyl-(2'→5')-, cyclic nucleotide, sodium salt (1:2); ADU-S 100; MIW 815. Grade: 98%. CAS No. 1638750-95-4. Molecular formula: C20H22N10Na2O10P2S2. Mole weight: 734.51.
Adustin
Akrabicin is an antibiotic produced in Streptomyces galactis against yeast and tinea mold. Synonyms: (3-Hydroxy-2-furanyl)phenylmethanone; Methanone, (3-hydroxy-2-furanyl)phenyl-; (2E)-2-[hydroxy(phenyl)methylidene]furan-3-one; 2-Benzoyl-3-hydroxyfuran. CAS No. 69579-74-4. Molecular formula: C11H8O3. Mole weight: 188.18.
Advantame
Advantame is a combination of Aspartame (A790015) and Vanillin (V097500). Advantame was developed as a high-intensity, low calorie sweetener that is 20,000 times sweeter than sucrose. Group: Biochemicals. Grades: Highly Purified. CAS No. 245650-17-3. Pack Sizes: 10mg, 25mg. Molecular Formula: C24H30N2O7. US Biological Life Sciences.
Worldwide
Advantame
Advantame is a non-caloric artificial sweetener, analogue of aspartame, commonly used as a food additive [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 714229-20-6. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-122351A.
ADW742
NVP-ADW742 is a novel small weight molecular inhibitor of IGF-IR with potential anticancer activity. NVP-ADW742 inhibited IGF-IR-mediated proliferation with an IC50 of 11.12 μmol/l. NVP-ADW742 induced early suppression of Akt, P38 and GSK-3β phosphorylation. NVP-ADW742 was found to suppresse survival and resistance to chemotherapy in acute myeloid leukemia cells. Synonyms: NVP-ADW742; NVP ADW-742; NVP ADW 742; ADW 742; ADW-742; ADW742; GSK 552602A; GSK-552602A; GSK552602A. Grade: 0.98. CAS No. 475488-23-4. Molecular formula: C28H31N5O. Mole weight: 453.59.
ADWX 1
ADWX 1 has been found to be a Kv1.3 channel blocker and could probably ameliorate autoimmune encephalomyelitis at some extent. Synonyms: ADWX1. Grade: >98%. Molecular formula: C169H281N57O46S7. Mole weight: 4071.86.
ADWX 1
ADWX 1. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 100ug. US Biological Life Sciences.
Worldwide
ADX 10059 hydrochloride
ADX 10059 hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 757949-98-7. Pack Sizes: 10mg, 50mg. US Biological Life Sciences.
Worldwide
ADX 10059 hydrochloride
The hydrochloride salt form of ADX 10059, which has been reported to be a negative allosteric modulator. Synonyms: ADX-10059 Hydrochloride; ADX10059 Hydrochloride; ADX 10059 Hydrochloride; ADX10059 HCl; 2-[(3-Fluorophenyl)ethynyl]-4,6-dimethyl-3-pyridinamine hydrochloride. Grade: ≥99% by HPLC. CAS No. 757949-98-7. Molecular formula: C15H13FN2.HCl. Mole weight: 276.74.
ADX-47273
ADX-47273 is a drug used in scientific research which acts as a positive allosteric modulator selective for the metabotropic glutamate receptor subtype mGluR5. Synonyms: TKI-258 Dilactic Acid; TKI 258 Dilactic Acid; TKI258 Dilactic Acid; ADX-47273; ADX 47273; ADX47273. Grade: >98%. CAS No. 851881-60-2. Molecular formula: C20H17F2N3O2. Mole weight: 369.36.
ADX-47273
ADX-47273 is a potent, selective and brain-penetrant mGluR5 positive allosteric modulator (PAM), with an EC 50 of 0.17 μM for potentiation of glutamate (50 nM) response. ADX-47273 has antipsychotic and procognitive activities [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 851881-60-2. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-13058.
ADX71743 is a highly selective, noncompetitive and brain-penetrant metabotropic glutamate receptor 7 negative allosteric modulator ( mGlu7 NAM ). ADX71743 has anxiolytic-like activity [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1431641-29-0. Pack Sizes: 1 mg; 5 mg. Product ID: HY-110278.
ADX88178
This active molecular is a selectiveMetabotropic glutamate receptor 4 agonist and modulator under the development of Addex Therapeutics. In the marble burying test, ADX88178 can reduce the number of buried marbles Meanwhile, in the EPM (elevated plus maze) test, it can also increase open-arm exploration, indicative of anxiolytic-like efficacy. Now, preclinical trials for Anxiety disorders, Cocaine abuse, Multiple sclerosis and Parkinson's diseas were on-going. Uses: Anxiety disorders; cocaine abuse; multiple sclerosis; parkinson's disease. Synonyms: ADX-88178; ADX 88178; ADX88178. SCHEMBL369060; GTPL6238; SCHEMBL 369060; GTPL 6238; SCHEMBL-369060; GTPL-6238; 5-methyl-N-(4-methylpyrimidin-2-yl)-4-(1H-pyrazol-4-yl)-1,3-thiazol-2-amine. Grade: 98%. CAS No. 1235318-89-4. Molecular formula: C12H12N6S. Mole weight: 272.33.