American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
FSK hydrochloride FSK hydrochloride is fluorosulfonyloxybenzoyl-l-lysine, with a long and flexible aryl fluorosulfate-containing side chain that can reach protein sites that are difficult to reach by covalent linkage. FSK hydrochloride is a modified nanomolecule that targets the epidermal growth factor receptor (EGFR), creating a covalent binding that results in irreversible binding. FSK hydrochloride captures unknown enzyme-substrate interactions in living cells through genetically encoded chemical cross-linking, targeting residues beyond Cys, and cross-linking at the binding periphery. FSK hydrochloride enables the construction of bioreactive SuFEx systems for creating covalent bonds in different proteins in vitro and in vivo [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 3033987-42-4. Pack Sizes: 5 mg; 10 mg; 25 mg. Product ID: HY-48999A. MedChemExpress MCE
FSL-1 FSL 1 is a TLR2/6 peptide agonist (also a putative TLR10 ligand) that activates NF-κB. FSL 1 induces the expression of some pro-inflammatory cytokines such as IL-8, IL-1β, CCL20 and TNF-α in vitro. Synonyms: FSL 1; FSL1; L-Phenylalanine, S-[2,3-bis[(1-oxohexadecyl)oxy]propyl]-L-cysteinylglycyl-L-α-aspartyl-L-prolyl-L-lysyl-L-histidyl-L-prolyl-L-lysyl-L-seryl-; S-[2,3-Bis[(1-oxohexadecyl)oxy]propyl]-L-cysteinylglycyl-L-α-aspartyl-L-prolyl-L-lysyl-L-histidyl-L-prolyl-L-lysyl-L-seryl-L-phenylalanine; FSL-1 lipoprotein, synthetic; Fibroblast-stimulating lipopeptide-1; Pam2-Cys-Gly-Asp-Pro-Lys-His-Pro-Lys-Ser-Phe-OH. Grade: ≥95%. CAS No. 322455-70-9. Molecular formula: C84H140N14O18S. Mole weight: 1666.16. BOC Sciences
FSL-1 ?80% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
FSL-1-FLAG Lipopeptide FSL-1, synthesized on the basis of the N-terminal structure of M. salivarium lipoprotein, can induce ICAM-1 expression on the surface of human gingival fibroblasts. In addition, it induces the production of monocyte chemoattractant protein 1, interleukin-6 (IL-6), and IL-8. It activates macrophages to produce tumor necrosis factor-alpha. Synonyms: Fibroblast Stimulating Lipopeptide 1 FLAG-tag; H-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Gly-Asp-Pro-Lys-His-Pro-Lys-Ser-Phe-Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys-OH; L-Lysine, S-[2,3-bis[(1-oxohexadecyl)oxy]propyl]-L-cysteinylglycyl-L-α-aspartyl-L-prolyl-L-lysyl-L-histidyl-L-prolyl-L-lysyl-L-seryl-L-phenylalanyl-L-α-aspartyl-L-tyrosyl-L-lysyl-L-α-aspartyl-L-α-aspartyl-L-α-aspartyl-L-α-aspartyl-. Grade: ≥95%. CAS No. 2243206-97-3. Molecular formula: C125H198N24O37S. Mole weight: 2661.15. BOC Sciences 10
FSL-1 TFA salt FSL-1 is a TLR2/6 peptide agonist (also a putative TLR10 ligand) that activates NF-κB. FSL-1 induces the expression of some pro-inflammatory cytokines such as IL-8, IL-1β, CCL20 and TNF-α in vitro. Synonyms: FSL 1 TFA salt; FSL1 TFA salt; L-Phenylalanine, S-[2,3-bis[(1-oxohexadecyl)oxy]propyl]-L-cysteinylglycyl-L-α-aspartyl-L-prolyl-L-lysyl-L-histidyl-L-prolyl-L-lysyl-L-seryl-, 2,2,2-trifluoroacetic acid; S-[2,3-Bis[(1-oxohexadecyl)oxy]propyl]-L-cysteinylglycyl-L-α-aspartyl-L-prolyl-L-lysyl-L-histidyl-L-prolyl-L-lysyl-L-seryl-L-phenylalanine 2,2,2-trifluoroacetic acid; FSL-1 lipoprotein, synthetic TFA salt; Fibroblast-stimulating lipopeptide-1 TFA salt; Pam2-Cys-Gly-Asp-Pro-Lys-His-Pro-Lys-Ser-Phe-OH TFA. Grade: ≥95%. Molecular formula: C86H141F3N14O20S. Mole weight: 1780.18. BOC Sciences 8
FSLLRY-NH2 FSLLRY-NH2 is a selective PAR2 peptide antagonist. It reverses taxol-induced mechanical allodynia, heat hyperalgesia and PKC activation in ICR mice, also suppresses ERK activation and collagen production in isolated cardiac fibroblasts. Synonyms: [Phe1,Ser2,Tyr6]-PAR-1 (1-6) amide (human). CAS No. 245329-02-6. Molecular formula: C39H60N10O8. Mole weight: 796.97. BOC Sciences
FSLLRY-NH2 FSLLRY-NH2 is a protease-activated receptor 2 (PAR2) inhibitor[1]. Uses: Scientific research. Group: Peptides. CAS No. 245329-02-6. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg. Product ID: HY-P1260. MedChemExpress MCE
FSLLRY-NH2 FSLLRY-NH2. Group: Biochemicals. Grades: Purified. CAS No. 245329-02-6. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 5
Worldwide
FSLLRY-NH2 TFA FSLLRY-NH2 TFA is a selective PAR2 peptide antagonist. It reverses taxol-induced mechanical allodynia, heat hyperalgesia and PKC activation in ICR mice, and also suppresses ERK activation and collagen production in isolated cardiac fibroblasts. Synonyms: H-Phe-Ser-Leu-Leu-Arg-Tyr-NH2.TFA; L-phenylalanyl-L-seryl-L-leucyl-L-leucyl-L-arginyl-L-tyrosinamide trifluoroacetic acid. Grade: ≥95%. Molecular formula: C41H61F3N10O10. Mole weight: 910.99. BOC Sciences
FSLLRY-NH2 trifluoroacetate salt ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
FSL-Tyr1 ?90% (TLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
FSP-1 Anticoagulant: irreversible inhibitor of serine proteinase a-thrombine. Fluorocontaining phosphonate, identifies an inflammatory subpopulation of macrophages in the liver. Grade: 99% (NMR). Molecular formula: C17H24F6NO5PS. Mole weight: 499.40. BOC Sciences 2
FSP-2 Anticoagulant: irreversible inhibitor of serine proteinase a-thrombine. Fluorocontaining phosphonate, synthetised. Grade: 99% (NMR). Molecular formula: C19H28F6NO5PS. Mole weight: 527.46. BOC Sciences 2
FSP-3 Anticoagulant: irreversible inhibits serine proteinase a-thrombine. Fluorocontaining phosphonate, synthetised. Grade: 99% (NMR). Molecular formula: C19H28F6NO5PS. Mole weight: 527.46. BOC Sciences 2
Fsp4H I One unit of the enzyme is the amount required to hydrolyze 1 μg of Lambda DNA in 1 hour at 37°C in a total reaction volume of 50 μl. Applications: After 5-fold overdigestion with enzyme about 5% of the dna fragments can be ligated and recut. Group: Restriction Enzymes. Purity: 200U; 1000U. GC↑NGC CGN↓CG. Activity: 3000-5000u.a./ml. Appearance: 10 X SE-buffer Y. Storage: -20°C. Form: Liquid. Source: An E.coli strain that carries the cloned Fsp4H I gene from Flavobacterium species 4H. Pack: 10 mM Tris-HCl (pH 7.5); 100 mM NaCl; 0.1 mM EDTA; 200ug/ml BSA; 1mM DTT; 50% glycerol. Cat No: ET-1114RE. Creative Enzymes
FT001 FT001 is a potent, selective and orally effective BET Bromodomain inhibitor with antitumor activity. FT001 inhibits MYC expression with an IC50 of 0.46 μM. FT001 has an effective anti-proliferation effect on MV-4-11, showing obvious MYC mRNA inhibition both in vitro and in vivo. Synonyms: (S)-1-(4-(cyclopropanecarbonyl)-6-(4-(1,1-dioxidothiomorpholino)phenyl)-2-methyl-3,4-dihydroquinoxalin-1(2H)-yl)ethan-1-one; Ethanone, 1-[(2S)-4-(cyclopropylcarbonyl)-6-[4-(1,1-dioxido-4-thiomorpholinyl)phenyl]-3,4-dihydro-2-methyl-1(2H)-quinoxalinyl]-; FT001; FT-001; 1-[(2S)-4-(Cyclopropylcarbonyl)-6-[4-(1,1-dioxido-4-thiomorpholinyl)phenyl]-3,4-dihydro-2-methyl-1(2H)-quinoxalinyl]ethanone. Grade: ≥95%. CAS No. 1778655-51-8. Molecular formula: C25H29N3O4S. Mole weight: 467.58. BOC Sciences 8
FT011 FT011 is an anti-fibrotic agent, reduces mRNA expression of collagens I and III and inhibits collagen synthesis[1]. FT011 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Group: Signaling pathways. Alternative Names: Asengeprast. CAS No. 1001288-58-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-100495. MedChemExpress MCE
FT113 FT113 is a potent inhibitor of fatty acid synthase (FAS/FASN) with IC50 of 213 nM. Synonyms: FT-113; FT113. CAS No. 1630808-89-7. Molecular formula: C22H20FN3O4. Mole weight: 409.41. BOC Sciences 8
FT113 FT113 is a potent and orally active fatty acid synthase (FASN) inhibitor, with an IC 50 of 213 nM for full-length recombinant human FASN enzyme. In cell-based assay, FT113 blocks FASN activity in BT474 cells (IC 50 , 90 nM). FT113 shows anti-proliferative activity, and exhibits anti-cancer activity both in vitro and in vivo [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1630808-89-7. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-111551. MedChemExpress MCE
FT-1518 FT-1518 is a new generation selective, potent and oral bioavailable inhibitor of mTORC1 and mTORC2, and it shows antitumor activity. Synonyms: FT1518; NSC-802820. CAS No. 1313026-58-2. Molecular formula: C20H26N8O. Mole weight: 394.48. BOC Sciences 8
FT206 FT206 is a carboxamide ubiquitin-specific protrase inhibitor. (Extracted from patent WO 2020033707 A1, example 11-1). Synonyms: NSC833745; Thieno[2,3-b]pyridine-2-carboxamide, 3-amino-N-[(2S)-6-(3,8-diazabicyclo[3.2.1]oct-3-yl)-1,2,3,4-tetrahydro-2-naphthalenyl]-6-methyl-; 3-Amino-N-[(2S)-6-(3,8-diazabicyclo[3.2.1]oct-3-yl)-1,2,3,4-tetrahydro-2-naphthalenyl]-6-methylthieno[2,3-b]pyridine-2-carboxamide. Grade: ≥98%. CAS No. 2278274-34-1. Molecular formula: C25H29N5OS. Mole weight: 447.60. BOC Sciences 8
FT3967385 FT3967385 is an inhibitor of USP30 that recapitulates genetic loss of USP30 and sets the trigger for PINK1-PARKIN amplification of mitochondrial ubiquitylation. Synonyms: FT385; (R)-N-(1-cyanopyrrolidin-3-yl)-3-(2-phenoxyphenyl)-1H-pyrazole-5-carboxamide. Grade: ≥95%. Molecular formula: C21H19N5O2. Mole weight: 373.41. BOC Sciences 8
FT671 FT671 is a potent and selective USP7 inhibitor with high affinity and specificity in vitro and in cells. FT671 destabilises USP7 substrates including MDM2, elevates p53 and results in transcription of p53 target genes, induction of the tumour suppressor p21, and tumour growth inhibition in mice. Synonyms: FT-671; FT 671; (S)-5-((1-(4,4-difluoro-3-(3-fluoro-1H-pyrazol-1-yl)butanoyl)-4-hydroxypiperidin-4-yl)methyl)-1-(4-fluorophenyl)-1,5-dihydro-4H-pyrazolo[3,4-d]pyrimidin-4-one. Grade: >98%. CAS No. 1959551-26-8. Molecular formula: C24H23F4N7O3. Mole weight: 533.48. BOC Sciences 8
FT709 FT709 is a potent and selective USP9X inhibitor, an IC50 of 82 nM. USP9X has been linked with centrosome function, chromosome alignment during mitosis, EGF receptor degradation, chemo-sensitization, and circadian rhythms[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2413991-74-7. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-145967. MedChemExpress MCE
FT895 FT895 is a potent and selective HDAC11 inhibitor with an IC50 of 3 nM[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2225728-57-2. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-112285. MedChemExpress MCE
FT895 FT895 is a potent and selective inhibitor of HDAC11 with an IC50 of 3 nM. Synonyms: 1H-Isoindole-4-carboxamide, 2,3-dihydro-N-hydroxy-1,1-dimethyl-2-[5-(trifluoromethyl)-2-pyrazinyl]-; N-Hydroxy-1,1-dimethyl-2-[5-(trifluoromethyl)-2-pyrazinyl]-4-isoindolinecarboxamide; 2,3-Dihydro-N-hydroxy-1,1-dimethyl-2-[5-(trifluoromethyl)-2-pyrazinyl]-1H-isoindole-4-carboxamide; HDTK 070; FT-895; FT 895. Grade: ≥95%. CAS No. 2225728-57-2. Molecular formula: C16H15F3N4O2. Mole weight: 352.31. BOC Sciences 8
FTase Inhibitor I FTase inhibitor I is a potent and selective farnesyltransferase (FTase) inhibitor with an IC50 of 21 nM, which is 30-fold higher for FTase over geranylgeranyl transferase (GGTase; IC50 = 790 nM). Synonyms: Farnesyltransferase Inhibitor I; B581; N-[(2S)-2-[[(2R)-2-amino-3-mercaptopropyl]amino]-3-methylbutyl]-L-phenylalanyl-L-methionine. Grade: ≥95%. CAS No. 149759-96-6. Molecular formula: C22H38N4O3S2. Mole weight: 470.69. BOC Sciences
FTase Inhibitor II FTase Inhibitor II is a cell-permeable analog of farnesyl pyrophosphate (FPP) that potently inhibits FTase with an IC50 of 50-75 nM, and it does not inhibit geranylgeranyl transferase at similar concentrations (IC50 > 100 μM). FTase Inhibitor II is a possible cancer therapeutic agent. Synonyms: Farnesyltransferase Inhibitor II; FTI-II; N-[4-[[(2R)-2-amino-3-mercapto-1-oxopropyl]amino]benzoyl]-L-methionine. Grade: ≥80%. CAS No. 156707-43-6. Molecular formula: C15H21N3O4S2. Mole weight: 371.47. BOC Sciences
Ftaxilide Ftaxilide is an antituberculosis agent used as antiseptic. Synonyms: 2-[(2,6-dimethylphenyl)carbamoyl]benzoic acidFtaxilide2',6'-Dimethylphthalanilic acidHistanorm19368-18-4Ftaxilide [INN:DCF]Ftaxilidum [INN-Latin]Ftaxilida [INN-Spanish]Phthalic 2,6-dimethylanilideUNII-7Z71845H3FMP-12-PMP 12; NSC 16112; MP12; NSC16112; MP-12; NSC-16112Phthalanil. CAS No. 19368-18-4. Molecular formula: C16H15NO3. Mole weight: 269.295. BOC Sciences 8
FTBMT FTBMT is a novel and selective GPR52 agonist (EC50 = 75 nM, Emax = 122%). FTBMT displays antipsychotic and procognitive properties without causing catalepsy in rodents. Synonyms: 4-[3-[[3-Fluoro-5-(trifluoromethyl)phenyl]methyl]-5-methyl-1H-1,2,4-triazol-1-yl]-2-methylbenzamide. Grade: ≥98% by HPLC. CAS No. 1358575-02-6. Molecular formula: C19H16F4N4O. Mole weight: 392.35. BOC Sciences 8
FTBMT ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
FTI-2148 FTI-2148 is a potent farnesyltransferase inhibitor with potential antitumor activity. Synonyms: FTI 2148; FTI2148; (S)-2-(5-((((1H-Imidazol-5-yl)methyl)amino)methyl)-2'-methyl-[1,1'-biphenyl]-2-ylcarboxamido)-4-(methylthio)butanoic acid. Grade: 98%. CAS No. 251577-09-0. Molecular formula: C24H28N4O3S. Mole weight: 452.57. BOC Sciences 8
FTI-2153 FTI-2153 is a potent farnesyltransferase inhibitor. FTI-2153 inhibits bipolar spindle formation during mitosis independently of transformation and Ras and p53 mutation status. FTI-2153 was reported to block bipolar spindle formation and chromosome alignment and causes prometaphase accumulation during mitosis of human lung cancer cells. Synonyms: FTI 2153; FTI2153; (S)-2-[(5-{[(1H-Imidazol-4-ylmethyl)-amino]-methyl}-2''-methyl-biphenyl-2-carbonyl)-amino]-4-methylsulfanyl-butyric acid methyl ester. CAS No. 344900-92-1. Molecular formula: C25H30N4O3S. Mole weight: 466.6. BOC Sciences 8
FTI-249 FTI-249 is a Farnesyltransferase inhibitor, which potently inhibited FTase (IC50 = 100-200 nM). Synonyms: FTI 249; FTI249; (S)-2-(4-(((R)-2-amino-3-mercaptopropyl)amino)benzamido)-4-(methylthio)butanoic acid. Grade: 98%. CAS No. 161721-65-9. Molecular formula: C15H23N3O3S2. Mole weight: 357.49. BOC Sciences 8
FTI 276 FTI 276. Group: Biochemicals. Grades: Purified. CAS No. 1217471-51-6. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 5
Worldwide
FTI-276 FTI-276 is a potent and selective farnesyltransferase inhibitor, which is also a tetrapeptide mimetic of the carboxyl terminus of K-Ras4B. FTI-276 blocked the growth in nude mice of a human lung carcinoma that expresses the two most prevalent genetic alterations in human cancers (K-Ras oncogenic mutation and deletion in the tumor suppressor gene p53). In contrast, FTI-276 did not inhibit tumor growth of a human lung carcinoma that harbors no Ras mutations. Furthermore, FTI-276 inhibited oncogenic signaling and tumor growth of NIH 3T3 cells transformed with the ras but not the raf oncogene. Synonyms: FTI276; FTI 276; (S)-2-(5-(((R)-2-amino-3-mercaptopropyl)amino)-[1,1'-biphenyl]-2-ylcarboxamido)-4-(methylthio)butanoic acid. CAS No. 170006-72-1. Molecular formula: C21H27N3O3S2. Mole weight: 433.59. BOC Sciences 8
FTI 276 trifluoroacetate salt FTI 276 is a Ras CAAX peptidomimetic, a selective inhibitor of farnesyltransferase (FTase) with > 100-fold selectivity over geranylgeranyltransferase I (GGTase I) (IC50 = 0.5 and 50 nM, respectively). It exhibits an inhibitory effect on growth of human lung carcinoma expressing oncogenic K-Ras in nude mice. Synonyms: FTI 276 trifluoroacetate salt; FTI276 trifluoroacetate salt; FTI-276 trifluoroacetate salt; N-[4-[2(R)-Amino-3-mercaptopropyl]amino-2-phenylbenzoyl]methionine trifluoroacetate salt. Grade: ≥95% by HPLC. CAS No. 1217471-51-6. Molecular formula: C21H27N3O3S2.C2HF3O2. Mole weight: 547.61. BOC Sciences 8
FTI-276 trifluoroacetate salt ?95% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
FTI 277 FTI 277. Group: Biochemicals. Grades: Purified. CAS No. 1217447-06-7. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 5
Worldwide
FTI-277 FTI-277, a peptide mimetic of the COOH-terminal Cys-Val-Ile-Met of K-Ras4B that inhibited potently FTase in vitro (IC50 = 500 pM) and was highly selective for FTase over geranylgeranyltransferase I (GGTase I) (IC50 = 50 nM). FTI-277, the methyl ester derivative of FTI-276, was extremely potent (IC50 = 100 nM) at inhibiting H-Ras, but not the geranylgeranylated Rap1A processing in whole cells. Treatment of H-Ras oncogene-transformed NIH 3T3 cells with FTI-277 blocked recruitment to the plasma membrane and subsequent activation of the serine/threonine kinase c-Raf-1 in cells transformed by farnesylated Ras (H-RasF), but not geranylgeranylated, Ras (H-RasGG). FTI-277 induced accumulation of cytoplasmic non-farnesylated H-Ras that was able to bind Raf and form cytoplasmic Ras/Raf complexes in which Raf kinase was not activated. Furthermore, FTI-277 blocked constitutive activation of mitogen-activated protein kinase (MAPK) in H-RasF, but not H-RasGG, or Raf-transformed cells. FTI-277 also inhibited oncogenic K-Ras4B processing and constitutive activation of MAPK, but the concentrations required were 100-fold higher than those needed for H-Ras inhibition. The results demonstrate that FTI-277 blocks Ras oncogenic signaling by accumulating inactive Ras/Raf complexes in the cytoplasm, hence preventing constitutive activation of the MAPK cascade. Uses: Radiation-sensitizing agents. Synonyms: FTI-277; FTI 277; FTI277. CAS No. 170006-73-2. M BOC Sciences 8
FTI 277 HCl FTI-277 inhibits Ras processing with an IC50 of 100 nM, but not the geranylgeranylated Rap1A processing in whole cells. Synonyms: FTI277 HCl; FTI 277 HCl; FTI-277 HCl. Grade: >98%. CAS No. 180977-34-8. Molecular formula: C22H30ClN3O3S2. Mole weight: 484.07. BOC Sciences 8
FTI-277 hydrochloride FTI-277 hydrochloride is an inhibitor of farnesyl transferase (FTase); a highly potent Ras CAAX peptidomimetic which antagonizes both H- and K-Ras oncogenic signaling. FTI-277 hydrochloride can inhibit hepatitis delta virus (HDV) infection. Uses: Scientific research. Group: Signaling pathways. CAS No. 180977-34-8. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15872A. MedChemExpress MCE
FTI 277 trifluoroacetate salt FTI 277 is a prodrug form of FTI 276 that inhibits farnesyltransferase (FTase) (IC50 = 0.5 nM) with antiproliferative activity. It potently inhibits H-Ras and K-Ras processing in whole cells (IC50 = 0.1 and 10 μM, respectively) and disrupts constitutive H-Ras-specific activation of MAPK. Synonyms: FTI 277 trifluoroacetate salt; FTI277 trifluoroacetate salt; FTI-277 trifluoroacetate salt; N-[4-[2(R)-Amino-3-mercaptopropyl]amino-2-phenylbenzoyl]methionine methyl ester trifluoroacetate salt. Grade: ≥95% by HPLC. CAS No. 1217447-06-7. Molecular formula: C22H29N3O3S2.C2HF3O2. Mole weight: 561.64. BOC Sciences 8
FTI-277 trifluoroacetate salt ?95% (HPLC), film. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
FTIDC FTIDC. Group: Biochemicals. Grades: Purified. CAS No. 873551-53-2. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 5
Worldwide
FTIDC FTIDC is an orally bioactive mGlu1 receptor negative allosteric modulator (IC50 = 5.8 and 6200 nM for mGlu1 and mGlu5, respectively) and an mGlu1 receptor inverse agonist (IC50 = 7 nM) in the absence of ligand. FTIDC exhibits anxiolytic and antipsychotic effects in vivo. Synonyms: 4-[1-(2-Fluoro-3-pyridinyl)-5-methyl-1H-1,2,3-triazol-4-yl]-3,6-dihydro-N-methyl-N-(1-methylethyl)-1(2H)-pyridinecarboxamide. Grade: ≥98% by HPLC. CAS No. 873551-53-2. Molecular formula: C18H23FN6O. Mole weight: 358.41. BOC Sciences 8
FTO Coated Glass FTO Coated Glass. Group: Ito-coated glass. Alfa Chemistry Materials 3
FTO-IN-1 FTO-IN-1 is a potent FTO inhibitor. Synonyms: UUN44923. CAS No. 2243944-92-3. Molecular formula: C18H16Cl2N4O2. Mole weight: 391.2. BOC Sciences 8
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS It is a derivative of Exendin-4 peptide. Synonyms: Phe-Thr-Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser. Grade: ≥95%. Molecular formula: C164H252N42O53S. Mole weight: 3692.12. BOC Sciences 10
FTTF FTTF. Group: Organic field effect transistor (ofet) materials. Alternative Names: 5,5'-Di(9H-fluoren-2-yl)-2,2'-bithiophene. CAS No. 369599-41-7. Pack Sizes: 250 mg in glass insert. Product ID: 2-(9H-fluoren-2-yl)-5-[5-(9H-fluoren-2-yl)thiophen-2-yl]thiophene. Molecular formula: 494.67. Mole weight: C34H22S2. C1c2ccccc2-c3ccc(cc13)-c4ccc(s4)-c5ccc(s5)-c6ccc-7c(Cc8ccccc-78)c6. BYGHZDSINXXOSM-UHFFFAOYSA-N. 96%. Alfa Chemistry Materials 7
FTTF sublimed grade. Group: Organic field effect transistor (ofet) materials. Alfa Chemistry Analytical Products
FTX-6058 FTX-6058 is a potent and orally active embryonic ectoderm development (EED) inhibitor that induces HbF protein expression in cells and murine models, and can be used in the study of select hemoglobinopathies, including sickle cell disease and β-thalassemia. Synonyms: 7H-Furo(4,3,2-gh)(1,2,4)triazolo(4',3':1,6)pyrido(2,3-c)(5,2)benzoxazonine, 12-fluoro-7a,8,13,14-tetrahydro-4-(2-methyl-3-pyridinyl)-, (7aS)-. Grade: ≥95%. CAS No. 2490676-18-9. Molecular formula: C22H18FN5O2. Mole weight: 403.41. BOC Sciences 8
FTX-6058 hydrochloride FTX-6058 hydrochloride is a potent and orally active embryonic ectoderm development (EED) inhibitor that induces HbF protein expression in cells and murine models, and can be used in the study of select hemoglobinopathies, including sickle cell disease and β-thalassemia. Synonyms: 7H-Furo(4,3,2-gh)(1,2,4)triazolo(4',3':1,6)pyrido(2,3-c)(5,2)benzoxazonine, 12-fluoro-7a,8,13,14-tetrahydro-4-(2-methyl-3-pyridinyl)-, (7aS)-, hydrochloride (1:1). Grade: ≥95%. CAS No. 2490676-19-0. Molecular formula: C22H19ClFN5O2. Mole weight: 439.87. BOC Sciences 8
FTY720 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
FTY720 hexanoic acid hydrochloride FTY720 hexanoic acid hydrochloride. Group: Biochemicals. Alternative Names: 4-[3-Amino-4-hydroxy-3- (hydroxymethyl) butyl]benzenehexanoic acid hydrochloride. Grades: Highly Purified. CAS No. 896472-94-9. Pack Sizes: 10mg. Molecular Formula: C17H28ClNO4. US Biological Life Sciences. USBiological 7
Worldwide
FTY720 Hydrochloride FTY720 is a derivative of ISP-1 (myriocin), a fungal metabolite of the Chinese herb Iscaria sinclarii as well as a structural analogue of Sphingosine. FTY720 is a novel immune modulator that prolongs allograft transplant survival in numberour models by inhibiting lymphocyte emigration from lymphoid organs. FTY720 us reported to be phosphorylated by sphingosine kinase to FTY720-P, which has been shown to potently stimulate GTPgS binding activity in S1P-transfected CHO cells (EC50 = 210 pM, 4.9 nM, 4.3 nM, and 1 nM for S1P1, S1P3, S1P4 and S1P5, respectively). Group: Biochemicals. Alternative Names: 2-Amino-2- (2- (4-octylphenyl) ethyl) propane-1, 3-diol Hydrochloride; Fingolimod Hydrochloride. Grades: Highly Purified. CAS No. 162359-56-0. Pack Sizes: 100mg. US Biological Life Sciences. USBiological 2
Worldwide
FTY720 Hydrochloride (Gilenya, 2-Amino-2-[2-(4-octylphenyl)ethyl]-1,3-propanediol. HCl, Fingolimod) Cell permeable immunosuppressor displaying lymphocyte sequestration properties and used for treatment in multiple sclerosis. Potent sphingosine 1-phosphate (S1P) receptor (S1P1, S1P3, S1P4, and S1P5) agonist when phosphorylated by sphingosine kinase. Sphingosine transporter Abcb1 and leukotriene C4 transporter Abcc1 activity enhancer. Cytosolic phospholipase A2 inhibitor, independent of sphingosine 1-phosphate receptors. Autophagy inducer. Apoptosis inducer. Group: Biochemicals. Grades: Highly Purified. CAS No. 162359-56-0. Pack Sizes: 1mg, 5mg, 25mg. US Biological Life Sciences. USBiological 4
Worldwide
FTY720 octanoic acid hydrochloride FTY720 octanoic acid hydrochloride. Group: Biochemicals. Alternative Names: 4-[3-Amino-4-hydroxy-3- (hydroxymethyl) butyl]benzeneoctanoic acid hydrochloride. Grades: Highly Purified. CAS No. 896472-95-0. Pack Sizes: 1mg, 2mg, 5mg, 10mg. Molecular Formula: C19H32ClNO4. US Biological Life Sciences. USBiological 7
Worldwide
FTY720 phenoxy-biotin FTY720 is a potent agonist at four of the five sphingosine-1-phosphate (S1P) receptors. Biotin-FTY720 is a biotin-tagged analog of FTY720. The hydroxy methyl side chain of FTY720 that is targeted for phosphorylation by sphingosine kinases is retained in this analog, which means that it would likewise be phosphorylated in vivo. Synonyms: 2-amino-2-[2-(4-octylphenyl)ethyl]-1,3-propanediol-N-biotinoyl-1,5-diampentane. Grade: ≥95%. Molecular formula: C27H44N4O5S·HCl. Mole weight: 573.2. BOC Sciences
FTY720 Phosphate FTY720 is a derivative of ISP-1 (myriocin). FTY720 phosphate is a potent agonist at four of the sphingosine-1-phosphate (S1P) receptors (S1P1, S1P3, S1P4, and S1P5, IC50 values = 0.2-6 nM). Synonyms: FTY720P; 2-amino-2-[2-(4-octylphenyl)ethyl]-1,3-propanediol, 1-(dihydrogen phosphate). Grade: ≥98%. CAS No. 402615-91-2. Molecular formula: C19H34NO5P. Mole weight: 387.5. BOC Sciences 8
Fty720(R)-phosphate Fty720(R)-phosphate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: fingolimod-P; FTY720-P; FTY720-phosphate,rac-2; FTY720 phosphate. Product Category: Heterocyclic Organic Compound. Appearance: A crystalline solid. CAS No. 402616-23-3. Molecular formula: C19H34NO5P. Mole weight: 387.5. Purity: ≥98%. IUPACName: [2-amino-2-(hydroxymethyl)-4-(4-octylphenyl)butyl] dihydrogen phosphate. Canonical SMILES: CCCCCCCCC1=CC=C(C=C1)CCC(CO)(COP(=O)(O)O)N. Product ID: ACM402616233. Alfa Chemistry — ISO 9001:2015 Certified. Categories: Fingolimod phosphate. Alfa Chemistry. 3
FTY720 (R)-Phosphate FTY720 is a potent agonist at four of the five sphingosine-1-phosphate (S1P) receptors. FTY720 (R)-phosphate is one of the stereoisomers of FTY720-phosphate. Synonyms: (2R)-amino-2-[2-(4-octylphenyl)ethyl]-1-(dihydrogen phosphate)-1,3-propanediol. Grade: ≥98%. CAS No. 402616-23-3. Molecular formula: C19H34NO5P. Mole weight: 387.5. BOC Sciences 8
FTY720 (S)-Phosphate FTY720 is a potent agonist at four of the five sphingosine-1-phosphate (S1P) receptors. FTY720 (S)-phosphate is the single stereoisomer of FTY720. FTY720 (S)-phosphate exhibits Ki values of 2.1, 5.9, 23, and 2.2 nM for S1P1,3,4,5, respectively, whereas the R enantiomer binds with 5 to 130-fold lower affinity. Synonyms: (S)-FTY 720P; (2S)-amino-2-[2-(4-octylphenyl)ethyl]-1-(dihydrogen phosphate)-1,3-propanediol. Grade: ≥98%. CAS No. 402616-26-6. Molecular formula: C19H34NO5P. Mole weight: 387.5. BOC Sciences 8
Fuberidazole Fuberidazole (BAY 33172; Furidazole) is a fungicide. Fuberidazole shows a synergistic effect with cucurbituril (CB) macromolecules, such as CB7 and CB8. Studies have shown that, CB8 induces pK a shifts on Fuberidazole. Fuberidazole significantly inhibits the growth of B. cinerea [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: BAY 33172; Furidazole. CAS No. 3878-19-1. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-B1843. MedChemExpress MCE
Fuberidazole Fuberidazole is an antifungal agent. Synonyms: Fuberidatol; Voronit; 2-(2-Furyl)benzimidazole. CAS No. 3878-19-1. Molecular formula: C11H8N2O. Mole weight: 184.19. BOC Sciences 8
Fuberidazole Fuberidazole. Group: Biochemicals. Alternative Names: 2-(2-Furanyl)-1H-benzimidazole; 2-(2-Furanyl)benzimidazole; 2-(2-Furyl)benzimidazole; 2-(2'-Furyl)benzimidazole; 2-(Furan-2-yl)benzimidazole; B 33172; BAY 33172; Bayer 33172; Fuberidazol; Furidazol; Furidazole; NSC 72670; PF 7402; Voronit; 2-(2-Furyl)-benzimidazole; 2-(2-Furanyl)-1H-benzimidazole. Grades: Highly Purified. CAS No. 3878-19-1. Pack Sizes: 500mg. Molecular Formula: C11H8N2O, Molecular Weight: 184.19. US Biological Life Sciences. USBiological 3
Worldwide
FUB-JWH 018 FUB-JWH 018 is an analog of JWH 018 (P283650), the 18th compound synthesized in a series of more than 470 analogs and metabolites of ?9-Tetrahydro- cannabinol (THC) (T293200), the active component of marijuana. JWH 018 acts as cannabinoid receptor. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 1mg, 5mg. Molecular Formula: C26H18FNO, Molecular Weight: 379.43. US Biological Life Sciences. USBiological 5
Worldwide
FUBP1-IN-1 FUBP1-IN-1 is a potent FUSE binding protein 1 (FUBP1) inhibitor which interferes with the binding of FUBP1 to its single stranded target DNA FUSE sequence , with an IC50 value of 11.0 ?M[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 883003-62-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-100758. MedChemExpress MCE
Fuc-a-1-2-Gal-b-1-3-GalNAc-b-1-4-Gal-b-1-4-Glc-b-ethylazide Fuc-a-1-2-Gal-b-1-3-GalNAc-b-1-4-Gal-b-1-4-Glc-b-ethylazide. BOC Sciences 8
Fuchsin acid 25g Pack Size. Group: Stains & Indicators. Formula: C20H20N2O9S3. CAS No. 3244-88-0. Prepack ID 16313560-25g. Molecular Weight 585.5382. See USA prepack pricing. Molekula Americas

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products