A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Also reduces D-tagaturonate. Group: Enzymes. Synonyms: mannonate oxidoreductase; mannonic dehydrogenase; D-mannonate dehydrogenase; D-mannonate:NAD oxidoreductase. Enzyme Commission Number: EC 1.1.1.57. CAS No. 9028-44-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0342; fructuronate reductase; EC 1.1.1.57; 9028-44-8; mannonate oxidoreductase; mannonic dehydrogenase; D-mannonate dehydrogenase; D-mannonate:NAD oxidoreductase. Cat No: EXWM-0342.
Fructus Gardeniae Extract (Standard)
Fructus Gardeniae Extract (Standard). Applications: For the upset, jaundice, blood heat spit bleed at the nose, sprains, edema. Group: Others. Synonyms: Fructus Gardeniae Extract (Standard). Purity: 10%,10:1, HPLC. Appearance: Red-brown powder. Storage: 24 months with original packing under 18°C. Store in cool dry place,avoid sunlight and high temperature. Source: Rubiaceae Gardenia fruit. Fructus Gardeniae Extract (Standard) ; plant extract. Pack: 1kg, 5kg, 10kg aluminum foil vacuum bag; or 20kg, 25kg Fiber Drum. Cat No: EXTW-201.
fruit bromelain
From the pineapple plant, Ananas comosus. Scarcely inhibited by chicken cystatin. Another cysteine endopeptidase, with similar action on small molecule substrates, pinguinain, is obtained from the related plant, Bromelia pinguin, but pinguinain differs from fruit bromelain in being inhibited by chicken cystatin. Group: Enzymes. Synonyms: juice bromelain; ananase; bromelase; bromelin; extranase; juice bromelain; pinase; pineapple enzyme; traumanase; fruit bromelain FA2. Enzyme Commission Number: EC 3.4.22.33. CAS No. 9001-00-7. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4208; fruit bromelain; EC 3.4.22.33; 9001-00-7; juice bromelain; ananase; bromelase; bromelin; extranase; juice bromelain; pinase; pineapple enzyme; traumanase; fruit bromelain FA2. Cat No: EXWM-4208.
Frunexian (EP-7041) is a selective and potent inhibitor of coagulation factor XI/activated factor XI, targeting to factor XIa. Frunexian exhibits antithrombotic activity, with no bleeding liability in rat mesenteric arterial puncture model. Frunexian can be used in extracorporeal membrane oxygenation (ECMO) research[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: EP-7041. CAS No. 1803270-60-1. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-156613.
Fruquintinib
Fruquintinib (HMPL-013) is a highly potent and selective VEGFR 1/2/3 inhibitor with IC50s of 33, 0.35, and 35 nM, respectively. Uses: Scientific research. Category: Signaling pathways. Alternative Names: HMPL-013. CAS No. 1194506-26-7. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-19912.
Fruquintinib
Fruquintinib, also known as HMPL-013, is an orally available, small molecule inhibitor of vascular endothelial growth factor receptors (VEGFRs), with potential anti-angiogenic and antineoplastic activities. Synonyms: Fruquintinib; HMPL013; HMPL 013; HMPL-013. Grade: 98%. CAS No. 1194506-26-7. Molecular formula: C21H19N3O5. Mole weight: 393.39.
Frutinone A is a CYP1A2 inhibitor, possesses a chromonocoumarin structural scaffold. Frutinone A shows various biological activities, including antibacterial and antioxidant[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 38210-27-4. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-W777979.
Frutinone A
Frutinone A. Group: Biochemicals. Alternative Names: 6H,7H-[1]Benzopyrano[4,3-b][1]benzopyran-6,7-dione. Grades: Highly Purified. CAS No. 38210-27-4. Pack Sizes: 10mg, 25mg, 50mg, 100mg, 250mg. Molecular Formula: C16H8O4. US Biological Life Sciences.
Worldwide
Frutonile
Frutonile. Group: Biochemicals. Alternative Names: 2-Methyldecanenitrile; 2-Cyanodecane. Grades: Highly Purified. CAS No. 69300-15-8. Pack Sizes: 10mg, 25mg, 50mg, 100mg, 250mg. Molecular Formula: C11H21N. US Biological Life Sciences.
FSBA (5'-p-Fluorosulfonylbenzoyladenosine) hydrochloride is a covalent modifier and affinity labeling reagent for adenine nucleotide-binding proteins. FSBA hydrochloride covalently attaches to the nucleotide-binding sites of pyruvate kinase, glutamate dehydrogenase, and p56lck, and to a lysine residue in the ATP-binding site of cAMP-dependent protein kinase, causing loss of enzymatic activity. FSBA hydrochloride can be used for the research of T lymphoma[1][2]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: 5'-p-Fluorosulfonylbenzoyladenosine. CAS No. 78859-42-4. Pack Sizes: 5 mg; 10 mg. Product ID: HY-123650.
FSEN1
FSEN1 is a potent and non-competitive FSP1 inhibitor with an IC50 value of 313 nM. FSEN1 triggers iron death in cancer cells by inhibiting FSP1. FSEN1 can be used in research of cancer[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 862808-01-3. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-153629.
FSG67
FSG67 is a glycerol 3-phosphate acyltransferase (GPAT) inhibitor with an IC50 of 24 μM[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1158383-34-6. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-112489.
FSHR agonist 1
FSHR agonist 1 is a high affinity and allosteric follicle stimulating hormone receptor (FSHR) agonist with a pEC50 of 7.72. FSHR agonist 1 formes extensive interactions with the TMD to directly activate FSHR[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1256776-89-2. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-150210.
FSH receptor antagonist 1
FSH receptor antagonist 1 (compound 10) is a potent antagonist of the G(s)-protein-coupled human follicle-stimulating hormone (FSH) receptor. FSH receptor antagonist 1 exhibits an IC50 of 28 nM on a cell line expressing the human FSH receptor. FSH receptor antagonist 1 significantly inhibits follicle growth and ovulation in an ex vivo mouse model[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 487064-35-7. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-149105.
Fsh receptor-binding inhibitor fragment(bi-10)
FSH receptor-binding inhibitor fragment(bi-10) is a potent FSH antagonist. FSH receptor-binding inhibitor fragment(bi-10) blocks the binding of FSH to FSHR, and alteres FSH action at the receptor level. FSH receptor-binding inhibitor fragment(bi-10) results in the suppression of ovulation and causes follicular atresia of mice. FSH receptor-binding inhibitor fragment(bi-10) has the potential for utilizing to restrain the carcinogenesis of ovarian cancer by down-regulating overexpression of FSHR and ERβ in the ovaries[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 163973-98-6. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P4190.
FSI-TN42
FSI-TN42 (N42) is a selective, orally active and irreversible ALDH1A1 inhibitor with an IC50 of 23 nM. FSI-TN42 shows 800-fold more potent against ALDH1A1 than ALDH1A2 (IC50
FSK hydrochloride
FSK hydrochloride is fluorosulfonyloxybenzoyl-L-lysine, which features a long, flexible aryl fluorosulfate-containing side chain that can reach protein sites inaccessible to covalent conjugation. FSK hydrochloride modifies nanomolecules to target epidermal growth factor receptor (EGFR), resulting in irreversibly bound covalent interactions. Through genetically encoded chemical crosslinking, FSK hydrochloride captures unknown enzyme-substrate interactions in living cells, targets residues other than Cys, and mediates crosslinking at the binding periphery. FSK hydrochloride enables the construction of a bioreactive SuFEx system for generating covalent bonds in various proteins both in vitro and in vivo[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 3033987-42-4. Pack Sizes: 10 mM * 1 mL in Water; 5 mg; 10 mg; 25 mg. Product ID: HY-48999A.
FSL 1 is a TLR2/6 peptide agonist (also a putative TLR10 ligand) that activates NF-κB. FSL 1 induces the expression of some pro-inflammatory cytokines such as IL-8, IL-1β, CCL20 and TNF-α in vitro. Synonyms: FSL 1; FSL1; L-Phenylalanine, S-[2,3-bis[(1-oxohexadecyl)oxy]propyl]-L-cysteinylglycyl-L-α-aspartyl-L-prolyl-L-lysyl-L-histidyl-L-prolyl-L-lysyl-L-seryl-; S-[2,3-Bis[(1-oxohexadecyl)oxy]propyl]-L-cysteinylglycyl-L-α-aspartyl-L-prolyl-L-lysyl-L-histidyl-L-prolyl-L-lysyl-L-seryl-L-phenylalanine; FSL-1 lipoprotein, synthetic; Fibroblast-stimulating lipopeptide-1; Pam2-Cys-Gly-Asp-Pro-Lys-His-Pro-Lys-Ser-Phe-OH. Grade: ≥95%. CAS No. 322455-70-9. Molecular formula: C84H140N14O18S. Mole weight: 1666.16.
FSL-1-FLAG
Lipopeptide FSL-1, synthesized on the basis of the N-terminal structure of M. salivarium lipoprotein, can induce ICAM-1 expression on the surface of human gingival fibroblasts. In addition, it induces the production of monocyte chemoattractant protein 1, interleukin-6 (IL-6), and IL-8. It activates macrophages to produce tumor necrosis factor-alpha. Synonyms: Fibroblast Stimulating Lipopeptide 1 FLAG-tag; H-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-Gly-Asp-Pro-Lys-His-Pro-Lys-Ser-Phe-Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys-OH; L-Lysine, S-[2,3-bis[(1-oxohexadecyl)oxy]propyl]-L-cysteinylglycyl-L-α-aspartyl-L-prolyl-L-lysyl-L-histidyl-L-prolyl-L-lysyl-L-seryl-L-phenylalanyl-L-α-aspartyl-L-tyrosyl-L-lysyl-L-α-aspartyl-L-α-aspartyl-L-α-aspartyl-L-α-aspartyl-. Grade: ≥95%. CAS No. 2243206-97-3. Molecular formula: C125H198N24O37S. Mole weight: 2661.15.
FSL-1 TFA salt
FSL-1 is a TLR2/6 peptide agonist (also a putative TLR10 ligand) that activates NF-κB. FSL-1 induces the expression of some pro-inflammatory cytokines such as IL-8, IL-1β, CCL20 and TNF-α in vitro. Synonyms: FSL 1 TFA salt; FSL1 TFA salt; L-Phenylalanine, S-[2,3-bis[(1-oxohexadecyl)oxy]propyl]-L-cysteinylglycyl-L-α-aspartyl-L-prolyl-L-lysyl-L-histidyl-L-prolyl-L-lysyl-L-seryl-, 2,2,2-trifluoroacetic acid; S-[2,3-Bis[(1-oxohexadecyl)oxy]propyl]-L-cysteinylglycyl-L-α-aspartyl-L-prolyl-L-lysyl-L-histidyl-L-prolyl-L-lysyl-L-seryl-L-phenylalanine 2,2,2-trifluoroacetic acid; FSL-1 lipoprotein, synthetic TFA salt; Fibroblast-stimulating lipopeptide-1 TFA salt; Pam2-Cys-Gly-Asp-Pro-Lys-His-Pro-Lys-Ser-Phe-OH TFA. Grade: ≥95%. Molecular formula: C86H141F3N14O20S. Mole weight: 1780.18.
FSLLRY-NH2
FSLLRY-NH2 is a protease-activated receptor 2 (PAR2) inhibitor[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 245329-02-6. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg. Product ID: HY-P1260.
FSLLRY-NH2
FSLLRY-NH2 is a selective PAR2 peptide antagonist. It reverses taxol-induced mechanical allodynia, heat hyperalgesia and PKC activation in ICR mice, also suppresses ERK activation and collagen production in isolated cardiac fibroblasts. Synonyms: [Phe1,Ser2,Tyr6]-PAR-1 (1-6) amide (human). CAS No. 245329-02-6. Molecular formula: C39H60N10O8. Mole weight: 796.97.
FSLLRY-NH2
FSLLRY-NH2. Group: Biochemicals. Grades: Purified. CAS No. 245329-02-6. Pack Sizes: 1mg. US Biological Life Sciences.
Worldwide
FSLLRY-NH2 TFA
FSLLRY-NH2 TFA is a selective PAR2 peptide antagonist. It reverses taxol-induced mechanical allodynia, heat hyperalgesia and PKC activation in ICR mice, and also suppresses ERK activation and collagen production in isolated cardiac fibroblasts. Synonyms: H-Phe-Ser-Leu-Leu-Arg-Tyr-NH2.TFA; L-phenylalanyl-L-seryl-L-leucyl-L-leucyl-L-arginyl-L-tyrosinamide trifluoroacetic acid. Grade: ≥95%. Molecular formula: C41H61F3N10O10. Mole weight: 910.99.
FSP-1
Anticoagulant: irreversible inhibitor of serine proteinase a-thrombine. Fluorocontaining phosphonate, identifies an inflammatory subpopulation of macrophages in the liver. Grade: 99% (NMR). Molecular formula: C17H24F6NO5PS. Mole weight: 499.40.
One unit of the enzyme is the amount required to hydrolyze 1 μg of Lambda DNA in 1 hour at 37°C in a total reaction volume of 50 μl. Applications: After 5-fold overdigestion with enzyme about 5% of the dna fragments can be ligated and recut. Group: Restriction Enzymes. Purity: 200U; 1000U. GC↑NGC CGN↓CG. Activity: 3000-5000u.a./ml. Appearance: 10 X SE-buffer Y. Storage: -20°C. Form: Liquid. Source: An E.coli strain that carries the cloned Fsp4H I gene from Flavobacterium species 4H. Pack: 10 mM Tris-HCl (pH 7.5); 100 mM NaCl; 0.1 mM EDTA; 200ug/ml BSA; 1mM DTT; 50% glycerol. Cat No: ET-1114RE.
FT001
FT001 is a potent, selective and orally effective BET Bromodomain inhibitor with antitumor activity. FT001 inhibits MYC expression with an IC50 of 0.46 μM. FT001 has an effective anti-proliferation effect on MV-4-11, showing obvious MYC mRNA inhibition both in vitro and in vivo. Synonyms: (S)-1-(4-(cyclopropanecarbonyl)-6-(4-(1,1-dioxidothiomorpholino)phenyl)-2-methyl-3,4-dihydroquinoxalin-1(2H)-yl)ethan-1-one; Ethanone, 1-[(2S)-4-(cyclopropylcarbonyl)-6-[4-(1,1-dioxido-4-thiomorpholinyl)phenyl]-3,4-dihydro-2-methyl-1(2H)-quinoxalinyl]-; FT001; FT-001; 1-[(2S)-4-(Cyclopropylcarbonyl)-6-[4-(1,1-dioxido-4-thiomorpholinyl)phenyl]-3,4-dihydro-2-methyl-1(2H)-quinoxalinyl]ethanone. Grade: ≥95%. CAS No. 1778655-51-8. Molecular formula: C25H29N3O4S. Mole weight: 467.58.
FT011
FT011 is an anti-fibrotic agent, reduces mRNA expression of collagens I and III and inhibits collagen synthesis[1]. FT011 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Asengeprast. CAS No. 1001288-58-9. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-100495.
FT113
FT113 is a potent and orally active fatty acid synthase (FASN) inhibitor, with an IC50 of 213 nM for full-length recombinant human FASN enzyme. In cell-based assay, FT113 blocks FASN activity in BT474 cells (IC50, 90 nM). FT113 shows anti-proliferative activity, and exhibits anti-cancer activity both in vitro and in vivo[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1630808-89-7. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-111551.
FT113
FT113 is a potent inhibitor of fatty acid synthase (FAS/FASN) with IC50 of 213 nM. Synonyms: FT-113; FT113. CAS No. 1630808-89-7. Molecular formula: C22H20FN3O4. Mole weight: 409.41.
FT-1518
FT-1518 is a new generation selective, potent and oral bioavailable inhibitor of mTORC1 and mTORC2, and it shows antitumor activity. Synonyms: FT1518; NSC-802820. CAS No. 1313026-58-2. Molecular formula: C20H26N8O. Mole weight: 394.48.
FT206
FT206 is a carboxamide ubiquitin-specific protrase inhibitor. (Extracted from patent WO 2020033707 A1, example 11-1). Synonyms: NSC833745; Thieno[2,3-b]pyridine-2-carboxamide, 3-amino-N-[(2S)-6-(3,8-diazabicyclo[3.2.1]oct-3-yl)-1,2,3,4-tetrahydro-2-naphthalenyl]-6-methyl-; 3-Amino-N-[(2S)-6-(3,8-diazabicyclo[3.2.1]oct-3-yl)-1,2,3,4-tetrahydro-2-naphthalenyl]-6-methylthieno[2,3-b]pyridine-2-carboxamide. Grade: ≥98%. CAS No. 2278274-34-1. Molecular formula: C25H29N5OS. Mole weight: 447.60.
FT206
FT206 is the inhibitor for ubiquitin-specific protease that inhibits USP28 and USP25 with IC50s of 0.15 μM and 1.01 μM[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2278274-34-1. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-138698.
FT3967385
FT3967385 is an inhibitor of USP30 that recapitulates genetic loss of USP30 and sets the trigger for PINK1-PARKIN amplification of mitochondrial ubiquitylation. Synonyms: FT385; (R)-N-(1-cyanopyrrolidin-3-yl)-3-(2-phenoxyphenyl)-1H-pyrazole-5-carboxamide. Grade: ≥95%. Molecular formula: C21H19N5O2. Mole weight: 373.41.
FT671
FT671 is a potent and selective USP7 inhibitor with high affinity and specificity in vitro and in cells. FT671 destabilises USP7 substrates including MDM2, elevates p53 and results in transcription of p53 target genes, induction of the tumour suppressor p21, and tumour growth inhibition in mice. Synonyms: FT-671; FT 671; (S)-5-((1-(4,4-difluoro-3-(3-fluoro-1H-pyrazol-1-yl)butanoyl)-4-hydroxypiperidin-4-yl)methyl)-1-(4-fluorophenyl)-1,5-dihydro-4H-pyrazolo[3,4-d]pyrimidin-4-one. Grade: >98%. CAS No. 1959551-26-8. Molecular formula: C24H23F4N7O3. Mole weight: 533.48.
FT709
FT709 is a potent and selective USP9X inhibitor, an IC50 of 82 nM. USP9X has been linked with centrosome function, chromosome alignment during mitosis, EGF receptor degradation, chemo-sensitization, and circadian rhythms[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2413991-74-7. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-145967.
FT895
FT895 is a potent and selective inhibitor of HDAC11 with an IC50 of 3 nM. Synonyms: 1H-Isoindole-4-carboxamide, 2,3-dihydro-N-hydroxy-1,1-dimethyl-2-[5-(trifluoromethyl)-2-pyrazinyl]-; N-Hydroxy-1,1-dimethyl-2-[5-(trifluoromethyl)-2-pyrazinyl]-4-isoindolinecarboxamide; 2,3-Dihydro-N-hydroxy-1,1-dimethyl-2-[5-(trifluoromethyl)-2-pyrazinyl]-1H-isoindole-4-carboxamide; HDTK 070; FT-895; FT 895. Grade: ≥95%. CAS No. 2225728-57-2. Molecular formula: C16H15F3N4O2. Mole weight: 352.31.
FT895
FT895 is a potent and selective HDAC11 inhibitor with an IC50 of 3 nM[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2225728-57-2. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-112285.
FTase Inhibitor I
FTase inhibitor I is a potent and selective farnesyltransferase (FTase) inhibitor with an IC50 of 21 nM, which is 30-fold higher for FTase over geranylgeranyl transferase (GGTase; IC50 = 790 nM). Synonyms: Farnesyltransferase Inhibitor I; B581; N-[(2S)-2-[[(2R)-2-amino-3-mercaptopropyl]amino]-3-methylbutyl]-L-phenylalanyl-L-methionine. Grade: ≥95%. CAS No. 149759-96-6. Molecular formula: C22H38N4O3S2. Mole weight: 470.69.
FTase Inhibitor II
FTase Inhibitor II is a cell-permeable analog of farnesyl pyrophosphate (FPP) that potently inhibits FTase with an IC50 of 50-75 nM, and it does not inhibit geranylgeranyl transferase at similar concentrations (IC50 > 100 μM). FTase Inhibitor II is a possible cancer therapeutic agent. Synonyms: Farnesyltransferase Inhibitor II; FTI-II; N-[4-[[(2R)-2-amino-3-mercapto-1-oxopropyl]amino]benzoyl]-L-methionine. Grade: ≥80%. CAS No. 156707-43-6. Molecular formula: C15H21N3O4S2. Mole weight: 371.47.
Ftaxilide
Ftaxilide is an antituberculosis agent used as antiseptic. Synonyms: 2-[(2,6-dimethylphenyl)carbamoyl]benzoic acidFtaxilide2',6'-Dimethylphthalanilic acidHistanorm19368-18-4Ftaxilide [INN:DCF]Ftaxilidum [INN-Latin]Ftaxilida [INN-Spanish]Phthalic 2,6-dimethylanilideUNII-7Z71845H3FMP-12-PMP 12; NSC 16112; MP12; NSC16112; MP-12; NSC-16112Phthalanil. CAS No. 19368-18-4. Molecular formula: C16H15NO3. Mole weight: 269.295.
FTBMT
FTBMT is a novel and selective GPR52 agonist (EC50 = 75 nM, Emax = 122%). FTBMT displays antipsychotic and procognitive properties without causing catalepsy in rodents. Synonyms: 4-[3-[[3-Fluoro-5-(trifluoromethyl)phenyl]methyl]-5-methyl-1H-1,2,4-triazol-1-yl]-2-methylbenzamide. Grade: ≥98% by HPLC. CAS No. 1358575-02-6. Molecular formula: C19H16F4N4O. Mole weight: 392.35.
FT-FAPI-12_9
FT-FAPI-12_9 is a FAP ligand that can be used to synthesize FAPI-46, a radiotracer targeting FAP[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2883407-81-4. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-164316.
FTI-2148
FTI-2148 is a potent farnesyltransferase inhibitor with potential antitumor activity. Synonyms: FTI 2148; FTI2148; (S)-2-(5-((((1H-Imidazol-5-yl)methyl)amino)methyl)-2'-methyl-[1,1'-biphenyl]-2-ylcarboxamido)-4-(methylthio)butanoic acid. Grade: 98%. CAS No. 251577-09-0. Molecular formula: C24H28N4O3S. Mole weight: 452.57.
FTI-2153
FTI-2153 is a potent farnesyltransferase inhibitor. FTI-2153 inhibits bipolar spindle formation during mitosis independently of transformation and Ras and p53 mutation status. FTI-2153 was reported to block bipolar spindle formation and chromosome alignment and causes prometaphase accumulation during mitosis of human lung cancer cells. Synonyms: FTI 2153; FTI2153; (S)-2-[(5-{[(1H-Imidazol-4-ylmethyl)-amino]-methyl}-2''-methyl-biphenyl-2-carbonyl)-amino]-4-methylsulfanyl-butyric acid methyl ester. CAS No. 344900-92-1. Molecular formula: C25H30N4O3S. Mole weight: 466.6.
FTI-249
FTI-249 is a Farnesyltransferase inhibitor, which potently inhibited FTase (IC50 = 100-200 nM). Synonyms: FTI 249; FTI249; (S)-2-(4-(((R)-2-amino-3-mercaptopropyl)amino)benzamido)-4-(methylthio)butanoic acid. Grade: 98%. CAS No. 161721-65-9. Molecular formula: C15H23N3O3S2. Mole weight: 357.49.
FTI 276
FTI 276. Group: Biochemicals. Grades: Purified. CAS No. 1217471-51-6. Pack Sizes: 1mg. US Biological Life Sciences.
Worldwide
FTI-276
FTI-276 is a potent and selective farnesyltransferase inhibitor, which is also a tetrapeptide mimetic of the carboxyl terminus of K-Ras4B. FTI-276 blocked the growth in nude mice of a human lung carcinoma that expresses the two most prevalent genetic alterations in human cancers (K-Ras oncogenic mutation and deletion in the tumor suppressor gene p53). In contrast, FTI-276 did not inhibit tumor growth of a human lung carcinoma that harbors no Ras mutations. Furthermore, FTI-276 inhibited oncogenic signaling and tumor growth of NIH 3T3 cells transformed with the ras but not the raf oncogene. Synonyms: FTI276; FTI 276; (S)-2-(5-(((R)-2-amino-3-mercaptopropyl)amino)-[1,1'-biphenyl]-2-ylcarboxamido)-4-(methylthio)butanoic acid. CAS No. 170006-72-1. Molecular formula: C21H27N3O3S2. Mole weight: 433.59.
FTI 276 TFA
FTI 276 TFA is a farnesyltransferase (FTase) inhibitor with an IC50 of 0.5 nM, and it exhibits selectivity for FTase over geranylgeranyltransferase I (GGTase I). FTI 276 TFA blocks the farnesylation of H-Ras and K-Ras4B, causes inactive Ras-Raf complexes to accumulate in the cytoplasm, and inhibits constitutive MAPK activation. FTI 276 TFA reduces the number, incidence and volume of tumors, and restricts the growth of tumors expressing activated K-ras. FTI 276 TFA can be used in research related to pulmonary adenoma[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1217471-51-6. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15873A.
FTI 276 trifluoroacetate salt
FTI 276 is a Ras CAAX peptidomimetic, a selective inhibitor of farnesyltransferase (FTase) with > 100-fold selectivity over geranylgeranyltransferase I (GGTase I) (IC50 = 0.5 and 50 nM, respectively). It exhibits an inhibitory effect on growth of human lung carcinoma expressing oncogenic K-Ras in nude mice. Synonyms: FTI 276 trifluoroacetate salt; FTI276 trifluoroacetate salt; FTI-276 trifluoroacetate salt; N-[4-[2(R)-Amino-3-mercaptopropyl]amino-2-phenylbenzoyl]methionine trifluoroacetate salt. Grade: ≥95% by HPLC. CAS No. 1217471-51-6. Molecular formula: C21H27N3O3S2.C2HF3O2. Mole weight: 547.61.
FTI 277
FTI 277. Group: Biochemicals. Grades: Purified. CAS No. 1217447-06-7. Pack Sizes: 1mg. US Biological Life Sciences.
Worldwide
FTI-277
FTI-277, a peptide mimetic of the COOH-terminal Cys-Val-Ile-Met of K-Ras4B that inhibited potently FTase in vitro (IC50 = 500 pM) and was highly selective for FTase over geranylgeranyltransferase I (GGTase I) (IC50 = 50 nM). FTI-277, the methyl ester derivative of FTI-276, was extremely potent (IC50 = 100 nM) at inhibiting H-Ras, but not the geranylgeranylated Rap1A processing in whole cells. Treatment of H-Ras oncogene-transformed NIH 3T3 cells with FTI-277 blocked recruitment to the plasma membrane and subsequent activation of the serine/threonine kinase c-Raf-1 in cells transformed by farnesylated Ras (H-RasF), but not geranylgeranylated, Ras (H-RasGG). FTI-277 induced accumulation of cytoplasmic non-farnesylated H-Ras that was able to bind Raf and form cytoplasmic Ras/Raf complexes in which Raf kinase was not activated. Furthermore, FTI-277 blocked constitutive activation of mitogen-activated protein kinase (MAPK) in H-RasF, but not H-RasGG, or Raf-transformed cells. FTI-277 also inhibited oncogenic K-Ras4B processing and constitutive activation of MAPK, but the concentrations required were 100-fold higher than those needed for H-Ras inhibition. The results demonstrate that FTI-277 blocks Ras oncogenic signaling by accumulating inactive Ras/Raf complexes in the cytoplasm, hence preventing constitutive activation of the MAPK cascade. Uses: Radiation-sensitizing agents. Synonyms: FTI-277; FTI 277; FTI277. CAS No. 170006-73-2. M
FTI 277 HCl
FTI-277 inhibits Ras processing with an IC50 of 100 nM, but not the geranylgeranylated Rap1A processing in whole cells. Synonyms: FTI277 HCl; FTI 277 HCl; FTI-277 HCl. Grade: >98%. CAS No. 180977-34-8. Molecular formula: C22H30ClN3O3S2. Mole weight: 484.07.
FTI-277 hydrochloride
FTI-277 hydrochloride is an inhibitor of farnesyl transferase (FTase); a highly potent Ras CAAX peptidomimetic which antagonizes both H- and K-Ras oncogenic signaling. FTI-277 hydrochloride can inhibit hepatitis delta virus (HDV) infection. Uses: Scientific research. Category: Signaling pathways. CAS No. 180977-34-8. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15872A.
FTI 277 trifluoroacetate salt
FTI 277 is a prodrug form of FTI 276 that inhibits farnesyltransferase (FTase) (IC50 = 0.5 nM) with antiproliferative activity. It potently inhibits H-Ras and K-Ras processing in whole cells (IC50 = 0.1 and 10 μM, respectively) and disrupts constitutive H-Ras-specific activation of MAPK. Synonyms: FTI 277 trifluoroacetate salt; FTI277 trifluoroacetate salt; FTI-277 trifluoroacetate salt; N-[4-[2(R)-Amino-3-mercaptopropyl]amino-2-phenylbenzoyl]methionine methyl ester trifluoroacetate salt. Grade: ≥95% by HPLC. CAS No. 1217447-06-7. Molecular formula: C22H29N3O3S2.C2HF3O2. Mole weight: 561.64.
FTIDC
FTIDC is an orally bioactive mGlu1 receptor negative allosteric modulator (IC50 = 5.8 and 6200 nM for mGlu1 and mGlu5, respectively) and an mGlu1 receptor inverse agonist (IC50 = 7 nM) in the absence of ligand. FTIDC exhibits anxiolytic and antipsychotic effects in vivo. Synonyms: 4-[1-(2-Fluoro-3-pyridinyl)-5-methyl-1H-1,2,3-triazol-4-yl]-3,6-dihydro-N-methyl-N-(1-methylethyl)-1(2H)-pyridinecarboxamide. Grade: ≥98% by HPLC. CAS No. 873551-53-2. Molecular formula: C18H23FN6O. Mole weight: 358.41.
FTIDC
FTIDC. Group: Biochemicals. Grades: Purified. CAS No. 873551-53-2. Pack Sizes: 10mg. US Biological Life Sciences.
Worldwide
FTIDC
FTIDC is an orally active, noncompetitive, selective allosteric metabotropic glutamate receptor (mGluR) 1 antagonist with an IC50 of 5.8 nM for human mGluR1a. FTIDC has no species differences in its antagonistic activity on recombinant human, mouse, and rat mGluR1[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 873551-53-2. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-100405.
FTO Coated Glass
FTO Coated Glass.
FTO-IN-1
FTO-IN-1 is a potent FTO inhibitor. Synonyms: UUN44923. CAS No. 2243944-92-3. Molecular formula: C18H16Cl2N4O2. Mole weight: 391.2.
FTO-IN-3
FTO-IN-3 is a FTO inhibitor that impair self-renewal in glioblastoma stem cells. Uses: Scientific research. Category: Signaling pathways. CAS No. 2585198-87-2. Pack Sizes: 5 mg; 10 mg. Product ID: HY-132865.
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
It is a derivative of Exendin-4 peptide. Synonyms: Phe-Thr-Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser. Grade: ≥95%. Molecular formula: C164H252N42O53S. Mole weight: 3692.12.