A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| mPEG-PLA-PPEEA | Polylactic acid (PLA) is a kind of non-toxic,non irritating synthetic polymer material with excellent biodegradability,compatibility and absorbability.It can be used as drug transport material and tissue engineering scaffold material. Synonyms: methoxy polyethylene glycol-Poly(D,L-lactide)-PPEEA. Product ID: MSMN-064. Category: Raw Materials. |  |
| mPEG-RhB | Revolutionize your Fluorescent Monofunctional Linear PEGs research with Methoxy PEG-Rhodamine B, a high-quality Fluorescent Polymers obtainable from CD Bioparticles Drug Delivery. Group: Fluorescent monofunctional linear pegs. |  |
| MPEP | MPEP is a potent, selective, noncompetitive, orally active and systemically active mGlu5 receptor antagonist, with an IC50 of 36 nM for completely inhibiting quisqualate-stimulated phosphoinositide (PI) hydrolysis. MPEP has anxiolytic-or antidepressant-like effects[1][2]. MPEP is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Category: Signaling pathways. CAS No. 96206-92-7. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-14609A. |  |
| MPEP hydrochloride | MPEP hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 219911-35-0. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. |  Worldwide |
| MPEP Hydrochloride | MPEP Hydrochloride is a potent, selective, noncompetitive, orally active and systemically active mGlu5 receptor antagonist, with an IC50 of 36 nM for completely inhibiting quisqualate-stimulated phosphoinositide (PI) hydrolysis. MPEP Hydrochloride has anxiolytic-or antidepressant-like effects[1][2]. MPEP (Hydrochloride) is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Category: Signaling pathways. CAS No. 219911-35-0. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-14609. | |
| MPEP Hydrochloride (6-Methyl-2- (phenylethynyl) pyridine Hydrochloride) | A non-competitive, highly potent antagonist selective for mGlu5 receptors (IC50 = 36nM). Also a positive allosteric modulator of mGlu4 and weak anatagonist of nMDA receptors. Biologically active admitted systematically. Widely used in assessing the functional roles of mGlu5 receptors in a variety of research areas, such as learning and memory, sleep, neuroprotection, depression, addiction, anxiety and stress related disorders, analgesia, locomotion, neural plasticity, and Parkinson's disease. Group: Biochemicals. Grades: Highly Purified. CAS No. 96206-92-7. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| MPGΔNLS, HIV related | It is a 27-residue peptide derived from the hydrophobic fusion peptide of HIV-1 gp41 (for efficient crossing of the cell membrane) and the hydrophilic nuclear localization sequence of SV40 large T antigen (for the nuclear addressing of the peptide). It contains a single mutation in which the second lysine in NLS has mutated to serine. Synonyms: H-Gly-Ala-Leu-Phe-Leu-Gly-Phe-Leu-Gly-Ala-Ala-Gly-Ser-Thr-Met-Gly-Ala-Trp-Ser-Gln-Pro-Lys-Ser-Lys-Arg-Lys-Val-OH. Grade: 97%. Molecular formula: C126H201N35O33S. Mole weight: 2766.27. |  |
| MPG, HIV related | MPG, a 27-AA peptide derived from the nucleotide localization sequence of SV40 large T antigen and the fusion peptide domain of HIV-1 gp41, is an effective nucleic acid and oligonucleotide carrier for wide delivery into cultured cells. Synonyms: Gly-Ala-Leu-Phe-Leu-Gly-Phe-Leu-Gly-Ala-Ala-Gly-Ser-Thr-Met-Gly-Ala-Trp-Ser-Gln-Pro-Lys-Ser-Lys-Arg-Lys-Val; L-Valine, glycyl-L-alanyl-L-leucyl-L-phenylalanyl-L-leucylglycyl-L-phenylalanyl-L-leucylglycyl-L-alanyl-L-alanylglycyl-L-seryl-L-threonyl-L-methionylglycyl-L-alanyl-L-tryptophyl-L-seryl-L-glutaminyl-L-prolyl-L-lysyl-L-seryl-L-lysyl-L-arginyl-L-lysyl-. Grade: ≥95%. CAS No. 395069-92-8. Molecular formula: C126H201N35O33S. Mole weight: 2766.22. | |
| MPH | MPH. Pack Sizes: Milligram Quantities: 50 mg. Order Number: CL230. |  www.prochemonline.com |
| MPH-220 | MPH-220 is a selective and orally active inhibitor of skeletal muscle myosin-2. MPH-220 enables muscle relaxation. MPH-220 is anti-spastic agent that can be used in the research of spasticity and muscle stiffness[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2649776-79-2. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-148516. | |
| m-Phenoxytoluene | m-Phenoxytoluene. Group: Biochemicals. Alternative Names: 1-Methyl-3-phenoxybenzene; 3-Methyldiphenyl ether; 3-Methylphenyl Phenyl Ether; 3-Phenoxytoluene; Phenyl m-Tolyl Ether; m-Methylphenyl Phenyl Ether. Grades: Highly Purified. CAS No. 3586-14-9. Pack Sizes: 10g. Molecular Formula: C13H12O, Molecular Weight: 184.23. US Biological Life Sciences. | Worldwide |
| m-Phenylenediamine | 1,3-phenylenediamine appears as colorless or white colored needles that turn red or purple in air. Melting point 64-66 C. Density 1.14 g / cm³. Flash point 280 F. May irritate skin and eyes. Toxic by skin absorption, inhalation or ingestion. Used in aramid fiber manufacture, as a polymer additive, dye manufacturing, as a laboratory reagent, and in photography.;DryPowder; OtherSolid; PelletsLargeCrystals, Liquid;WHITE CRYSTALS. TURNS RED ON EXPOSURE TO AIR.;Colorless or white colored needles that turn red or purple in air. CAS No. 108-45-2. Molecular formula: C6H8N2;C6H4(NH2)2;C6H8N2. Mole weight: 108.14g/mol. IUPAC Name: benzene-1,3-diamine. SMILES: C1=CC(=CC(=C1)N)N. InChI: InChI=1S/C6H8N2/c7-5-2-1-3-6(8)4-5/h1-4H,7-8H2. |  |
| m-Phenylenediamine | 1,3-phenylenediamine appears as colorless or white colored needles that turn red or purple in air. Melting point 64-66 C. Density 1.14 g / cm³. Flash point 280 F. May irritate skin and eyes. Toxic by skin absorption, inhalation or ingestion. Used in aramid fiber manufacture, as a polymer additive, dye manufacturing, as a laboratory reagent, and in photography.;DryPowder; OtherSolid; PelletsLargeCrystals, Liquid;WHITE CRYSTALS. TURNS RED ON EXPOSURE TO AIR.;Colorless or white colored needles that turn red or purple in air. Molecular formula: C6H8N2;C6H4(NH2)2;C6H8N2. Mole weight: 108.14g/mol. IUPAC Name: benzene-1,3-diamine. SMILES: C1=CC(=CC(=C1)N)N. InChI: InChI=1S/C6H8N2/c7-5-2-1-3-6(8)4-5/h1-4H,7-8H2. | |
| m-Phenylenediamine | m-Phenylenediamine. Group: Biochemicals. Alternative Names: 1,3-Diaminobenzene. Grades: Highly Purified. CAS No. 108-45-2. Pack Sizes: 5kg. US Biological Life Sciences. | Worldwide |
| m-Phenylenediamine | 1kg Pack Size. Group: Amines, Building Blocks, Organics. Formula: C6H8N2. CAS No. 108-45-2. Prepack ID 13219509-1kg. Molecular Weight 108.14. See USA prepack pricing. |  |
| M-PHENYLENEDIAMINE | M-PHENYLENEDIAMINE. Tyger suppliers of organic specialty chemicals & custom chemical synthesis. |  |
| m-Phenylenediamine 99+.9% | m-Phenylenediamine 99+.9%. Group: Biochemicals. Grades: Reagent Grade. CAS No. 108-45-2. Pack Sizes: 25Kg, 100Kg. US Biological Life Sciences. | Worldwide |
| M-Phisyl-chloride | M-Phisyl-chloride. Alternative Names: 2-Methoxy-5-(N-phthalimidinyl)benzenesulfonylchloride. CAS No. 126565-42-2. Purity: 97%+. Product ID: ACM126565422-2. Molecular formula: C15H12ClNO4S. Mole weight: 337.78. IUPAC Name: 2-methoxy-5-(3-oxo-1H-isoindol-2-yl)benzenesulfonylchloride. Alfa Chemistry - ISO 9001:32057 Certified. |  |
| MPI-0479605 | MPI-0479605 is a potent and selective ATP-competitive inhibitor of Mps1, with an IC50 of 1.8 nM. Uses: Scientific research. Category: Signaling pathways. CAS No. 1246529-32-7. Pack Sizes: 10 mM * 1 mL in DMSO; 2 mg; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-12660. | |
| MPLA (Synthetic) Sterile Solution (Monophosphoryl Lipid A, Phosphorylated Hexaacyl Disaccharide, Glycopyranoside Lipid A, Glucopyranosyl Lipid Adjuvant, GLA) | Toll-like receptor 4 (TLR4) activator. Activates TLR4 but does not activate TLR2 even at high concentrations. Defined structure of MPLA. Synthetic lipid A is structurally very similar to natural MPLA but does not exist in nature. Group: Biochemicals. Grades: Cell Culture Grade. CAS No. 1246298-63-4. Pack Sizes: 100ug. US Biological Life Sciences. | Worldwide |
| Mp_mastoparan MP | Mp_mastoparan MP was found in Venom, wasps, Mischocyttarusphthisicus. Mp_mastoparan MP has antimicrobial activity. | |
| MPP+-d3iodide | MPP+-d3 (iodide) is deuterium labeled MPP+ (iodide). MPP+ iodide, a toxic metabolite of the neurotoxin MPTP, causes symptom of Parkinson's disease in animal models by selectively destroying dopaminergic neurons in substantia nigra. MPP+ iodide is taken up by the dopamine transporter into dopaminergic neurons where it exerts its neurotoxic action on mitochondria by affecting complex I of the respiratory chain. MPP+ iodide is also a high affinity substrate for the serotonin transporter (SERT)[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 207556-07-8. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-W008719S. | |
| MPP dihydrochloride | MPP dihydrochloride is a potent and selective ER (estrogen receptor) modulator. MPP dihydrochloride induces significant apoptosis in the endometrial cancer and oLE cell lines. MPP dihydrochloride reverses the positive effects of beta-estradiol. MPP dihydrochloride has mixed agonist/antagonist action on murine uterine ERalpha in vivo[1][2][3]. Uses: Scientific research. Category: Signaling pathways. CAS No. 911295-24-4. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-103454. | |
| MPPG | MPPG. Group: Biochemicals. Grades: Purified. CAS No. 169209-65-8. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| MPP hydrochloride | MPP hydrochloride is a potent and selective ER (estrogen receptor) modulator. MPP hydrochloride induces significant apoptosis in the endometrial cancer and oLE cell lines. MPP hydrochloride reverses the the positive effects of beta-estradiol. MPP hydrochloride has mixed agonist/antagonist action on murine uterine ERalpha in vivo[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2863676-89-3. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-103454B. | |
| MPP+ iodide | MPP+ iodide, a toxic metabolite of the neurotoxin MPTP, causes symptom of Parkinson's disease in animal models by selectively destroying dopaminergic neurons in substantia nigra. MPP+ iodide is taken up by the dopamine transporter into dopaminergic neurons where it exerts its neurotoxic action on mitochondria by affecting complex I of the respiratory chain. MPP+ iodide is also a high affinity substrate for the serotonin transporter (SERT)[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 36913-39-0. Pack Sizes: 10 mM * 1 mL in DMSO; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-W008719. | |
| Mpr-JR11 | Mpr-JR11. Synonyms: Mpr-Cpa-(D-Cys)-[Aph(Hor)]-[D-Aph(Cbm)]-Lys-Thr-Cys-(D-Tyr)-NH2 [Disulfide bond Cys2/Cys7]; Mpr-Cpa-D-Cys-Aph(Hor)-D-Aph(Cbm)-Lys-Thr-Cys-D-Tyr-NH2 [Disulfide bond Cys2/Cys7]. Mole weight: 1391.96. | |
| MPS | MPS. CAS No. 55750-62-4. Pack Sizes: Milligram Quantities: 100 mg. Order Number: CL228. | www.prochemonline.com |
| Mps1-IN-1 | Mps1-IN-1 is a potent, selective and ATP-competitive Mps1 kinase inhibitor, with an IC50 and a Kd of 367 nM and 27 nM[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1125593-20-5. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-13298. | |
| Mps1-IN-1 dihydrochloride | Mps1-IN-1 dihydrochloride. Group: Biochemicals. Grades: Purified. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| Mps1-IN-3 | Mps1-IN-3 is a potent and selective MPS1 kinase inhibitor, with an IC50 of 50 nM. Uses: Scientific research. Category: Signaling pathways. CAS No. 1609584-72-6. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-12401. | |
| MPS1 Inhibitor, NMS-P715 ( (N- (2, 6-diethylphenyl) -1-methyl-8- ({4-[ (1-methylpiperidin-4-yl) carbamoyl]-2- (trifluoromethoxy) phenyl}amino) -4, 5-dihydro-1H-pyrazolo[4, 3-h]quinazoline-3-carboxamide) ) | An orally bioavailable, ATP-competitive, pyrazolo-quinazoline, MPS1 inhibitor (IC50=182nM, Ki=0.99nM) that is shown to act in a reversible and time-dependent manner. It demonstrates selectivity for MPS1 against a panel of 60 kinases, displaying activity against only three kinases, CK2, MELK, and NEK6 (<10uM), but not against other mitotic kinases including PLK1, CDK1, Aurora A, Aurora B, or the SAC kinase BUB1, in an in vitro kinase assay. It promotes massive SAC (spindle assembly checkpoint) override (EC50=65nM) in nocodazole-arrested U20S cells and elicits a reduction in the G1 and G2/M phase of the cell cycle in A2780 ovarian cancer cells, similar to RNAi-mediated MPS1 silencing. In addition, it is shown to inactivate SAC, delocalize kinetochore components, and inhibit the proliferation of select cancer cell lines (IC50 ~1uM), without marked activity among a panel of 127 normal cell lines. Also, it inhibits A2780 tumor xenograft growth in mice (90mg/kg/day, o.s., in vivo) by 53% wit Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 5mg. US Biological Life Sciences. | Worldwide |
| MPS-Gαi3 | It is a cell penetrating peptide. Synonyms: H-Ala-Ala-Val-Ala-Leu-Leu-Pro-Ala-Val-Leu-Leu-Ala-Leu-Leu-Ala-Lys-Asn-Asn-Leu-Lys-Glu-Cys-Gly-Leu-Tyr-OH. Grade: >95%. Molecular formula: C120H205N29O31S. Mole weight: 2582.19. | |
| MPT0G211 | MPT0G211 is a potent, orally active and selective HDAC6 inhibitor (IC50=0.291 nM). MPT0G211 displays >1000-fold selective for HDAC6 over other HDAC isoforms. MPT0G211 can penetrate the blood-brain barrier. MPT0G211 ameliorates tau phosphorylation and cognitive deficits in an Alzheimers disease model. MPT0G211 has anti-metastatic and neuroprotective effects. Anticancer activities[1][2][3]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2151853-97-1. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-123976. | |
| MPTP | MPTP (1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine) is a brain penetrant dopamine neurotoxin. MPTP can be used to induce Parkinsons Disease model. MPTP, a precusor of MPP+, induces apoptosis[1][2][3]. Uses: Scientific research. Category: Signaling pathways. CAS No. 28289-54-5. Pack Sizes: 10 mM * 1 mL in DMSO; 50 mg; 100 mg; 250 mg; 500 mg; 1 g. Product ID: HY-W114750. | |
| MPTP hydrochloride | MPTP hydrochloride is a brain penetrant dopaminergic neurotoxin. MPTP hydrochloride can be used to induce Parkinsons Disease model. MPTP hydrochloride, a precusor of MPP+, induces apoptosis[1][2][3]. MPTP hydrochloride has been verified by MCE with professional biological experiments. Uses: Scientific research. Category: Induced disease models products. CAS No. 23007-85-4. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 200 mg; 500 mg; 1 g. Product ID: HY-15608. | |
| MPTP hydrochloride | MPTP hydrochloride Inhibitor. Uses: Scientific use. Product Category: T4081. CAS No. 23007-85-4. |  |
| MPTP Hydrochloride | MPTP hydrochloride is a dopaminergic neurotoxin and cause selective destruction of dopaminergic neurons in animal models of parkinsonism. MPTP hydrochloride induces apoptosis.MPTP hydrochloride can be used to induce animal models of Parkinsons disease. Group: Inhibitors. CAS No. 23007-85-4. Pack Sizes: 20mg. Product ID: S4732. Formula: C12H15N·HCl. Smiles: CN1CCC(=CC1)C2=CC=CC=C2.Cl. Storage Conditions: 2 years -80 in solvent. |  United States; Europe |
| MPTP Hydrochloride (Dopaminergic Neurotoxin, MPTP) | A neurotoxin that is a precusor of MPP+ which is toxic to dopaminergic neurons and causes Parkinsonism. Widely used in research to induce Parkinson's disease models in primates. Group: Biochemicals. Grades: Highly Purified. CAS No. 23007-85-4. Pack Sizes: 10mg. Molecular Formula: C??H??N·HCl. US Biological Life Sciences. | Worldwide |
| mPTP-IN-1 | mPTP-IN-1 (Compound 14e) is a mitochondrial permeability transition pore (mPTP) inhibitor. mPTP-IN-1 blocks calcium-induced mPTP opening by targeting the C subunit of ATP synthase. mPTP-IN-1 can be used to study myocardial ischemia/reperfusion injury (IRI)[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 554414-59-4. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-172959. | |
| MP-VB1 | MP-VB1 showed strong antimicrobial activities against bacteria and fungi and induced mast cell degranulation, but displayed almost no hemolytic activity towards human blood red cells. | |
| MPX-007 | MPX-007 is a GluN2A antagonist (IC50: 27 nM). MPX-007 is a tools to probe GluN2A physiology, and to study neuropsychiatric and developmental disorders[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1688685-29-1. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg. Product ID: HY-116483. | |
| MQAE | MQAE is a chloride ion (Cl-) fluorescent probe that can be used to measure chloride concentrations. The fluorescence intensity of MQAE decreases proportionally as Cl- ions increase. MQAE has high cell permeability and is suitable for fluorescence detection such as confocal microscopy and flow cytometry (Ex/Em=350/460 nm)[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 162558-52-3. Pack Sizes: 50 mg; 100 mg; 200 mg; 500 mg. Product ID: HY-D0090. | |
| MQRGNFRNQRKIVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQAN | It is an HIV retrovirus NC peptide with superior cell membrane penetration activity. Synonyms: HIV-NC peptide SEQ ID NO: 12. | |
| m-Quaterphenyl | White powder. Synonym: 3,3'-Diphenylbiphenyl. CAS No. 1166-18-3. Pack Sizes: Typically in stock: 0.1g, 1g. Mole weight: 306.41. MP/BP: M.P. 82.5-84. Order No: FR-2035. |  Frinton Laboratories |
| MR10 | MR10. | |
| Mr 16728 hydrochloride | Mr 16728 hydrochloride. Alternative Names: MR 16728 HYDROCHLORIDE;N-[3-(1-HEXAHYDROAZAPINYL)PROPYL]-ALPHA-CYCLOHEXYL-BENZENEACETAMIDE HYDROCHLORIDE;MR16728HCl;N-[3-(1-Hexahydroazapinyl)propyl]-a-cyclohexyl-benzeneacetamidehydrochloride;MR 16728. CAS No. 147614-21-9. Purity: 96%. Product ID: ACM147614219. Molecular formula: C23H36N2O.HCl. Mole weight: 393.01. IUPAC Name: N-[3-(azepan-1-yl)propyl]-2-cyclohexyl-2-phenylacetamide. Alfa Chemistry - ISO 9001:32057 Certified. | |
| MR 16728 hydrochloride | MR 16728 hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 207403-36-9. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| MR-2088 | MR-2088 is a reversible, ATP-competitive, and selective ULK1/2 inhibitor with pEC50 values of 8.3 and 8.7 respectively. MR-2088 effectively inhibits autophagic flux and demonstrates a synergistic antiproliferative effect with Trametinib (HY-10999) (MEK inhibitor) in vitro. MR-2088 can be used for non-small lung cell cancer (NSCLC) research[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2922531-69-7. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg. Product ID: HY-162100. | |
| MR304A | MR304A is extracted from Trichoderma harzianum. It can inhibit the formation of melanin by Mushroom tyrosinase, Streptomyces bikiniensis and B16 melanoma cells, with IC50 (μg/L) of 7.5, 2.5 and 1.0, respectively. Synonyms: MR-304A; MR 304A. Molecular formula: C8H11NO4. Mole weight: 185.18. | |
| MR-387-A | MR-387-A is an AP-N inhibitor produced by the strain of Streptomyces neyagawaensis SL-387. It is used to inhibit AP-N activity in cells derived from porcine kidney microsomes, human fibrosarcoma HT-1080 and human myeloid leukemia K562. Molecular formula: C25H36N4O7. Mole weight: 504.57. | |
| MR-387-B | MR-387-B is an AP-N inhibitor produced by the strain of Streptomyces neyagawaensis SL-387. It is used to inhibit AP-N activity in cells derived from porcine kidney microsomes, human fibrosarcoma HT-1080 and human myeloid leukemia K562. Molecular formula: C25H36N4O6. Mole weight: 488.58. | |
| MR 409 | MR 409 is a selected growth hormone-releasing hormone (GHRH) agonist. MR 409 has remarkable neuroprotective effects through enhancing endogenous neurogenesis in cerebral ischemic mice. MR 409 also inhibits the in vivo growth of lung cancer[1][2][3][4]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1445155-39-4. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P3304. | |
| MR-566A | It is produced by the strain of Trichoderma harzianus KCTC 0114BP. MR-566A inhibited mushroom enzyminase and melanin biosynthesis in B16 melanoma cells with IC50 (μmol/L) of 1.72 and 0.1, respectively. Synonyms: SCHEMBL20203773. Molecular formula: C8H10ClNO3. Mole weight: 203.62. | |
| MR-566B | It is produced by the strain of Trichoderma harzianus KCTC 0114BP. MR-566B inhibited mushroom enzyminase and melanin biosynthesis in B16 melanoma cells with IC50 (μmol/L) of 47 and 2.2, respectively. Synonyms: SCHEMBL20203767. Molecular formula: C8H11NO4. Mole weight: 185.18. | |
| MR837 | MR837 is an inhibitor of NSD2-PWWP1. MR837 can bind with human nuclear receptor binding SET domain protein 2 (PWWP domain)[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1210906-48-1. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-138283. | |
| Mram 8 | Mram 8 is isolated from Viola philippica which is a plant from the Violaceae family. | |
| MRE 0094 | MRE 0094 (Sonedenoson) is a selective activator for adenosine receptor A2A, with a Ki of 490 nM. MRE 0094 exhibits anti-platelet and anti-inflammatory activities[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Sonedenoson. CAS No. 131865-88-8. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-14851. | |
| MRE-269 | MRE-269 is an active metabolite of selexipag, and acts as a selective IP receptor agonist. Uses: Scientific research. Category: Signaling pathways. Alternative Names: ACT-333679. CAS No. 475085-57-5. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-79593. | |
| MRE 3008F20 | MRE 3008F20. Group: Biochemicals. Grades: Purified. CAS No. 252979-43-4. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| MreB Perturbing Compound A22 hydrochloride | MreB Perturbing Compound A22 hydrochloride (A22 hydrochloride) is a reversible MreB inhibitor and antimicrobial agent that exhibits bacteriostatic activity against Escherichia coli, with low activity against Gram-positive bacteria. MreB Perturbing Compound A22 hydrochloride rapidly and reversally delocalizes MreB from the helical/circular structures in cells, impairs MreB function, and reduces the binding of MreB to the chromosomal region proximal to the replication origin. MreB Perturbing Compound A22 hydrochloride alters the cell morphology of caulobacters to round/lemon-shaped, slows caulobacter growth, blocks their cell division, and induces the formation of spherical morphology, asymmetric division, and anucleate cells in Escherichia coli. MreB Perturbing Compound A22 hydrochloride is used for studies related to bacterial rod-shaped morphology determination, chromosome segregation, and cell division mechanisms[1][2]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: A22 hydrochloride. CAS No. 22816-60-0. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg. Product ID: HY-118773. | |
| MRGPRX1 agonist 1 | MRGPRX1 agonist 1 is a highly potent MRGPRX1 agonist (EC50=50 nM) with greater than 50-fold selectivity for δ, μ, and κ opioid receptors. MRGPRX1 agonist 1 is inactive against MRGPRC11. MRGPRC11 inhibits high voltage-activated (HVA) Ca2+ currents, reduces neurotransmitter release, and mitigates nociceptive transmission in the spinal cord. MRGPRX1 agonist 1 is useful for the study of chronic pain, especially neuropathic pain[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2377379-39-8. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-130118. | |
| MrgprX2 antagonist-1 | MrgprX2 antagonist-1 is an MrgprX2 antagonist extracted from patent WO2021092264A1, example E23. MrgprX2 antagonist-1 can be used for the research of inflammatory disorders of the skin[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2642162-06-7. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-145191. | |
| MrgprX2 antagonist-2 | MrgprX2 antagonist-2 is an MrgprX2 antagonist extracted from patent WO2021092262A1, example E163. MrgprX2 antagonist-2 can be used for the research of inflammatory disorders of the skin[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2642346-30-1. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-145192. | |
| MrgprX2 antagonist-3 | MrgprX2 antagonist-3 is an MrgprX2 antagonist extracted from patent WO2021092240A1, example E117. MrgprX2 antagonist-3 can be used for the research of inflammatory disorders of the skin[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2642174-19-2. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-145193. | |
| MrgprX2 antagonist-4 | MrgprX2 antagonist-4 is an MrgprX2 antagonist extracted from patent US20210128561A1, compound B-51 E117. MrgprX2 antagonist-4 can be used for the research of inflammatory disorders of the skin[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2641398-04-9. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-145194. | |
| MrgprX2 antagonist-5 | MrgprX2 antagonist-5 is an MrgprX2 antagonist extracted from patent WO2020223255A1, example 16. MrgprX2 antagonist-5 can be used for the research of inflammatory disorders of the skin[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2527815-74-1. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-145195. | |
| MrgprX2 antagonist-8 | MrgprX2 antagonist-8 (example 5b) is a MrgprX2 antagonist. MrgprX2 antagonist-8 can be used for the research of inflammatory disorders[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2768216-96-0. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-146220. | |
| MrgprX2 antagonist-9 | MrgprX2 antagonist-9 is an MRGPRX2 antagonist with an IC50 of 0.1-100 nM. MrgprX2 antagonist-9 can be used for the research of inflammatory diseases[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 3095296-92-4. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-178793. | |
| MRGPRX4 modulator-1 | MRGPRX4 modulator-1 (compound 31-2) is a potent mas-related g-protein receptor X4 (MRGPR X4) modulator, with antagonist activity of IC50 < 100 nM for MRGPR4. MRGPRX4 modulator-1 can be used for researching MRGPR X4 dependent diseases such as itch, pain, and autoimmune disorders[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2492596-61-7. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg. Product ID: HY-145997. | |
Our database is helping our users find suppliers everyday.
