A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| Fsp4H I | One unit of the enzyme is the amount required to hydrolyze 1 μg of Lambda DNA in 1 hour at 37°C in a total reaction volume of 50 μl. Applications: After 5-fold overdigestion with enzyme about 5% of the dna fragments can be ligated and recut. Group: Restriction Enzymes. Purity: 200U; 1000U. GC↑NGC CGN↓CG. Activity: 3000-5000u.a./ml. Appearance: 10 X SE-buffer Y. Storage: -20°C. Form: Liquid. Source: An E.coli strain that carries the cloned Fsp4H I gene from Flavobacterium species 4H. Pack: 10 mM Tris-HCl (pH 7.5); 100 mM NaCl; 0.1 mM EDTA; 200ug/ml BSA; 1mM DTT; 50% glycerol. Cat No: ET-1114RE. |  |
| FT011 | FT011. CAS No. 1001288-58-9. |  |
| FT011 | FT011 is an anti-fibrotic agent, reduces mRNA expression of collagens I and III and inhibits collagen synthesis[1]. FT011 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Asengeprast. CAS No. 1001288-58-9. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-100495. |  |
| FT113 | FT113 is a potent and orally active fatty acid synthase (FASN) inhibitor, with an IC50 of 213 nM for full-length recombinant human FASN enzyme. In cell-based assay, FT113 blocks FASN activity in BT474 cells (IC50, 90 nM). FT113 shows anti-proliferative activity, and exhibits anti-cancer activity both in vitro and in vivo[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1630808-89-7. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-111551. | |
| FT206 | FT206 is the inhibitor for ubiquitin-specific protease that inhibits USP28 and USP25 with IC50s of 0.15 μM and 1.01 μM[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2278274-34-1. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-138698. | |
| FT709 | FT709 is a potent and selective USP9X inhibitor, an IC50 of 82 nM. USP9X has been linked with centrosome function, chromosome alignment during mitosis, EGF receptor degradation, chemo-sensitization, and circadian rhythms[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2413991-74-7. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-145967. | |
| FT895 | FT895 is a potent and selective HDAC11 inhibitor with an IC50 of 3 nM[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2225728-57-2. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-112285. | |
| FTase Inhibitor I | FTase inhibitor I is a potent and selective farnesyltransferase (FTase) inhibitor with an IC50 of 21 nM, which is 30-fold higher for FTase over geranylgeranyl transferase (GGTase; IC50 = 790 nM). Alternative Names: Farnesyltransferase Inhibitor I; B581; N-[(2S)-2-[[(2R)-2-amino-3-mercaptopropyl]amino]-3-methylbutyl]-L-phenylalanyl-L-methionine. Grades: ≥95%. CAS No. 149759-96-6. Molecular formula: C22H38N4O3S2. Mole weight: 470.69. | |
| FTase Inhibitor II | FTase Inhibitor II is a cell-permeable analog of farnesyl pyrophosphate (FPP) that potently inhibits FTase with an IC50 of 50-75 nM, and it does not inhibit geranylgeranyl transferase at similar concentrations (IC50 > 100 μM). FTase Inhibitor II is a possible cancer therapeutic agent. Alternative Names: Farnesyltransferase Inhibitor II; FTI-II; N-[4-[[(2R)-2-amino-3-mercapto-1-oxopropyl]amino]benzoyl]-L-methionine. Grades: ≥80%. CAS No. 156707-43-6. Molecular formula: C15H21N3O4S2. Mole weight: 371.47. | |
| FT-FAPI-12_9 | FT-FAPI-12_9 is a FAP ligand that can be used to synthesize FAPI-46, a radiotracer targeting FAP[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2883407-81-4. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-164316. | |
| FTI 276 | FTI 276. Group: Biochemicals. Grades: Purified. CAS No. 1217471-51-6. Pack Sizes: 1mg. US Biological Life Sciences. |  Worldwide |
| FTI 276 TFA | FTI 276 TFA is a farnesyltransferase (FTase) inhibitor with an IC50 of 0.5 nM, and it exhibits selectivity for FTase over geranylgeranyltransferase I (GGTase I). FTI 276 TFA blocks the farnesylation of H-Ras and K-Ras4B, causes inactive Ras-Raf complexes to accumulate in the cytoplasm, and inhibits constitutive MAPK activation. FTI 276 TFA reduces the number, incidence and volume of tumors, and restricts the growth of tumors expressing activated K-ras. FTI 276 TFA can be used in research related to pulmonary adenoma[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1217471-51-6. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15873A. | |
| FTI 277 | FTI 277. Group: Biochemicals. Grades: Purified. CAS No. 1217447-06-7. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| FTI-277 hydrochloride | FTI-277 hydrochloride is an inhibitor of farnesyl transferase (FTase); a highly potent Ras CAAX peptidomimetic which antagonizes both H- and K-Ras oncogenic signaling. FTI-277 hydrochloride can inhibit hepatitis delta virus (HDV) infection. Uses: Scientific research. Category: Signaling pathways. CAS No. 180977-34-8. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15872A. | |
| FTIDC | FTIDC is an orally active, noncompetitive, selective allosteric metabotropic glutamate receptor (mGluR) 1 antagonist with an IC50 of 5.8 nM for human mGluR1a. FTIDC has no species differences in its antagonistic activity on recombinant human, mouse, and rat mGluR1[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 873551-53-2. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-100405. | |
| FTIDC | FTIDC. Group: Biochemicals. Grades: Purified. CAS No. 873551-53-2. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| FTO Coated Glass | FTO Coated Glass. |  |
| FTO-IN-3 | FTO-IN-3 is a FTO inhibitor that impair self-renewal in glioblastoma stem cells. Uses: Scientific research. Category: Signaling pathways. CAS No. 2585198-87-2. Pack Sizes: 5 mg; 10 mg. Product ID: HY-132865. | |
| FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | It is a derivative of Exendin-4 peptide. Alternative Names: Phe-Thr-Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser. Grades: ≥95%. Molecular formula: C164H252N42O53S. Mole weight: 3692.12. | |
| FTT5 | FTT5 is an ionizable lipid that can be used to prepare lipid nanoparticles for efficient delivery of long-chain mRNA in vivo[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2328129-27-5. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-145793. | |
| FTTF | FTTF. Alternative Names: 5,5'-Di(9H-fluoren-2-yl)-2,2'-bithiophene. CAS No. 369599-41-7. Molecular formula: C34H22S2. Mole weight: 494.67. Purity: 96%. IUPAC Name: 2-(9H-fluoren-2-yl)-5-[5-(9H-fluoren-2-yl)thiophen-2-yl]thiophene. SMILES: C1c2ccccc2-c3ccc(cc13)-c4ccc(s4)-c5ccc(s5)-c6ccc-7c(Cc8ccccc-78)c6. | |
| FTY720 (Fingolimod) Hydrochloride | Fingolimod (FTY720, Fingolimod Hydrochloride) HCl is a S1P antagonist with IC50 of 0.033 nM in K562, and NK cells. Please use saline solution rather than PBS for dilutions. PBS may cause precipitation. Group: Inhibitors. Alternative Names: Fingolimod Hydrochloride,FTY720. CAS No. 162359-56-0. Pack Sizes: 100mg. Product ID: S5002. Formula: C19H33NO2.HCl. Smiles: CCCCCCCCC1=CC=C(C=C1)CCC(CO)(CO)N.Cl. Storage Conditions: 2 years -80 in solvent. |  United States; Europe |
| FTY720 hexanoic acid hydrochloride | FTY720 hexanoic acid hydrochloride. Group: Biochemicals. Alternative Names: 4-[3-Amino-4-hydroxy-3- (hydroxymethyl) butyl]benzenehexanoic acid hydrochloride. Grades: Highly Purified. CAS No. 896472-94-9. Pack Sizes: 10mg. Molecular Formula: C17H28ClNO4. US Biological Life Sciences. | Worldwide |
| FTY720 Hydrochloride | FTY720 is a derivative of ISP-1 (myriocin), a fungal metabolite of the Chinese herb Iscaria sinclarii as well as a structural analogue of Sphingosine. FTY720 is a novel immune modulator that prolongs allograft transplant survival in numberour models by inhibiting lymphocyte emigration from lymphoid organs. FTY720 us reported to be phosphorylated by sphingosine kinase to FTY720-P, which has been shown to potently stimulate GTPgS binding activity in S1P-transfected CHO cells (EC50 = 210 pM, 4.9 nM, 4.3 nM, and 1 nM for S1P1, S1P3, S1P4 and S1P5, respectively). Group: Biochemicals. Alternative Names: 2-Amino-2- (2- (4-octylphenyl) ethyl) propane-1, 3-diol Hydrochloride; Fingolimod Hydrochloride. Grades: Highly Purified. CAS No. 162359-56-0. Pack Sizes: 100mg. US Biological Life Sciences. | Worldwide |
| FTY720 Hydrochloride (Gilenya, 2-Amino-2-[2-(4-octylphenyl)ethyl]-1,3-propanediol. HCl, Fingolimod) | Cell permeable immunosuppressor displaying lymphocyte sequestration properties and used for treatment in multiple sclerosis. Potent sphingosine 1-phosphate (S1P) receptor (S1P1, S1P3, S1P4, and S1P5) agonist when phosphorylated by sphingosine kinase. Sphingosine transporter Abcb1 and leukotriene C4 transporter Abcc1 activity enhancer. Cytosolic phospholipase A2 inhibitor, independent of sphingosine 1-phosphate receptors. Autophagy inducer. Apoptosis inducer. Group: Biochemicals. Grades: Highly Purified. CAS No. 162359-56-0. Pack Sizes: 1mg, 5mg, 25mg. US Biological Life Sciences. | Worldwide |
| FTY720 octanoic acid hydrochloride | FTY720 octanoic acid hydrochloride. Group: Biochemicals. Alternative Names: 4-[3-Amino-4-hydroxy-3- (hydroxymethyl) butyl]benzeneoctanoic acid hydrochloride. Grades: Highly Purified. CAS No. 896472-95-0. Pack Sizes: 1mg, 2mg, 5mg, 10mg. Molecular Formula: C19H32ClNO4. US Biological Life Sciences. | Worldwide |
| FTY720 (S)-Phosphate | FTY720 (S)-Phosphate is an agonist of S1P receptor 1 (S1PR1), used in the research of acute inflammatory diseases such as acute lung injury. Uses: Scientific research. Category: Signaling pathways. Alternative Names: (S)-FTY720P; (S)-FTY720 phosphate. CAS No. 402616-26-6. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15382. | |
| Fuberidazole | Fuberidazole. Group: Biochemicals. Alternative Names: 2-(2-Furanyl)-1H-benzimidazole; 2-(2-Furanyl)benzimidazole; 2-(2-Furyl)benzimidazole; 2-(2'-Furyl)benzimidazole; 2-(Furan-2-yl)benzimidazole; B 33172; BAY 33172; Bayer 33172; Fuberidazol; Furidazol; Furidazole; NSC 72670; PF 7402; Voronit; 2-(2-Furyl)-benzimidazole; 2-(2-Furanyl)-1H-benzimidazole. Grades: Highly Purified. CAS No. 3878-19-1. Pack Sizes: 500mg. Molecular Formula: C11H8N2O, Molecular Weight: 184.19. US Biological Life Sciences. | Worldwide |
| FUB-JWH 018 | FUB-JWH 018 is an analog of JWH 018 (P283650), the 18th compound synthesized in a series of more than 470 analogs and metabolites of ?9-Tetrahydro- cannabinol (THC) (T293200), the active component of marijuana. JWH 018 acts as cannabinoid receptor. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 1mg, 5mg. Molecular Formula: C26H18FNO, Molecular Weight: 379.43. US Biological Life Sciences. | Worldwide |
| FUBP1-IN-1 | FUBP1-IN-1 is a potent FUSE binding protein 1 (FUBP1) inhibitor which interferes with the binding of FUBP1 to its single stranded target DNA FUSE sequence , with an IC50 value of 11.0 μM[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 883003-62-1. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-100758. | |
| Fuc-a-1-2-Gal-b-1-3-GalNAc-b-1-4-Gal-b-1-4-Glc-b-ethylazide | Fuc-a-1-2-Gal-b-1-3-GalNAc-b-1-4-Gal-b-1-4-Glc-b-ethylazide. | |
| Fuchsin acid | 25g Pack Size. Group: Stains & Indicators. Formula: C20H20N2O9S3. CAS No. 3244-88-0. Prepack ID 16313560-25g. Molecular Weight 585.5382. See USA prepack pricing. |  |
| Fuchsin Acid Calcium Salt Certified | Fuchsin Acid Calcium Salt Certified. Uses: For analytical and research use. Alternative Names: Acid Magenta. CAS No. 123334-10-1. Molecular formula: C20H17CaN3O9S3. Mole weight: 579.6. IUPAC Name: calcium;2-amino-5-[(4-amino-3-sulfonatophenyl)-(4-imino-3-methyl-5-sulfocyclohexa-2,5-dien-1-ylidene)methyl]benzenesulfonate. Catalog: APB123334101. |  |
| Fuchsin Acid, Certified 99+% (Dye content) | Fuchsin Acid, Certified 99+% (Dye content). Group: Biochemicals. Grades: Certified Dye. Pack Sizes: 25g, 100g, 250g, 1Kg. US Biological Life Sciences. | Worldwide |
| Fuchsin Basic (C.I. 42510) DC | 25g Pack Size. Group: Stains & Indicators. Formula: C20H20ClN3. CAS No. 632-99-5. Prepack ID 51119322-25g. Molecular Weight 337.85. See USA prepack pricing. | |
| Fucogalactan | Fucogalactan. | |
| Fucoidan | Fucoidan is a polysaccharide composed predominantly of sulfated fucose. Group: Biochemicals. Grades: Highly Purified. CAS No. 9072-19-9. Pack Sizes: 500mg, 1000mg. Molecular Formula: N/A, Molecular Weight: US Biological Life Sciences. | Worldwide |
| Fucoidan | 1g Pack Size. Group: Biochemicals, Carbohydrates, Sugars. Formula: N/A. CAS No. 9072-19-9. Prepack ID 19821160-1g. See USA prepack pricing. | |
| Fucoidan | Fucoidan, a biologically active polysaccharide, is an efficient inhibitor of α-amylase and α-glucosidase. Anticoagulant, antitumor, antioxidant and antisteatotic activities[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 9072-19-9. Pack Sizes: 100 mg; 500 mg. Product ID: HY-132179. | |
| Fucoidan | Fucoidan is a polysaccharide rich in diverse bioactive compounds found in brown marine algae (Phaeophyta, typically Ascophyllum nodosum and Laminaria digitata). It has anticoagulant activity and consists mainly of α(1-4) and α(1-2) linked L-fucose sulfates, although galactose is also present, with many variations of the basic structure found in different species of Phaeophyta. Esteemed for its exceptional immunomodulatory and anti-inflammatory attributes, fucoidan has been explored for its potential against formidable adversaries like cancer, viral infections, cardiovascular diseases, and inflammatory conditions. Alternative Names: Sulfated L-fucan; DH 0201; Fuco'min; Fuco'min; Fucoidin; Fucoidine; LF 0902; Limuveil HV; Nemacystus mucilage; Sea Alga-F; Fucoidan - Ascophyllum nodosum. CAS No. 9072-19-9. Molecular formula: (C6H9O3SO3)n. | |
| Fucoidan 85% Powder | Fucoidan 85% Powder. |  CA, FL & NJ |
| Fucoidan - Alaria | Fucoidan - Alaria is an organic element hailing from the abundant Alaria seaweed, fostering immunological fortification and demonstrating effective anti-inflammatory attributes. Fucoidan - Alaria reveals encouraging indications for studying a range of afflictions such as cancer, diabetes and cardiovascular complexities. Alternative Names: Sulfated L-Fucan (Alaria). Molecular formula: (C6H9O3SO3)n. | |
| Fucoidan - Ascophyllum nodosum, analytical grade | Fucoidan is ascophyllum nodosum is an analytical grade biopolymer, renowned for its immuno-modulatory and anti-inflammatory attributes. Fucoidan showcases encouraging outcomes in the research of cancer, cardiovascular ailment and as a potent antioxidant. Alternative Names: Sulfated L-Fucan (Ascophyllum nodosum). Molecular formula: (C6H9O3SO3)n. | |
| fucoidanase | This enzyme belongs to the family of hydrolases, to be specific those glycosidases that hydrolyse O- and S-glycosyl compounds. Group: Enzymes. Synonyms: α-L-fucosidase; poly(1,2-α-L-fucoside-4-sulfate) glycanohydrolase. Enzyme Commission Number: EC 3.2.1.44. CAS No. 37288-38-3. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3907; fucoidanase; EC 3.2.1.44; 37288-38-3; α-L-fucosidase; poly(1,2-α-L-fucoside-4-sulfate) glycanohydrolase. Cat No: EXWM-3907. | |
| Fucoidan - Cladosiphon | Fucoidan - Cladosiphon is an innate compound sourced from Cladosiphon, a species of brown seaweed, possessing remarkable anti-inflammatory and immunomodulatory attributes. Fucoidan - Cladosiphon can be used in studying an assorted array of ailments and pathological states, encompassing cancer, viral infections and inflammatory afflictions. Alternative Names: Sulfated L-Fucan (Cladosiphon). Molecular formula: (C9H9O3SO3)n. | |
| Fucoidan - Durvillea | Fucoidan - Durvillea is an extraordinary bioactive constituent originating from Durvillea seaweed, manifesting tremendous potential in the research of cancer, inflammation and viral infections. Alternative Names: Sulfated L-Fucan (Durvillea). Molecular formula: (C9H9O3SO3)n. | |
| Fucoidan - Ecklonia | Fucoidan extracted from Ecklonia species is a bioactive polysaccharide extensively used in biomedical field. Known for its anti-inflammatory and antioxidant properties, Fucoidan-Ecklonia has applications in studying cancer, cardiovascular diseases and neurodegenerative disorders. Alternative Names: Sulfated L-Fucan (Ecklonia). Molecular formula: (C6H9O3SO3)n. | |
| Fucoidan from Fucus vesiculosus | Fucoidan from Fucus vesiculosus. CAS No. 9072-19-9. | |
| Fucoidan from Macrocystis pyrifera | Fucoidan from Macrocystis pyrifera. CAS No. 9072-19-9. | |
| Fucoidan from Undaria pinnatifida | Fucoidan from Undaria pinnatifida. CAS No. 9072-19-9. | |
| Fucoidan - Fucus serratus | Fucoidan - Fucus serratus is an organic compound derived from the seaweed Fucus serratus with remarkable anti-inflammatory and antioxidant attributes. This multifaceted compound demonstrates promising potential in studying a wide array of ailments, encompassing neoplastic malignancies, cardiovascular pathologies and inflammatory afflictions. Alternative Names: Sulfated L-Fucan. Molecular formula: (C6H9O3SO3)n. | |
| Fucoidan - Fucus vesiculosus | Derived from Fucus vesiculosus is a brown seaweed, Fucoidan stands as a polysaccharide compound with natural origins. Through extensive employment in biomedical research, Fucoidan has exhibited promise in research of anticancer therapy, immunomodulation and inflammation. Its attributes position Fucoidan as a highly prospective contender for studying cancer, cardiovascular afflictions and inflammatory dysfunctions. Alternative Names: Sulfated L-Fucan (Fucus vesiculosus). Molecular formula: (C6H9O3SO3)n. | |
| Fucoidan - Laminaria digitata | Fucoidan - Laminaria Digitata is a remarkable natural polysaccharide extracted from the magnificent seaweed Laminaria Digitata. It has excellent anti-inflammatory, anticoagulant and anticancer properties, propelling exploration into potential researchs for diverse diseases encompassing cancer, cardiovascular ailments and viral afflictions. Alternative Names: Sulfated L-Fucan. Molecular formula: (C6H9O3SO3)n. | |
| Fucoidan - Laminaria japonicia | Fucoidan - Laminaria japonicia is an organic amalgamation extracted from the Laminaria japonicia marine flora with compelling anti-inflammatory and anticancer attributes. Fucoidan manifests promising prospects in studying ailments including neoplastic maladies, adipose aggregation and cardiovascular pathologies. Alternative Names: Sulfated L-Fucan (Laminaria japonicia). Molecular formula: (C6H9O3SO3)n. | |
| Fucoidan - Lessonia nigrescens | Fucoidan - Lessonia nigrescens is a naturally occurring polysaccharide extracted from brown seaweed, demonstrating promise as an antiviral and anticancer compound. Alternative Names: Sulfated L-Fucan (Lessonia nigrescens). Molecular formula: (C6H9O3SO3)n. | |
| Fucoidan - Macrocystis pyrifera | Fucoidan - Macrocystis pyrifera is a natural compound extracted from the brown seaweed Macrocystis pyrifera. This product possesses anti-inflammatory, antioxidant and anticancer effects. Fucoidan has been studied for its potential application in supporting immune system function, facilitating wound healing and exhibiting activities against various diseases including cancer, cardiovascular diseases, viral infections and diabetes. Alternative Names: Fucoidan, macrocystis pyrifera; Fucoidan, macrocystis pyrifera. Grades: 85%. Molecular formula: (C6H9O3SO3)n. | |
| Fucoidan - Pelvetia canaliculata | Fucoidan - Pelvetia canaliculata is an exceptional polysaccharide harvested from the intricate realms of brown algae Pelvetia canaliculata. It is used to studying inflammation,viral onslaughts and cancer. Alternative Names: Sulfated L-fucan. Molecular formula: (C9H9O3SO3)n. | |
| Fucoidan - Sargassum | Sargassum-derived Fucoidan, renowned for its potent anti-cancer and anti-inflammatory attributes, plays a pivotal role in combatting a diverse array of malignancies - including breast and colon cancers - alongside tackling inflammatory ailments such as arthritis and asthma. Alternative Names: Sulfated L-Fucan (Sargassum). Molecular formula: (C6H9O3SO3)n. | |
| Fucoidan - Undaria pinnatifida | Fucoidan - Undaria pinnatifida. Alternative Names: Sulfated L-Fucan (Undaria pinnatifida). Molecular formula: (C9H9O3SO3)n. | |
| fucokinase | Requires a divalent cation for activity, with Mg2+ and Fe2+ giving rise to the highest enzyme activity. Forms part of a salvage pathway for reutilization of L-fucose. Can also phosphorylate D-arabinose, but more slowly. Group: Enzymes. Synonyms: fucokinase (phosphorylating); fucose kinase; L-fucose kinase; L-fucokinase; ATP:6-deoxy-L-galactose 1-phosphotransferase; ATP:L-fucose 1-phosphotransferase. Enzyme Commission Number: EC 2.7.1.52. CAS No. 37278-00-5. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3083; fucokinase; EC 2.7.1.52; 37278-00-5; fucokinase (phosphorylating); fucose kinase; L-fucose kinase; L-fucokinase; ATP:6-deoxy-L-galactose 1-phosphotransferase; ATP:L-fucose 1-phosphotransferase. Cat No: EXWM-3083. | |
| fucose-1-phosphate guanylyltransferase | This enzyme belongs to the family of transferases, specifically those transferring phosphorus-containing nucleotide groups (nucleotidyltransferases). The systematic name of this enzyme class is GTP:beta-L-fucose-1-phosphate guanylyltransferase. Other names in common use include GDP fucose pyrophosphorylase, guanosine diphosphate L-fucose pyrophosphorylase, GDP-L-fucose pyrophosphorylase, GDP-fucose pyrophosphorylase, and GTP:L-fucose-1-phosphate guanylyltransferase. This enzyme participates in fructose and mannose metabolism. Group: Enzymes. Synonyms: GDP fucose pyrophosphorylase; guanosine diphosphate L-fucose pyrophosphorylase; GDP-L-fucose pyrophosphorylase; GDP-fucose pyrophosphorylase; GTP:L-fucose-1-phosphate guanylyltransferase. Enzyme Commission Number: EC 2.7.7.30. CAS No. 9033-14-1. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3241; fucose-1-phosphate guanylyltransferase; EC 2.7.7.30; 9033-14-1; GDP fucose pyrophosphorylase; guanosine diphosphate L-fucose pyrophosphorylase; GDP-L-fucose pyrophosphorylase; GDP-fucose pyrophosphorylase; GTP:L-fucose-1-phosphate guanylyltransferase. Cat No: EXWM-3241. | |
| Fucose 2-nitrophenylhydrazone | Fucose 2-nitrophenylhydrazone is an indispensable compound exhibiting inhibitory efficacy in studying select cancer types encompassing breast and colon carcinomas. Molecular formula: C12H17N3O6. Mole weight: 299.28. | |
| fucose-sulfate glycoconjugate | fucose-sulfate glycoconjugate. Product ID: ACMA00005017. Alfa Chemistry - ISO 9001:32057 Certified. |  |
| Fucosterol | Fucosterol is a sterol isolated from algae, seaweed or diatoms. Fucosterol exhibits various biological activities, including antioxidant, anti-adipogenic, blood cholesterol reducing, anti-diabetic and anti-cancer activities[1][2]. Fucosterol regulates adipogenesis via inhibition of PPARα and C/EBPα expression and can be used for anti-obesity agents development research[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 17605-67-3. Pack Sizes: 10 mM * 1 mL in Ethanol; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-N4103. | |
| Fucosterol | Fucosterol is a sterol isolated from algae with antioxidant, hepatoprotective, antiviral and antidiabetic properties. Alternative Names: Fucosterin; (24E)-24-N-Propylidenecholesterol; trans-24-Ethylidenecholesterol; (3beta,24E)-Stigmasta-5,24(28)-dien-3-ol; Stigmasta-5,24-dien-3beta-ol. Grades: 98%. CAS No. 17605-67-3. Molecular formula: C29H48O. Mole weight: 412.70. | |
| Fucosterol | Botanical Source: Group: Biochemicals. Grades: Plant Grade. CAS No. 17605-67-3. Pack Sizes: 20mg. US Biological Life Sciences. | Worldwide |
| fucosterol-epoxide lyase | The insect enzyme is involved in the conversion of sitosterol into cholesterol. Group: Enzymes. Synonyms: (24R,24'R)-fucosterol-epoxide acetaldehyde-lyase; (24R,24'R)-fucosterol-epoxide acetaldehyde-lyase (desmosterol-forming). Enzyme Commission Number: EC 4.1.2.33. CAS No. 99676-42-3. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4870; fucosterol-epoxide lyase; EC 4.1.2.33; 99676-42-3; (24R,24'R)-fucosterol-epoxide acetaldehyde-lyase; (24R,24'R)-fucosterol-epoxide acetaldehyde-lyase (desmosterol-forming). Cat No: EXWM-4870. | |
| fucosylgalactoside 3-α-galactosyltransferase | Acts on blood group substance, and can use a number of 2-fucosyl-galactosides as acceptors. Group: Enzymes. Synonyms: UDP-galactose:O-α-L-fucosyl(1?2)D-galactose α-D-galactosyltransferase; UDPgalactose:glycoprotein-α-L-fucosyl-(1,2)-D-galactose 3-α-D-galactosyltransferase; [blood group substance] α-galactosyltransferase; blood-group substance B-dependent galactosyltransferase; glycoprotein-fucosylgalacto. Enzyme Commission Number: EC 2.4.1.37. CAS No. 37257-33-3. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2583; fucosylgalactoside 3-α-galactosyltransferase; EC 2.4.1.37; 37257-33-3; UDP-galactose:O-α-L-fucosyl(1?2)D-galactose α-D-galactosyltransferase; UDPgalactose:glycoprotein-α-L-fucosyl-(1,2)-D-galactose 3-α-D-galactosyltransferase; [blood group substance] α-galactosyltransferase; blood-group substance B-dependent galactosyltransferase; glycoprotein-fucosylgalactoside α-galactosyltransferase; histo-blood group B transferase; histo-blood substance B-dependent galactosyltransferase; UDP-galactose:α-L-fucosyl-1,2-D-galactoside 3-α-D-galactosyltransferase; UDP-galactose:α-L-fucosyl-(1?2)-D-galactoside 3-α-D-galactosyltransferase. Cat No: EXWM-2583. | |
| Fucosyl-GM1 ganglioside | Fucosyl-GM1 ganglioside is an indispensable biomolecule with applicationa in the research of a myriad of afflictions encompassing neurodegenerative ailments, most notably Alzheimer's disease and Parkinson's disease. Alternative Names: Fucosylated monosialoganglioside GM1; 1-O-[O-(N-Acetyl-α-neuraminosyl)-(2→3)-O-[O-6-deoxy-α-L-galactopyranosyl-(1→2)-O-β-D-galactopyranosyl-(1→3)-2-(acetylamino)-2-deoxy-β-D-galactopyranosyl-(1→4)]-O-β-D-galactopyranosyl-(1→4)-β-D-glucopyranosyl]-ceramide; Fuc-GM1; Fucosyl ganglioside GM1; Fucosyl GM1; Ganglioside FG1. CAS No. 71812-11-8. Molecular formula: C79H141N3O35. Mole weight: 1692.96. | |
| Fucosyl GM1 oligosaccharide | Fucosyl GM1 oligosaccharide is a multifaceted biomedical compound with immune response augmentation and neuroprotective potency. Fucosyl GM1 oligosaccharide has applications in research of Alzheimer's disease, Parkinson's disease and multiple sclerosis. Alternative Names: Fuca1-2Galb1-3GalNAcb1-4(Neu5Aca2-3)Galb1-4Glc. Molecular formula: C43H71N2O33Na. Mole weight: 1167.01. | |
Our database is helping our users find suppliers everyday.
