American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
Fruit fiber mask Fruit fiber mask. Product ID: CDC10-0696. Category: Cosmetic Packaging Material. Product Keywords: Cosmetic Ingredients; Mask; CDC10-0696; Fruit fiber mask; Cosmetic Packaging Material;. CD Formulation
Fruit fiber mask Fruit fiber mask. Product ID: CDC10-0635. Category: Classic Mask. Product Keywords: Cosmetic Ingredients; Cosmetic packaging material; Fruit fiber mask; CDC10-0635; Classic Mask; Wood pulp fibers. CD Formulation
Frunevetmab Frunevetmab (NV-02) is a felinized anti- nerve growth factor (NGF) monoclonal antibody with a K d of 20 pM. Frunevetmab can effectively decrease osteoarthritis (OA) pain in cats [1] [2]. Uses: Scientific research. Group: Inhibitory antibodies. Alternative Names: NV-02. CAS No. 1708936-80-4. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P99627. MedChemExpress MCE
Fruquintinib Fruquintinib, also known as HMPL-013, is an orally available, small molecule inhibitor of vascular endothelial growth factor receptors (VEGFRs), with potential anti-angiogenic and antineoplastic activities. Synonyms: Fruquintinib; HMPL013; HMPL 013; HMPL-013. Grade: 98%. CAS No. 1194506-26-7. Molecular formula: C21H19N3O5. Mole weight: 393.39. BOC Sciences 8
Fruquintinib Fruquintinib (HMPL-013) is a highly potent and selective VEGFR 1/2/3 inhibitor with IC 50 s of 33, 0.35, and 35 nM, respectively. Uses: Scientific research. Group: Signaling pathways. Alternative Names: HMPL-013. CAS No. 1194506-26-7. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-19912. MedChemExpress MCE
Frutinate Frutinate. CAS No. 35206-51-0. VIGON Item # 502498. Categories: Speciality Ingrdients Suppliers, Fragrances, Perfumers. Vigon
America & Internationally
Frutinone A Frutinone A. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 6H,7H-[1]Benzopyrano[4,3-b][1]benzopyran-6,7-dione. Product Category: Heterocyclic Organic Compound. CAS No. 38210-27-4. Molecular formula: C16H8O4. Mole weight: 264.23. Purity: 0.96. IUPACName: chromeno[4,3-b]chromene-6,7-dione. Canonical SMILES: C1=CC=C2C(=C1)C3=C(C(=O)C4=CC=CC=C4O3)C(=O)O2. Density: 1.49g/cm³. Product ID: ACM38210274-1. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 4
Frutinone A Frutinone A. Group: Biochemicals. Alternative Names: 6H,7H-[1]Benzopyrano[4,3-b][1]benzopyran-6,7-dione. Grades: Highly Purified. CAS No. 38210-27-4. Pack Sizes: 10mg, 25mg, 50mg, 100mg, 250mg. Molecular Formula: C16H8O4. US Biological Life Sciences. USBiological 7
Worldwide
Frutonile Frutonile. Group: Biochemicals. Alternative Names: 2-Methyldecanenitrile; 2-Cyanodecane. Grades: Highly Purified. CAS No. 69300-15-8. Pack Sizes: 10mg, 25mg, 50mg, 100mg, 250mg. Molecular Formula: C11H21N. US Biological Life Sciences. USBiological 7
Worldwide
Frutonile Frutonile. CAS No. 69300-15-8. VIGON Item # 503220. Categories: Speciality Ingrdients Suppliers, Fragrances, Perfumers, peach nitrile, 2-METHYLDECANONITRILE. Vigon
America & Internationally
Frys Reagent Martensitic 400 series stainless steels. Group: Etchants. Alfa Chemistry Materials 3
FSBA hydrochloride FSBA hydrochloride is a useful reagent for the affinity labeling of adenine nucleotide binding proteins and is mainly applied in the study of purified The labeling and subsequent detection of these proteins can be blocked by including an excess of MgATP, which competes with FSBA for nucleotidebinding sites [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: 5'-p-Fluorosulfonylbenzoyladenosine. CAS No. 78859-42-4. Pack Sizes: 5 mg; 10 mg. Product ID: HY-123650. MedChemExpress MCE
FSB - CAS 891180-93-1 A fluorine analog of the amyloidophilic fluorescent probe BSB that crosses the blood-brain barrier and displays low toxicity. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Fscpx Fscpx. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Lopac-F-7927; HMS3261F15; FSCPX; FSCPX xanthine; 8-Cyclopentyl-N3-[3-(4-(fluorosulfonyl)benzoyloxy)propyl]-N1-propylxanthine. Product Category: Heterocyclic Organic Compound. CAS No. 156547-56-7. Molecular formula: C23H27FN4O6S. Mole weight: 506.55. Purity: 0.96. IUPACName: 3-(8-cyclopentyl-2,6-dioxo-1-propyl-7H-purin-3-yl)propyl 4-fluorosulfonylbenzoate. Product ID: ACM156547567. Alfa Chemistry — ISO 9001:2015 Certified. Categories: FSSPX. Alfa Chemistry. 4
FSCPX FSCPX is a potent and selective irreversible antagonist of A 1 adenosine receptor (A 1 AR) , with low nanomolar potency for binding to the A 1 AR. FSCPX could modify the effect of NBTI, a nucleoside transport inhibitor, by reducing the interstitial adenosine level in the guinea pig atrium [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 156547-56-7. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-116042. MedChemExpress MCE
FSEN1 FSEN1 is a potent and non-competitive FSP1 inhibitor with an IC50 value of 313 nM. FSEN1 triggers iron death in cancer cells by inhibiting FSP1. FSEN1 can be used in research of cancer[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 862808-01-3. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-153629. MedChemExpress MCE
FSG67 FSG67 is a glycerol 3-phosphate acyltransferase (GPAT) inhibitor with an IC50 of 24 ?M[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1158383-34-6. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-112489. MedChemExpress MCE
FSK hydrochloride FSK hydrochloride is fluorosulfonyloxybenzoyl-l-lysine, with a long and flexible aryl fluorosulfate-containing side chain that can reach protein sites that are difficult to reach by covalent linkage. FSK hydrochloride is a modified nanomolecule that targets the epidermal growth factor receptor (EGFR), creating a covalent binding that results in irreversible binding. FSK hydrochloride captures unknown enzyme-substrate interactions in living cells through genetically encoded chemical cross-linking, targeting residues beyond Cys, and cross-linking at the binding periphery. FSK hydrochloride enables the construction of bioreactive SuFEx systems for creating covalent bonds in different proteins in vitro and in vivo [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 3033987-42-4. Pack Sizes: 5 mg; 10 mg; 25 mg. Product ID: HY-48999A. MedChemExpress MCE
FSL-1 FSL 1 is a TLR2/6 peptide agonist (also a putative TLR10 ligand) that activates NF-κB. FSL 1 induces the expression of some pro-inflammatory cytokines such as IL-8, IL-1β, CCL20 and TNF-α in vitro. Synonyms: FSL 1; FSL1; L-Phenylalanine, S-[2,3-bis[(1-oxohexadecyl)oxy]propyl]-L-cysteinylglycyl-L-α-aspartyl-L-prolyl-L-lysyl-L-histidyl-L-prolyl-L-lysyl-L-seryl-; S-[2,3-Bis[(1-oxohexadecyl)oxy]propyl]-L-cysteinylglycyl-L-α-aspartyl-L-prolyl-L-lysyl-L-histidyl-L-prolyl-L-lysyl-L-seryl-L-phenylalanine; FSL-1 lipoprotein, synthetic; Fibroblast-stimulating lipopeptide-1; Pam2-Cys-Gly-Asp-Pro-Lys-His-Pro-Lys-Ser-Phe-OH. Grade: ≥95%. CAS No. 322455-70-9. Molecular formula: C84H140N14O18S. Mole weight: 1666.16. BOC Sciences
FSL-1 ?80% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
FSL-1-FLAG Lipopeptide FSL-1, synthesized on the basis of the N-terminal structure of M. salivarium lipoprotein, can induce ICAM-1 expression on the surface of human gingival fibroblasts. In addition, it induces the production of monocyte chemoattractant protein 1, interleukin-6 (IL-6), and IL-8. It activates macrophages to produce tumor necrosis factor-alpha. Synonyms: Fibroblast Stimulating Lipopeptide 1 FLAG-tag; H-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Gly-Asp-Pro-Lys-His-Pro-Lys-Ser-Phe-Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys-OH; L-Lysine, S-[2,3-bis[(1-oxohexadecyl)oxy]propyl]-L-cysteinylglycyl-L-α-aspartyl-L-prolyl-L-lysyl-L-histidyl-L-prolyl-L-lysyl-L-seryl-L-phenylalanyl-L-α-aspartyl-L-tyrosyl-L-lysyl-L-α-aspartyl-L-α-aspartyl-L-α-aspartyl-L-α-aspartyl-. Grade: ≥95%. CAS No. 2243206-97-3. Molecular formula: C125H198N24O37S. Mole weight: 2661.15. BOC Sciences 10
FSL-1 TFA salt FSL-1 is a TLR2/6 peptide agonist (also a putative TLR10 ligand) that activates NF-κB. FSL-1 induces the expression of some pro-inflammatory cytokines such as IL-8, IL-1β, CCL20 and TNF-α in vitro. Synonyms: FSL 1 TFA salt; FSL1 TFA salt; L-Phenylalanine, S-[2,3-bis[(1-oxohexadecyl)oxy]propyl]-L-cysteinylglycyl-L-α-aspartyl-L-prolyl-L-lysyl-L-histidyl-L-prolyl-L-lysyl-L-seryl-, 2,2,2-trifluoroacetic acid; S-[2,3-Bis[(1-oxohexadecyl)oxy]propyl]-L-cysteinylglycyl-L-α-aspartyl-L-prolyl-L-lysyl-L-histidyl-L-prolyl-L-lysyl-L-seryl-L-phenylalanine 2,2,2-trifluoroacetic acid; FSL-1 lipoprotein, synthetic TFA salt; Fibroblast-stimulating lipopeptide-1 TFA salt; Pam2-Cys-Gly-Asp-Pro-Lys-His-Pro-Lys-Ser-Phe-OH TFA. Grade: ≥95%. Molecular formula: C86H141F3N14O20S. Mole weight: 1780.18. BOC Sciences 8
FSLLRY-NH2 FSLLRY-NH2 is a selective PAR2 peptide antagonist. It reverses taxol-induced mechanical allodynia, heat hyperalgesia and PKC activation in ICR mice, also suppresses ERK activation and collagen production in isolated cardiac fibroblasts. Synonyms: [Phe1,Ser2,Tyr6]-PAR-1 (1-6) amide (human). CAS No. 245329-02-6. Molecular formula: C39H60N10O8. Mole weight: 796.97. BOC Sciences
FSLLRY-NH2 FSLLRY-NH2 is a protease-activated receptor 2 (PAR2) inhibitor[1]. Uses: Scientific research. Group: Peptides. CAS No. 245329-02-6. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg. Product ID: HY-P1260. MedChemExpress MCE
FSLLRY-NH2 FSLLRY-NH2. Group: Biochemicals. Grades: Purified. CAS No. 245329-02-6. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 5
Worldwide
FSLLRY-NH2 TFA FSLLRY-NH2 TFA is a selective PAR2 peptide antagonist. It reverses taxol-induced mechanical allodynia, heat hyperalgesia and PKC activation in ICR mice, and also suppresses ERK activation and collagen production in isolated cardiac fibroblasts. Synonyms: H-Phe-Ser-Leu-Leu-Arg-Tyr-NH2.TFA; L-phenylalanyl-L-seryl-L-leucyl-L-leucyl-L-arginyl-L-tyrosinamide trifluoroacetic acid. Grade: ≥95%. Molecular formula: C41H61F3N10O10. Mole weight: 910.99. BOC Sciences
FSLLRY-NH2 trifluoroacetate salt ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
FSL-Tyr1 ?90% (TLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
FSP-1 Anticoagulant: irreversible inhibitor of serine proteinase a-thrombine. Fluorocontaining phosphonate, identifies an inflammatory subpopulation of macrophages in the liver. Grade: 99% (NMR). Molecular formula: C17H24F6NO5PS. Mole weight: 499.40. BOC Sciences 2
FSP-2 Anticoagulant: irreversible inhibitor of serine proteinase a-thrombine. Fluorocontaining phosphonate, synthetised. Grade: 99% (NMR). Molecular formula: C19H28F6NO5PS. Mole weight: 527.46. BOC Sciences 2
FSP-3 Anticoagulant: irreversible inhibits serine proteinase a-thrombine. Fluorocontaining phosphonate, synthetised. Grade: 99% (NMR). Molecular formula: C19H28F6NO5PS. Mole weight: 527.46. BOC Sciences 2
Fsp4H I One unit of the enzyme is the amount required to hydrolyze 1 μg of Lambda DNA in 1 hour at 37°C in a total reaction volume of 50 μl. Applications: After 5-fold overdigestion with enzyme about 5% of the dna fragments can be ligated and recut. Group: Restriction Enzymes. Purity: 200U; 1000U. GC↑NGC CGN↓CG. Activity: 3000-5000u.a./ml. Appearance: 10 X SE-buffer Y. Storage: -20°C. Form: Liquid. Source: An E.coli strain that carries the cloned Fsp4H I gene from Flavobacterium species 4H. Pack: 10 mM Tris-HCl (pH 7.5); 100 mM NaCl; 0.1 mM EDTA; 200ug/ml BSA; 1mM DTT; 50% glycerol. Cat No: ET-1114RE. Creative Enzymes
FT001 FT001 is a potent, selective and orally effective BET Bromodomain inhibitor with antitumor activity. FT001 inhibits MYC expression with an IC50 of 0.46 μM. FT001 has an effective anti-proliferation effect on MV-4-11, showing obvious MYC mRNA inhibition both in vitro and in vivo. Synonyms: (S)-1-(4-(cyclopropanecarbonyl)-6-(4-(1,1-dioxidothiomorpholino)phenyl)-2-methyl-3,4-dihydroquinoxalin-1(2H)-yl)ethan-1-one; Ethanone, 1-[(2S)-4-(cyclopropylcarbonyl)-6-[4-(1,1-dioxido-4-thiomorpholinyl)phenyl]-3,4-dihydro-2-methyl-1(2H)-quinoxalinyl]-; FT001; FT-001; 1-[(2S)-4-(Cyclopropylcarbonyl)-6-[4-(1,1-dioxido-4-thiomorpholinyl)phenyl]-3,4-dihydro-2-methyl-1(2H)-quinoxalinyl]ethanone. Grade: ≥95%. CAS No. 1778655-51-8. Molecular formula: C25H29N3O4S. Mole weight: 467.58. BOC Sciences 8
FT011 FT011 is an anti-fibrotic agent, reduces mRNA expression of collagens I and III and inhibits collagen synthesis[1]. FT011 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Group: Signaling pathways. Alternative Names: Asengeprast. CAS No. 1001288-58-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-100495. MedChemExpress MCE
FT113 FT113 is a potent and orally active fatty acid synthase (FASN) inhibitor, with an IC 50 of 213 nM for full-length recombinant human FASN enzyme. In cell-based assay, FT113 blocks FASN activity in BT474 cells (IC 50 , 90 nM). FT113 shows anti-proliferative activity, and exhibits anti-cancer activity both in vitro and in vivo [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1630808-89-7. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-111551. MedChemExpress MCE
FT113 FT113 is a potent inhibitor of fatty acid synthase (FAS/FASN) with IC50 of 213 nM. Synonyms: FT-113; FT113. CAS No. 1630808-89-7. Molecular formula: C22H20FN3O4. Mole weight: 409.41. BOC Sciences 8
FT-1518 FT-1518 is a new generation selective, potent and oral bioavailable inhibitor of mTORC1 and mTORC2, and it shows antitumor activity. Synonyms: FT1518; NSC-802820. CAS No. 1313026-58-2. Molecular formula: C20H26N8O. Mole weight: 394.48. BOC Sciences 8
FT206 FT206 is a carboxamide ubiquitin-specific protrase inhibitor. (Extracted from patent WO 2020033707 A1, example 11-1). Synonyms: NSC833745; Thieno[2,3-b]pyridine-2-carboxamide, 3-amino-N-[(2S)-6-(3,8-diazabicyclo[3.2.1]oct-3-yl)-1,2,3,4-tetrahydro-2-naphthalenyl]-6-methyl-; 3-Amino-N-[(2S)-6-(3,8-diazabicyclo[3.2.1]oct-3-yl)-1,2,3,4-tetrahydro-2-naphthalenyl]-6-methylthieno[2,3-b]pyridine-2-carboxamide. Grade: ≥98%. CAS No. 2278274-34-1. Molecular formula: C25H29N5OS. Mole weight: 447.60. BOC Sciences 8
FT3967385 FT3967385 is an inhibitor of USP30 that recapitulates genetic loss of USP30 and sets the trigger for PINK1-PARKIN amplification of mitochondrial ubiquitylation. Synonyms: FT385; (R)-N-(1-cyanopyrrolidin-3-yl)-3-(2-phenoxyphenyl)-1H-pyrazole-5-carboxamide. Grade: ≥95%. Molecular formula: C21H19N5O2. Mole weight: 373.41. BOC Sciences 8
FT671 FT671 is a potent and selective USP7 inhibitor with high affinity and specificity in vitro and in cells. FT671 destabilises USP7 substrates including MDM2, elevates p53 and results in transcription of p53 target genes, induction of the tumour suppressor p21, and tumour growth inhibition in mice. Synonyms: FT-671; FT 671; (S)-5-((1-(4,4-difluoro-3-(3-fluoro-1H-pyrazol-1-yl)butanoyl)-4-hydroxypiperidin-4-yl)methyl)-1-(4-fluorophenyl)-1,5-dihydro-4H-pyrazolo[3,4-d]pyrimidin-4-one. Grade: >98%. CAS No. 1959551-26-8. Molecular formula: C24H23F4N7O3. Mole weight: 533.48. BOC Sciences 8
FT709 FT709 is a potent and selective USP9X inhibitor, an IC50 of 82 nM. USP9X has been linked with centrosome function, chromosome alignment during mitosis, EGF receptor degradation, chemo-sensitization, and circadian rhythms[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2413991-74-7. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-145967. MedChemExpress MCE
FT895 FT895 is a potent and selective HDAC11 inhibitor with an IC50 of 3 nM[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2225728-57-2. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-112285. MedChemExpress MCE
FT895 FT895 is a potent and selective inhibitor of HDAC11 with an IC50 of 3 nM. Synonyms: 1H-Isoindole-4-carboxamide, 2,3-dihydro-N-hydroxy-1,1-dimethyl-2-[5-(trifluoromethyl)-2-pyrazinyl]-; N-Hydroxy-1,1-dimethyl-2-[5-(trifluoromethyl)-2-pyrazinyl]-4-isoindolinecarboxamide; 2,3-Dihydro-N-hydroxy-1,1-dimethyl-2-[5-(trifluoromethyl)-2-pyrazinyl]-1H-isoindole-4-carboxamide; HDTK 070; FT-895; FT 895. Grade: ≥95%. CAS No. 2225728-57-2. Molecular formula: C16H15F3N4O2. Mole weight: 352.31. BOC Sciences 8
FTase Inhibitor I FTase inhibitor I is a potent and selective farnesyltransferase (FTase) inhibitor with an IC50 of 21 nM, which is 30-fold higher for FTase over geranylgeranyl transferase (GGTase; IC50 = 790 nM). Synonyms: Farnesyltransferase Inhibitor I; B581; N-[(2S)-2-[[(2R)-2-amino-3-mercaptopropyl]amino]-3-methylbutyl]-L-phenylalanyl-L-methionine. Grade: ≥95%. CAS No. 149759-96-6. Molecular formula: C22H38N4O3S2. Mole weight: 470.69. BOC Sciences
FTase Inhibitor II FTase Inhibitor II is a cell-permeable analog of farnesyl pyrophosphate (FPP) that potently inhibits FTase with an IC50 of 50-75 nM, and it does not inhibit geranylgeranyl transferase at similar concentrations (IC50 > 100 μM). FTase Inhibitor II is a possible cancer therapeutic agent. Synonyms: Farnesyltransferase Inhibitor II; FTI-II; N-[4-[[(2R)-2-amino-3-mercapto-1-oxopropyl]amino]benzoyl]-L-methionine. Grade: ≥80%. CAS No. 156707-43-6. Molecular formula: C15H21N3O4S2. Mole weight: 371.47. BOC Sciences
Ftaxilide Ftaxilide is an antituberculosis agent used as antiseptic. Synonyms: 2-[(2,6-dimethylphenyl)carbamoyl]benzoic acidFtaxilide2',6'-Dimethylphthalanilic acidHistanorm19368-18-4Ftaxilide [INN:DCF]Ftaxilidum [INN-Latin]Ftaxilida [INN-Spanish]Phthalic 2,6-dimethylanilideUNII-7Z71845H3FMP-12-PMP 12; NSC 16112; MP12; NSC16112; MP-12; NSC-16112Phthalanil. CAS No. 19368-18-4. Molecular formula: C16H15NO3. Mole weight: 269.295. BOC Sciences 8
FTBMT FTBMT is a novel and selective GPR52 agonist (EC50 = 75 nM, Emax = 122%). FTBMT displays antipsychotic and procognitive properties without causing catalepsy in rodents. Synonyms: 4-[3-[[3-Fluoro-5-(trifluoromethyl)phenyl]methyl]-5-methyl-1H-1,2,4-triazol-1-yl]-2-methylbenzamide. Grade: ≥98% by HPLC. CAS No. 1358575-02-6. Molecular formula: C19H16F4N4O. Mole weight: 392.35. BOC Sciences 8
FTBMT ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
FTI-2148 FTI-2148 is a potent farnesyltransferase inhibitor with potential antitumor activity. Synonyms: FTI 2148; FTI2148; (S)-2-(5-((((1H-Imidazol-5-yl)methyl)amino)methyl)-2'-methyl-[1,1'-biphenyl]-2-ylcarboxamido)-4-(methylthio)butanoic acid. Grade: 98%. CAS No. 251577-09-0. Molecular formula: C24H28N4O3S. Mole weight: 452.57. BOC Sciences 8
FTI-2153 FTI-2153 is a potent farnesyltransferase inhibitor. FTI-2153 inhibits bipolar spindle formation during mitosis independently of transformation and Ras and p53 mutation status. FTI-2153 was reported to block bipolar spindle formation and chromosome alignment and causes prometaphase accumulation during mitosis of human lung cancer cells. Synonyms: FTI 2153; FTI2153; (S)-2-[(5-{[(1H-Imidazol-4-ylmethyl)-amino]-methyl}-2''-methyl-biphenyl-2-carbonyl)-amino]-4-methylsulfanyl-butyric acid methyl ester. CAS No. 344900-92-1. Molecular formula: C25H30N4O3S. Mole weight: 466.6. BOC Sciences 8
FTI-249 FTI-249 is a Farnesyltransferase inhibitor, which potently inhibited FTase (IC50 = 100-200 nM). Synonyms: FTI 249; FTI249; (S)-2-(4-(((R)-2-amino-3-mercaptopropyl)amino)benzamido)-4-(methylthio)butanoic acid. Grade: 98%. CAS No. 161721-65-9. Molecular formula: C15H23N3O3S2. Mole weight: 357.49. BOC Sciences 8
FTI 276 FTI 276. Group: Biochemicals. Grades: Purified. CAS No. 1217471-51-6. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 5
Worldwide
FTI-276 FTI-276 is a potent and selective farnesyltransferase inhibitor, which is also a tetrapeptide mimetic of the carboxyl terminus of K-Ras4B. FTI-276 blocked the growth in nude mice of a human lung carcinoma that expresses the two most prevalent genetic alterations in human cancers (K-Ras oncogenic mutation and deletion in the tumor suppressor gene p53). In contrast, FTI-276 did not inhibit tumor growth of a human lung carcinoma that harbors no Ras mutations. Furthermore, FTI-276 inhibited oncogenic signaling and tumor growth of NIH 3T3 cells transformed with the ras but not the raf oncogene. Synonyms: FTI276; FTI 276; (S)-2-(5-(((R)-2-amino-3-mercaptopropyl)amino)-[1,1'-biphenyl]-2-ylcarboxamido)-4-(methylthio)butanoic acid. CAS No. 170006-72-1. Molecular formula: C21H27N3O3S2. Mole weight: 433.59. BOC Sciences 8
FTI 276 trifluoroacetate salt FTI 276 is a Ras CAAX peptidomimetic, a selective inhibitor of farnesyltransferase (FTase) with > 100-fold selectivity over geranylgeranyltransferase I (GGTase I) (IC50 = 0.5 and 50 nM, respectively). It exhibits an inhibitory effect on growth of human lung carcinoma expressing oncogenic K-Ras in nude mice. Synonyms: FTI 276 trifluoroacetate salt; FTI276 trifluoroacetate salt; FTI-276 trifluoroacetate salt; N-[4-[2(R)-Amino-3-mercaptopropyl]amino-2-phenylbenzoyl]methionine trifluoroacetate salt. Grade: ≥95% by HPLC. CAS No. 1217471-51-6. Molecular formula: C21H27N3O3S2.C2HF3O2. Mole weight: 547.61. BOC Sciences 8
FTI-276 trifluoroacetate salt ?95% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
FTI 277 FTI 277. Group: Biochemicals. Grades: Purified. CAS No. 1217447-06-7. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 5
Worldwide
FTI-277 FTI-277, a peptide mimetic of the COOH-terminal Cys-Val-Ile-Met of K-Ras4B that inhibited potently FTase in vitro (IC50 = 500 pM) and was highly selective for FTase over geranylgeranyltransferase I (GGTase I) (IC50 = 50 nM). FTI-277, the methyl ester derivative of FTI-276, was extremely potent (IC50 = 100 nM) at inhibiting H-Ras, but not the geranylgeranylated Rap1A processing in whole cells. Treatment of H-Ras oncogene-transformed NIH 3T3 cells with FTI-277 blocked recruitment to the plasma membrane and subsequent activation of the serine/threonine kinase c-Raf-1 in cells transformed by farnesylated Ras (H-RasF), but not geranylgeranylated, Ras (H-RasGG). FTI-277 induced accumulation of cytoplasmic non-farnesylated H-Ras that was able to bind Raf and form cytoplasmic Ras/Raf complexes in which Raf kinase was not activated. Furthermore, FTI-277 blocked constitutive activation of mitogen-activated protein kinase (MAPK) in H-RasF, but not H-RasGG, or Raf-transformed cells. FTI-277 also inhibited oncogenic K-Ras4B processing and constitutive activation of MAPK, but the concentrations required were 100-fold higher than those needed for H-Ras inhibition. The results demonstrate that FTI-277 blocks Ras oncogenic signaling by accumulating inactive Ras/Raf complexes in the cytoplasm, hence preventing constitutive activation of the MAPK cascade. Uses: Radiation-sensitizing agents. Synonyms: FTI-277; FTI 277; FTI277. CAS No. 170006-73-2. M BOC Sciences 8
FTI 277 HCl FTI-277 inhibits Ras processing with an IC50 of 100 nM, but not the geranylgeranylated Rap1A processing in whole cells. Synonyms: FTI277 HCl; FTI 277 HCl; FTI-277 HCl. Grade: >98%. CAS No. 180977-34-8. Molecular formula: C22H30ClN3O3S2. Mole weight: 484.07. BOC Sciences 8
FTI-277 hydrochloride FTI-277 hydrochloride is an inhibitor of farnesyl transferase (FTase); a highly potent Ras CAAX peptidomimetic which antagonizes both H- and K-Ras oncogenic signaling. FTI-277 hydrochloride can inhibit hepatitis delta virus (HDV) infection. Uses: Scientific research. Group: Signaling pathways. CAS No. 180977-34-8. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15872A. MedChemExpress MCE
FTI 277 trifluoroacetate salt FTI 277 is a prodrug form of FTI 276 that inhibits farnesyltransferase (FTase) (IC50 = 0.5 nM) with antiproliferative activity. It potently inhibits H-Ras and K-Ras processing in whole cells (IC50 = 0.1 and 10 μM, respectively) and disrupts constitutive H-Ras-specific activation of MAPK. Synonyms: FTI 277 trifluoroacetate salt; FTI277 trifluoroacetate salt; FTI-277 trifluoroacetate salt; N-[4-[2(R)-Amino-3-mercaptopropyl]amino-2-phenylbenzoyl]methionine methyl ester trifluoroacetate salt. Grade: ≥95% by HPLC. CAS No. 1217447-06-7. Molecular formula: C22H29N3O3S2.C2HF3O2. Mole weight: 561.64. BOC Sciences 8
FTI-277 trifluoroacetate salt ?95% (HPLC), film. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
FTIDC FTIDC. Group: Biochemicals. Grades: Purified. CAS No. 873551-53-2. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 5
Worldwide
FTIDC FTIDC is an orally bioactive mGlu1 receptor negative allosteric modulator (IC50 = 5.8 and 6200 nM for mGlu1 and mGlu5, respectively) and an mGlu1 receptor inverse agonist (IC50 = 7 nM) in the absence of ligand. FTIDC exhibits anxiolytic and antipsychotic effects in vivo. Synonyms: 4-[1-(2-Fluoro-3-pyridinyl)-5-methyl-1H-1,2,3-triazol-4-yl]-3,6-dihydro-N-methyl-N-(1-methylethyl)-1(2H)-pyridinecarboxamide. Grade: ≥98% by HPLC. CAS No. 873551-53-2. Molecular formula: C18H23FN6O. Mole weight: 358.41. BOC Sciences 8
FTO Coated Glass FTO Coated Glass. Group: Ito-coated glass. Alfa Chemistry Materials 3
FTO-IN-1 FTO-IN-1 is a potent FTO inhibitor. Synonyms: UUN44923. CAS No. 2243944-92-3. Molecular formula: C18H16Cl2N4O2. Mole weight: 391.2. BOC Sciences 8
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS It is a derivative of Exendin-4 peptide. Synonyms: Phe-Thr-Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser. Grade: ≥95%. Molecular formula: C164H252N42O53S. Mole weight: 3692.12. BOC Sciences 10
FTTF FTTF. Group: Organic field effect transistor (ofet) materials. Alternative Names: 5,5'-Di(9H-fluoren-2-yl)-2,2'-bithiophene. CAS No. 369599-41-7. Pack Sizes: 250 mg in glass insert. Product ID: 2-(9H-fluoren-2-yl)-5-[5-(9H-fluoren-2-yl)thiophen-2-yl]thiophene. Molecular formula: 494.67. Mole weight: C34H22S2. C1c2ccccc2-c3ccc(cc13)-c4ccc(s4)-c5ccc(s5)-c6ccc-7c(Cc8ccccc-78)c6. BYGHZDSINXXOSM-UHFFFAOYSA-N. 96%. Alfa Chemistry Materials 7
FTTF sublimed grade. Group: Organic field effect transistor (ofet) materials. Alfa Chemistry Analytical Products
FTX-6058 FTX-6058 is a potent and orally active embryonic ectoderm development (EED) inhibitor that induces HbF protein expression in cells and murine models, and can be used in the study of select hemoglobinopathies, including sickle cell disease and β-thalassemia. Synonyms: 7H-Furo(4,3,2-gh)(1,2,4)triazolo(4',3':1,6)pyrido(2,3-c)(5,2)benzoxazonine, 12-fluoro-7a,8,13,14-tetrahydro-4-(2-methyl-3-pyridinyl)-, (7aS)-. Grade: ≥95%. CAS No. 2490676-18-9. Molecular formula: C22H18FN5O2. Mole weight: 403.41. BOC Sciences 8
FTX-6058 hydrochloride FTX-6058 hydrochloride is a potent and orally active embryonic ectoderm development (EED) inhibitor that induces HbF protein expression in cells and murine models, and can be used in the study of select hemoglobinopathies, including sickle cell disease and β-thalassemia. Synonyms: 7H-Furo(4,3,2-gh)(1,2,4)triazolo(4',3':1,6)pyrido(2,3-c)(5,2)benzoxazonine, 12-fluoro-7a,8,13,14-tetrahydro-4-(2-methyl-3-pyridinyl)-, (7aS)-, hydrochloride (1:1). Grade: ≥95%. CAS No. 2490676-19-0. Molecular formula: C22H19ClFN5O2. Mole weight: 439.87. BOC Sciences 8

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products