American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
protein geranylgeranyltransferase type I This enzyme, along with protein farnesyltransferase (EC 2.5.1.58) and protein geranylgeranyltransferase type II (EC 2.5.1.60), constitutes the protein prenyltransferase family of enzymes. Catalyses the formation of a thioether linkage between the C-1 atom of the geranylgeranyl group and a cysteine residue fourth from the C-terminus of the protein. These protein acceptors have the C-terminal sequence CA1A2X, where the terminal residue, X, is preferably leucine; serine, methionine, alanine or glutamine makes the protein a substrate for EC 2.5.1.58. The enzymes are relaxed in specificity for A1, but cannot act if A2 is aromatic. Known targets of this enzyme include most γ-subunits of heterotrimeric G proteins and Ras-related GTPases such as members of the Ras and Rac/Rho families. A zinc metalloenzyme. The Zn2+ is required for peptide, but not for isoprenoid, substrate binding. Group: Enzymes. Synonyms: GGTase-I; GGTaseI. Enzyme Commission Number: EC 2.5.1.59. CAS No. 135371-29-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2796; protein geranylgeranyltransferase type I; EC 2.5.1.59; 135371-29-8; GGTase-I; GGTaseI. Cat No: EXWM-2796. Creative Enzymes
protein geranylgeranyltransferase type II This enzyme, along with protein farnesyltransferase (EC 2.5.1.58) and protein geranylgeranyltransferase type I (EC 2.5.1.59), constitutes the protein prenyltransferase family of enzymes. Attaches geranylgeranyl groups to two C-terminal cysteines in Ras-related GTPases of a single family, the Rab family (Ypt/Sec4 in lower eukaryotes) that terminate in XXCC, XCXC and CCXX motifs. Reaction is entirely dependent on the Rab substrate being bound to Rab escort protein (REP). Post-translational modification with the geranylgeranyl moiety is essential for Rab GTPases to be able to control the processes of membrane docking and fusion. Group: Enzymes. Synonyms: GGTaseII; Rab geranylgeranyltransferase; RabGGTase; geranylgeranyl-diphosphate,geranylgeranyl-diphosphate:protein-cysteine geranyltransferase. Enzyme Commission Number: EC 2.5.1.60. CAS No. 135371-29-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2798; protein geranylgeranyltransferase type II; EC 2.5.1.60; 135371-29-8; GGTaseII; Rab geranylgeranyltransferase; RabGGTase; geranylgeranyl-diphosphate,geranylgeranyl-diphosphate:protein-cysteine geranyltransferase. Cat No: EXWM-2798. Creative Enzymes
protein-glucosylgalactosylhydroxylysine glucosidase Requires free, positively charged ε-amino group of hydroxylysine. Group: Enzymes. Synonyms: 2-O-α-D-glucopyranosyl-5-O-α-D-galactopyranosylhydroxy-L-lysine glucohydrolase; protein-α-D-glucosyl-1,2-β-D-galactosyl-L-hydroxylysine glucohydrolase. Enzyme Commission Number: EC 3.2.1.107. CAS No. 72829-45-9. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3790; protein-glucosylgalactosylhydroxylysine glucosidase; EC 3.2.1.107; 72829-45-9; 2-O-α-D-glucopyranosyl-5-O-α-D-galactopyranosylhydroxy-L-lysine glucohydrolase; protein-α-D-glucosyl-1,2-β-D-galactosyl-L-hydroxylysine glucohydrolase. Cat No: EXWM-3790. Creative Enzymes
protein-glutamate methylesterase Hydrolyses the products of EC 2.1.1.77 (protein-L-isoaspartate(D-aspartate) O-methyltransferase), EC 2.1.1.78 (isoorientin 3'-O-methyltransferase), EC 2.1.1.80 (protein-glutamate O-methyltransferase) and EC 2.1.1.100 (protein-S-isoprenylcysteine O-methyltransferase). Group: Enzymes. Synonyms: chemotaxis-specific methylesterase; methyl-accepting chemotaxis protein methyl-esterase; CheB methylesterase; methylesterase CheB; protein methyl-esterase; protein carboxyl methylesterase; PME; protein methylesterase; protein-L-glutamate-5-O-methyl-ester acylhydrolase. Enzyme Commission Number: EC 3.1.1.61. CAS No. 69552-31-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3490; protein-glutamate methylesterase; EC 3.1.1.61; 69552-31-4; chemotaxis-specific methylesterase; methyl-accepting chemotaxis protein methyl-esterase; CheB methylesterase; methylesterase CheB; protein methyl-esterase; protein carboxyl methylesterase; PME; protein methylesterase; protein-L-glutamate-5-O-methyl-ester acylhydrolase. Cat No: EXWM-3490. Creative Enzymes
protein-glutamate O-methyltransferase Forms ester groups with L-glutamate residues in a number of membrane proteins. Group: Enzymes. Synonyms: methyl-accepting chemotaxis protein O-methyltransferase; S-adenosylmethionine-glutamyl methyltransferase; methyl-accepting chemotaxis protein methyltransferase II; S-adenosylmethionine:protein-carboxyl O-methyltransferase; protein methylase II; MCP methyltransferase I; MCP methyltransferase II; protein O-methyltransferase; protein(aspartate)methyltransferase; protein(carboxyl)methylt. Enzyme Commission Number: EC 2.1.1.80. CAS No. 9055-9-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1982; protein-glutamate O-methyltransferase; EC 2.1.1.80; 9055-09-8; methyl-accepting chemotaxis protein O-methyltransferase; S-adenosylmethionine-glutamyl methyltransferase; methyl-accepting chemotaxis protein methyltransferase II; S-adenosylmethionine:protein-carboxyl O-methyltransferase; protein methylase II; MCP methyltransferase I; MCP methyltransferase II; protein O-methyltransferase; protein(aspartate)methyltransferase; protein(carboxyl)methyltransferase; protein carboxyl-methylase; protein carboxyl-O-methyltransferase; protein carboxylmethyltransferase II; protein carboxymethylase; protein carboxymethyltransferase; protein methyltransferase II. Cat No: EXWM-1982. Creative Enzymes
protein-glutamine γ-glutamyltransferase Requires Ca2+. The γ-carboxamide groups of peptide-bound glutamine residues act as acyl donors, and the 6-amino-groups of protein- and peptide-bound lysine residues act as acceptors, to give intra- and inter-molecular N6-(5-glutamyl)-lysine crosslinks. Formed by proteolytic cleavage from plasma Factor XIII. Group: Enzymes. Synonyms: transglutaminase; Factor XIIIa; fibrinoligase; fibrin stabilizing factor; glutaminylpeptide γ-glutamyltransferase; polyamine transglutaminase; tissue transglutaminase; R-glutaminyl-peptide:amine γ-glutamyl transferase. Enzyme Commission Number: EC 2.3.2.13. CAS No. 80146-85-6. Transglutaminase. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2286; protein-glutamine γ-glutamyltransferase; EC 2.3.2.13; 80146-85-6; transglutaminase; Factor XIIIa; fibrinoligase; fibrin stabilizing factor; glutaminylpeptide γ-glutamyltransferase; polyamine transglutaminase; tissue transglutaminase; R-glutaminyl-peptide:amine γ-glutamyl transferase. Cat No: EXWM-2286. Creative Enzymes
protein-glutamine glutaminase Specific for the hydrolysis of the γ-amide of glutamine substituted at the carboxyl position or both the α-amino and carboxyl positions, e.g., L-glutaminylglycine and L-phenylalanyl-L-glutaminylglycine. Group: Enzymes. Synonyms: peptidoglutaminase II; glutaminyl-peptide glutaminase; destabilase; peptidylglutaminase II. Enzyme Commission Number: EC 3.5.1.44. CAS No. 62213-11-0. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4433; protein-glutamine glutaminase; EC 3.5.1.44; 62213-11-0; peptidoglutaminase II; glutaminyl-peptide glutaminase; destabilase; peptidylglutaminase II. Cat No: EXWM-4433. Creative Enzymes
Protein G Magnetic Nanoparticles The surface of the supperparamagnetic Fe3O4 nanoparticles is covalently functionalized with Protein G, and can be used to bind IgG antibodies to the particle surface. Uses: Protein g coupled magnetic nanoparticles can be used in the industry of immunoprecipitation, antibody purification. Group: Nanospheres. Alfa Chemistry Materials 3
Protein G?Peroxidase from Streptococcus sp. recombinant, expressed in unspecified host, lyophilized powder. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein G recombinant from Escherichia coli, ?90%. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
protein-histidine N-methyltransferase Highly specific for histidine residues, for example, in actin. Group: Enzymes. Synonyms: protein methylase IV; protein (histidine) methyltransferase; actin-specific histidine methyltransferase; S-adenosyl methionine:protein-histidine N-methyltransferase. Enzyme Commission Number: EC 2.1.1.85. CAS No. 108022-17-9. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1986; protein-histidine N-methyltransferase; EC 2.1.1.85; 108022-17-9; protein methylase IV; protein (histidine) methyltransferase; actin-specific histidine methyltransferase; S-adenosyl methionine:protein-histidine N-methyltransferase. Cat No: EXWM-1986. Creative Enzymes
protein-histidine pros-kinase A number of histones can act as acceptor. Group: Enzymes. Synonyms: ATP:protein-L-histidine N-pros-phosphotransferase; histidine kinase (ambiguous); histidine protein kinase (ambiguous); protein histidine kinase (ambiguous); protein kinase (histidine) (ambiguous); HK2. Enzyme Commission Number: EC 2.7.13.1. CAS No. 99283-67-7. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3163; protein-histidine pros-kinase; EC 2.7.13.1; 99283-67-7; ATP:protein-L-histidine N-pros-phosphotransferase; histidine kinase (ambiguous); histidine protein kinase (ambiguous); protein histidine kinase (ambiguous); protein kinase (histidine) (ambiguous); HK2. Cat No: EXWM-3163. Creative Enzymes
protein-histidine tele-kinase A number of histones can act as acceptor. Group: Enzymes. Synonyms: ATP:protein-L-histidine N-tele-phosphotransferase; histidine kinase (ambiguous); histidine protein kinase (ambiguous); protein histidine kinase (ambiguous); protein kinase (histidine) (ambiguous); HK3. Enzyme Commission Number: EC 2.7.13.2. CAS No. 99283-67-7. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3164; protein-histidine tele-kinase; EC 2.7.13.2; 99283-67-7; ATP:protein-L-histidine N-tele-phosphotransferase; histidine kinase (ambiguous); histidine protein kinase (ambiguous); protein histidine kinase (ambiguous); protein kinase (histidine) (ambiguous); HK3. Cat No: EXWM-3164. Creative Enzymes
Protein Kinase A Catalytic Subunit ?, Active human recombinant, expressed in baculovirus infected Sf9 cells, ?80% (SDS-PAGE), buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase A Catalytic Subunit β, Active human, Recombinant cAMP-dependent protein kinase catalytic subunit beta is an enzyme that in humans is encoded by the PRKACB gene. cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the protein kinase A (PKA), which transduces the signal through phosphorylation of different target proteins. The inactive holoenzyme of PKA is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits of PKA have.e crebtide substrate peptide per minute per mg protein at 30°c using a final concentration of 50 μm [32p] atp. Group: Enzymes. Synonyms: PKA Catalytic Subunit β, Active human; PKA-Cβ; cAMP-dependent protein kinase; PKACB; PRKACB; PKA C-beta; Protein Kinase A Catalytic Subunit &beta. Purity: > 85% (SDS-PAGE). PKAC. Mole weight: protein apparent mol wt ~65 kDa. Stability: -70°C. Form: buffered aqueous glycerol solution. Source: baculovirus infected Sf9 cells. Species: Human. PKA Catalytic Subunit β, Active human; PKA-Cβ; cAMP-dependent protein kinase; PKACB; PRKACB; PKA C-beta; Protein Kinase A Catalytic Subunit &beta. Cat No: NATE-0572. Creative Enzymes
Protein Kinase A Catalytic Subunit from bovine heart ?9 units/?g protein (cyclic-AMP is not required for this activity), lyophilized (white powder to sticky mass to hard pellet). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase A Catalytic Subunit from Bovine, Recombinant Protein Kinase A (PKA) catalyzes the transfer of the terminal phosphate of ATP to threonine or serine residues in a variety of protein substrates. The enzyme is composed of two subunit types: a catalytic subunit and a regulatory subunit. In the absence of cAMP, the two subunits are bound to each other and no catalysis can take place. In the presence of cAMP, the regulatory subunit binds cAMP, thus releasing the catalytic subunit. In the presence of cAMP, the catalytic subunit exists as a monomer of 40,862 Da (amino acid sequence), but on SDS-PAGE the apparent molecular mass is 43,000 Da. Group: Enzymes. Synonyms: PKA; cAMP-dependent protein kinase; ATP:protein phosphotransferase (cAMP-dependent); Protein K. Enzyme Commission Number: EC 2.7.11.11. Activity: >9 units/μg protein. Storage: Store at -20°C. Form: Lyophilized from a solution containing approximately: 80% sucrose, 19% potassium phosphate buffer, pH 6.7, 0.0625% 2-mercaptoethanol(2-ME), 0.002% EDTA, 0.016% dithiothreitol (DTT), and ≤1% protein. The lyophilized product may contain traces of DTT or 2-ME. Source: Bovine Heart. Species: Bovine. PKA; cAMP-dependent protein kinase; ATP:protein phosphotransferase (cAMP-dependent); Protein Kinase A catalytic subunit; Protein kinase A; PKAC; cAMP-dependent protein kinase catalytic subunit; PRKAC. Cat No: NATE-1889. Creative Enzymes
Protein Kinase A catalytic subunit human >90% (SDS-PAGE), recombinant, expressed in E. coli, buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase A catalytic subunit human, Recombinant Ubiquitous serine-threonine kinase that phosphorylates a broad spectrum of substrates, and regulates many cellular processes. The catalytic subunit is released following binding of cyclic AMP to the regulatory subunits of the PKA holoenzyme. The free catalytic subunit has intrinsic activity and does not require added cyclic AMP. >90% (sds-page), recombinant, expressed in e. coli, buffered aqueous glycerol solution. Group: Enzymes. Synonyms: Protein Kinase A catalytic subunit; Protein kinase A; PKA; PKAC; cAMP-dependent protein kinase catalytic subunit; PRKAC. Purity: >90% (SDS-PAGE). PKAC. Mole weight: mol wt 43.5 kDa. Activity: >1000 units/mg protein. Stability: -70°C. Form: buffered aqueous glycerol solution. Source: E. coli. Species: Human. Protein Kinase A catalytic subunit; Protein kinase A; PKA; PKAC; cAMP-dependent protein kinase catalytic subunit; PRKAC. Cat No: NATE-0571. Creative Enzymes
Protein Kinase Activator SC-10 (N- (n-heptyl) -5-chloro-1-naphthalene sulfonamide) An activator of protein kinase C in a Ca2+-dependent manner, via a mechanism similar to that of phosphatidylserine. Group: Biochemicals. Alternative Names: N- (n-heptyl) -5-chloro-1-naphthalene sulfonamide. Grades: Molecular Biology Grade. CAS No. 102649-79-6. Pack Sizes: 25mg. US Biological Life Sciences. USBiological 1
Worldwide
Protein Kinase Activator SC-9 (N- (6-phenylhexyl) -5-chloro-1-naphthalene sulfonamide) Activates protein kinase C in a Ca2+-dependent manner, via a mechanism similar to that of phosphatidylserine. Group: Biochemicals. Alternative Names: N- (6-phenylhexyl) -5-chloro-1-naphthalene sulfonamide. Grades: Molecular Biology Grade. CAS No. 102649-78-5. Pack Sizes: 10mg, 25mg, 50mg. US Biological Life Sciences. USBiological 1
Worldwide
Protein Kinase A inhibitor fragment 14-22, myristoylated trifluoroacetate salt ?90% (HPLC), lyophilized powder. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein kinase A inhibitor fragment 5-24 amide trifluoroacetate salt ?95% (HPLC), lyophilized powder. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
protein kinase C A family of serine- and threonine-specific protein kinases that depend on lipids for activity. They can be activated by calcium but have a requirement for the second messenger diacylglycerol. Members of this group of enzymes phosphorylate a wide variety of protein targets and are known to be involved in diverse cell-signalling pathways. Members of the protein kinase C family also serve as major receptors for phorbol esters, a class of tumour promoters. Group: Enzymes. Synonyms: calcium-dependent protein kinase C; calcium-independent protein kinase C; calcium/phospholipid dependent protein kinase; cPKCα; cPKCβ; cPKCγ; nPKCΔ; nPKCε; nPKC; nPKC; PKC; PKCα; PKCβ; PKCγ; PKCΔ; PKCε; PKCζ; Pkc1p; protein kinase Cε; STK24. Enzyme Commission Number: EC 2.7.11.13. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3132; protein kinase C; EC 2.7.11.13; calcium-dependent protein kinase C; calcium-independent protein kinase C; calcium/phospholipid dependent protein kinase; cPKCα; cPKCβ; cPKCγ; nPKCΔ; nPKCε; nPKC; nPKC; PKC; PKCα; PKCβ; PKCγ; PKCΔ; PKCε; PKCζ; Pkc1p; protein kinase Cε; STK24. Cat No: EXWM-3132. Creative Enzymes
Protein Kinase C 19-31 Protein Kinase C (19-31) is a peptide inhibitor of protein kinase C (PKC) originating in the pseudo-substrate regulatory domain of PKCA (residues 19-31). Synonyms: PKC (19-31); Arg-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-Lys-Asn-Val; Pseudosubstrate; L-arginyl-L-phenylalanyl-L-alanyl-L-arginyl-L-lysyl-glycyl-L-alanyl-L-leucyl-L-arginyl-L-glutaminyl-L-lysyl-L-asparagyl-L-valine. Grade: 95%. CAS No. 121545-65-1. Molecular formula: C67H118N26O16. Mole weight: 1543.82. BOC Sciences
Protein Kinase C 19-31 acetate Protein Kinase C 19-31 acetate is a peptide inhibitor of protein kinase C (PKC) originating in the pseudo-substrate regulatory domain of PKCA (residues 19-31). It is used as a protein kinase C substrate peptide for testing the protein kinase C activity. Synonyms: PKC (19-31) acetate; H-Arg-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-Lys-Asn-Val-OH.CH3CO2H; L-arginyl-L-phenylalanyl-L-alanyl-L-arginyl-L-lysyl-glycyl-L-alanyl-L-leucyl-L-arginyl-L-glutaminyl-L-lysyl-L-asparagyl-L-valine acetic acid. Grade: ≥95%. Molecular formula: C69H122N26O18. Mole weight: 1603.90. BOC Sciences
Protein kinase c(530-558) Protein kinase c(530-558). Uses: Designed for use in research and industrial production. Additional or Alternative Names: PKC (530-558);PKC FRAGMENT (530-558);PROTEIN KINASE C (530-558);PROTEIN KINASE C FRAGMENT 530-558;LLYEMLAGQAPFEGEDEDELFQSIMEHNV;LLYEMLAGQAPFEGEDEDELFQSIMEHNV-NH2;H-LEU-LEU-TYR-GLU-MET-LEU-ALA-GLY-GLN-ALA-PRO-PHE-GLU-GLY-GLU-ASP-GLU-ASP-GLU-LEU-PHE-GLN-SE. Product Category: Heterocyclic Organic Compound. CAS No. 122613-29-0. Molecular formula: C148H221N35O50S2. Mole weight: 3354.67. Product ID: ACM122613290. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 3
Protein kinase Cα isozyme human, Recombinant Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the second.third family are not activated by either DAG or phorbol esters and include PKCξ, μ, and &Iota. > 70% (sds-page), recombinant, expressed in baculovirus infected insect cells, buffered aqueous glycerol solution. Group: Enzymes. Synonyms: PRKCA; protein kinase C, alpha; PKCA; protein kinase C alpha type; PKC-A; PKCα; AAG6; PKC-alpha; PRKACA. Purity: > 70% (SDS-PAGE). PKC. Mole weight: mol wt 80-81 kDa by SDS-PAGE. Stability: -70°C. Form: buffered aqueous glycerol solution. Source: baculovirus infected insect cells. Species: Human. PRKCA; protein kinase C, alpha; PKCA; protein kinase C alpha type; PKC-A; PKCα; AAG6; PKC-alpha; PRKACA. Cat No: NATE-0574. Creative Enzymes
Protein Kinase C, alpha, primers, amplimer 324bp (AAG6, MGC129900, MGC129901, PKCA, PKC-A, PKC-alpha, PRKACA, Protein kinase C alpha type), Primer A, Upstream Primer Protein Kinase C, alpha, primers, amplimer 324bp (AAG6, MGC129900, MGC129901, PKCA, PKC-A, PKC-alpha, PRKACA, Protein kinase C alpha type), Primer A, Upstream Primer. Group: Molecular Biology. Pack Sizes: 1x50ul. US Biological Life Sciences. USBiological 3
Worldwide
Protein Kinase C, alpha, primers, amplimer 324bp (AAG6, MGC129900, MGC129901, PKCA, PKC-A, PKC-alpha, PRKACA, Protein kinase C alpha type), Primer B, Downstream Primer Protein Kinase C, alpha, primers, amplimer 324bp (AAG6, MGC129900, MGC129901, PKCA, PKC-A, PKC-alpha, PRKACA, Protein kinase C alpha type), Primer B, Downstream Primer. Group: Molecular Biology. Pack Sizes: 1x50ul. US Biological Life Sciences. USBiological 3
Worldwide
Protein Kinase CβII isozyme from human, Recombinant Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the sec. esters and include PKCξ, μ, and &Iota. Group: Enzymes. Synonyms: PRKCB; PKCB; PRKCB1; PRKCB2; protein kinase C, beta 1; protein kinase C beta type; PKC-beta; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: >95% (SDS-PAGE). PKC. Mole weight: calculated mol wt 76.9 kDa; mol wt 80 kDa by SDS-PAGE. Storage: -70°C. Form: buffered aqueous glycerol solution; Solution in 20 mM HEPES, pH 7.4; 2 mM EDTA, 2 mM EGTA, 5 mM DTT, 100 mM NaCl, 0.05% Triton X-100, and 50% glycerol. Source: Baculovirus infected insect cells. Species: Human. PRKCB; PKCB; PRKCB1; PRKCB2; protein kinase C, beta 1; protein kinase C beta type; PKC-beta; EC 2.7.1.37. Cat No: NATE-0622. Creative Enzymes
Protein Kinase CβI isozyme from human, Recombinant Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the sec.ted by either DAG or phorbol esters and include PKCξ, μ, and &Iota. Group: Enzymes. Synonyms: PRKCB; PKCB; PRKCB1; PRKCB2; protein kinase C, beta 1; protein kinase C beta type; PKC-beta; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: > 95% (SDS-PAGE). PKC. Mole weight: apparent mol wt 79-80 kDa. Storage: -70°C. Form: buffered aqueous glycerol solution; Solution in 20 mM HEPES, pH 7.4; 2 mM EDTA, 2 mM EGTA, 5 mM DTT, 100 mM NaCl, 0.05% Triton X-100, and 50% glycerol. Source: Baculovirus infected insect cells. Species: Human. PRKCB; PKCB; PRKCB1; PRKCB2; protein kinase C, beta 1; protein kinase C beta type; PKC-beta; EC 2.7.1.37. Cat No: NATE-0621. Creative Enzymes
Protein Kinase Cδ isozyme from human, Recombinant Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the sec.DAG or phorbol esters and include PKCξ, μ, and &Iota. Group: Enzymes. Synonyms: PRKCD; protein kinase C, delta; protein kinase C delta type; ALPS3; CVID9; MAY1; PKCD; nPKC-delta; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: >95% (SDS-PAGE). PKC. Mole weight: mol wt 74-79 kDa by SDS-PAGE. Storage: -70°C. Form: buffered aqueous glycerol solution; Solution in 20 mM HEPES, pH 7.4; 2 mM EDTA, 2 mM EGTA, 5 mM DTT, 100 mM NaCl, 0.05% Triton X-100, and 50% glycerol. Source: Baculovirus infected insect cells. Species: Human. PRKCD; protein kinase C, delta; protein kinase C delta type; ALPS3; CVID9; MAY1; PKCD; nPKC-delta; EC 2.7.1.37. Cat No: NATE-0623. Creative Enzymes
Protein Kinase Cε isozyme human, Recombinant Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the secon.tein kinase C, epsilon; protein kinase C epsilon type; PKCE; nPKC-epsilon; Ca2+-activated phospholipid-dependent serine-threonine kinase, ε isozyme human; PKCε human; PKCε; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: >95% (SDS-PAGE). PKC. Mole weight: apparent mol wt 89-96 kDa. Storage: -70°C. Form: buffered aqueous glycerol solution. Source: baculovirus infected insect cells. Species: Human. PRKCE; protein kinase C, epsilon; protein kinase C epsilon type; PKCE; nPKC-epsilon; Ca2+-activated phospholipid-dependent serine-threonine kinase, ε isozyme human; PKCε human; PKCε; EC 2.7.1.37. Cat No: NATE-0575. Creative Enzymes
Protein Kinase Cη isozyme human, Recombinant Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the second.nd include PKCξ, μ, and &Iota. > 90% (sds-page), recombinant, expressed in baculovirus infected insect cells, buffered aqueous glycerol solution. Group: Enzymes. Synonyms: PRKCH; Ca2+-activated phospholipid-dependent serine-threonine kinase η isozyme human; PKCη human; PKCH; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: > 90% (SDS-PAGE). PKC. Mole weight: mol wt 82-84 kDa by SDS-PAGE. Storage: -70°C. Form: buffered aqueous glycerol solution. Source: baculovirus infected insect cells. Species: Human. PRKCH; Ca2+-activated phospholipid-dependent serine-threonine kinase η isozyme human; PKCη human; PKCH; EC 2.7.1.37. Cat No: NATE-0576. Creative Enzymes
Protein kinase Cγ isozyme from human, Recombinant Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the sec.vated by either DAG or phorbol esters and include PKCξ, μ, and &Iota. Group: Enzymes. Synonyms: PRKCG; protein kinase C, gamma; protein kinase C gamma type; PKC-gamma; PKCC; PKCG; SCA14; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: >95% (SDS-PAGE). PKC. Mole weight: mol wt 77-84 kDa by SDS-PAGE. Storage: -70°C. Form: buffered aqueous glycerol solution; Solution in 20 mM HEPES, pH 7.4; 2 mM EDTA, 2 mM EGTA, 5 mM DTT, 250 mM NaCl, 0.05% Triton X-100, and 50% glycerol. Source: Baculovirus infected insect cells. Species: Human. PRKCG; protein kinase C, gamma; protein kinase C gamma type; PKC-gamma; PKCC; PKCG; SCA14; EC 2.7.1.37. Cat No: NATE-0624. Creative Enzymes
Protein kinase C?II isozyme human >85% (SDS-PAGE), recombinant, expressed in baculovirus infected insect cells, buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase C?I isozyme human ?95% (SDS-PAGE), recombinant, expressed in baculovirus infected insect cells, buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase C Inhibitor, Myristoylated ?7.5 mg/mL (peptide and counter ion), ?95% (Minimum peptide content 70%, HPLC), aqueous solution (neutral pH). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase CΙ, Active human, Recombinant Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the second.activated by either DAG or phorbol esters and include PKCξ, μ, and &Iota. Recombinant, expressed in e. coli, > 85% (sds-page), buffered aqueous glycerol solution. Applications: Kinase activity is measured as the molar amount of phosphate incorporated into the crebtide substrate peptide per minute per mg protein at 30°c using a final concentration of 50 μm [32p] atp. Group: Enzymes. Synonyms: PKCL; Protein Kinase C Lambda/Iota; PKC&Iota. Purity: > 85% (SDS-PAGE). PKC. Mole weight: apparent mol wt ~98 kDa. Stability: -70°C. Form: buffered aqueous glycerol solution. Source: E. coli. Species: Human. PKCL; Protein Kinase C Lambda/Iota; PKC&Iota. Cat No: NATE-0577. Creative Enzymes
Protein kinase C? isozyme human ?70% (SDS-PAGE), recombinant, expressed in baculovirus infected insect cells, buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase C? isozyme human >95% (SDS-PAGE), recombinant, expressed in baculovirus infected insect cells, buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase C? isozyme human ?75% (SDS-PAGE), recombinant, expressed in baculovirus infected insect cells, buffered aqueous solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase C Peptide Substrate Protein Kinase C Peptide Substrate targets specific cell compartents and activates G protein-coupled receptors, tyrosine kinase receptors or tyrosine kinase-coupled receptors by relying on second messenger and specific adaptor proteins in response to extracellular signals. Protein Kinase C Peptide Substrate regulates a variety of physiological functions, including nervous, endocrine, exocrine, inflammatory and immune system activation. Synonyms: PKCε; PRKCE; Peptide Epsilon; PKC epsilon; H-Glu-Arg-Met-Arg-Pro-Arg-Lys-Arg-Gln-Gly-Ser-Val-Arg-Arg-Arg-Val-OH; L-alpha-glutamyl-L-arginyl-L-methionyl-L-arginyl-L-prolyl-L-arginyl-L-lysyl-L-arginyl-L-glutaminyl-glycyl-L-seryl-L-valyl-L-arginyl-L-arginyl-L-arginyl-L-valine. Grade: 95%. CAS No. 120253-69-2. Molecular formula: C83H155N39O21S. Mole weight: 2067.43. BOC Sciences
Protein Kinase C Peptide Substrate acetate Protein Kinase C Peptide Substrate acetate targets specific cell compartments and activates G protein-coupled receptors, tyrosine kinase receptors, or tyrosine kinase-coupled receptors by relying on second messenger and specific adaptor proteins in response to extracellular signals. It regulates a variety of physiological functions, including nervous, endocrine, exocrine, inflammatory, and immune system activation. Synonyms: L-α-Glutamyl-L-arginyl-L-methionyl-L-arginyl-L-prolyl-L-arginyl-L-lysyl-L-arginyl-L-glutaminylglycyl-L-seryl-L-valyl-L-arginyl-L-arginyl-L-arginyl-L-valine acetate; H-Glu-Arg-Met-Arg-Pro-Arg-Lys-Arg-Gln-Gly-Ser-Val-Arg-Arg-Arg-Val-OH acetate. Grade: ≥95%. Molecular formula: C85H159N39O23S. Mole weight: 2127.52. BOC Sciences 11
Protein Kinase C? (PKC?) Active human recombinant, expressed in E. coli, ?75% (SDS-PAGE), buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein kinase C? pseudosubstrate, myristoyl trifluoroacetate salt ?90% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase Cζ isozyme from human, Recombinant Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the seco.Members of the third family are not activated by either DAG or phorbol esters and include PKCξ, μ, and &Iota. Group: Enzymes. Synonyms: PRKCZ; protein kinase C, zeta; protein kinase C zeta type; PKC2; PKC-ZETA; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: > 75% (SDS-PAGE). PKC. Mole weight: mol wt 76-80 kDa by SDS-PAGE. Storage: -70°C. Form: buffered aqueous solution; Solution in 20 mM HEPES, pH 7.5; 2 mM EDTA, 2 mM EGTA, 5 mM DTT, 250 mM NaCl, 0.05% Triton X-100, and 50% glycerol. Source: Baculovirus infected insect cells. Species: Human. PRKCZ; protein kinase C, zeta; protein kinase C zeta type; PKC2; PKC-ZETA; EC 2.7.1.37. Cat No: NATE-0625. Creative Enzymes
Protein kinase C zeta pseudosubstrate It is a protein kinase C inhibitor (PKC)ζ. It Consists of amino acids 113-129 PKC ζ pseudosubstrate domains connected by a disulfide bridge to the cell permeabilisation Antennapedia domain vector peptide. Synonyms: PKC ζ pseudosubstrate; H-Cys(1)-Ser-Ile-Tyr-Arg-Arg-Gly-Ala-Arg-Arg-Trp-Arg-Lys-Leu-Tyr-Arg-Ala-Asn-OH.H-Cys(1)-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-OH; L-cysteinyl-L-seryl-L-isoleucyl-L-tyrosyl-L-arginyl-L-arginyl-glycyl-L-alanyl-L-arginyl-L-arginyl-L-tryptophyl-L-arginyl-L-lysyl-L-leucyl-L-tyrosyl-L-arginyl-L-alanyl-L-asparagine (1->1')-disulfide compound with L-cysteinyl-L-arginyl-L-glutaminyl-L-isoleucyl-L-lysyl-L-isoleucyl-L-tryptophyl-L-phenylalanyl-L-glutaminyl-L-asparagyl-L-arginyl-L-arginyl-L-methionyl-L-lysyl-L-tryptophyl-L-lysyl-L-lysine. Grade: >98%. Molecular formula: C208H336N74O44S3. Mole weight: 4673.59. BOC Sciences 11
Protein Kinase G Iβ human, Recombinant Protein Kinase G Iβ induces apoptosis in certain cell lines such as human breast cancer cell lines MCF-7 and MDA-MB-468. It inhibits cell proliferation and induces apoptosis in colon cancer cell lines. > 95% (sds-page), recombinant, expressed in baculovirus infected sf9 cells, buffered aqueous glycerol solution. Applications: Protein kinase g is a serine/threonine-specific protein kinase that is activated by cgmp. protein kinase g iβ is used to induce apoptosis and inhibit cell proliferation. Group: Enzymes. Synonyms: Protein Kinase G Iβ; PRKG1B; PRKGR1B; PKG1B; cGMP-dependent protein kinase 1; cGKI-BETA. Purity: >95% (SDS-PAGE). PKG. Mole weight: mol wt 76 kDa (monomer). Activity: > 1.5 units/mg protein (20-fold stimulation by cGMP (5 μM)). Stability: -20°C. Form: buffered aqueous glycerol solution. Source: baculovirus infected insect cells. Species: Human. Protein Kinase G Iβ; PRKG1B; PRKGR1B; PKG1B; cGMP-dependent protein kinase 1; cGKI-BETA. Cat No: NATE-0580. Creative Enzymes
Protein Kinase G I? human ?95% (SDS-PAGE), recombinant, expressed in baculovirus infected Sf9 cells, buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase G II from rat >90% (SDS-PAGE), recombinant, expressed in baculovirus infected Sf9 cells, solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase G II from rat, Recombinant Protein Kinase G II (cGK-II) is a membrane-associated cGMP-dependent protein kinase found in rat intestine. This product is a recombinant rat isoform isolated from baculovirus-infected Sf 9 cells. >90% (sds-page), recombinant, expressed in baculovirus infected sf9 cells, solution. Group: Enzymes. Synonyms: cGK-II; 3':5'-Cyclic GMP dependent Protein Kinase; cGMP-dependent Protein Kinase II; Protein Kinase G II; PRKG2; protein kinase, cGMP-dependent, type II; cGMP-dependent protein kinase 2; PKG2. Purity: >90% (SDS-PAGE). PKG. Activity: ~0.7 U/mg. Form: solution. Source: baculovirus infected Sf9 cells. Species: Rat. cGK-II; 3':5'-Cyclic GMP dependent Protein Kinase; cGMP-dependent Protein Kinase II; Protein Kinase G II; PRKG2; protein kinase, cGMP-dependent, type II; cGMP-dependent protein kinase 2; PKG2. Cat No: NATE-0581. Creative Enzymes
Protein kinase inhibitor 1 hydrochloride Protein kinase inhibitor 1 hydrochloride is a potent HIPK2 inhibitor, with IC 50 s of 136 and 74 nM for HIPK1 and HIPK2, and a K d of 9.5 nM for HIPK2. Uses: Scientific research. Group: Signaling pathways. CAS No. 2321337-71-5. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-U00439A. MedChemExpress MCE
Protein kinase inhibitor 6 Protein kinase inhibitor 6 is a protein kinase inhibitor. Uses: Scientific research. Group: Signaling pathways. CAS No. 348-45-8. Pack Sizes: 5 mg; 10 mg; 25 mg. Product ID: HY-47026. MedChemExpress MCE
Protein Kinase Inhibitor CKI-7 (PKI) (N-(2-aminoethyl)-5-chloro-isoquinoline-8-sulfonamide) A potent inhibitor against casein kinase 1 with respect to ATP. Exhibits a much weaker effect on casein kinase 2 and other protein kinases. Group: Biochemicals. Alternative Names: N-(2-aminoethyl)-5-chloro-isoquinoline-8-sulfonamide. Grades: Molecular Biology Grade. CAS No. 120615-25-0. Pack Sizes: 10mg, 25mg, 50mg. US Biological Life Sciences. USBiological 1
Worldwide
Protein Kinase Inhibitor from rabbit ?85% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protein Kinase Inhibitor H-7 (PKI) (1-(5-isoquinolinesulfonyl)-2-methylpiperazine dihydrochloride) A selective inhibitor of protein kinase C or cyclic-nucleotide-dependent protein kinases. Group: Biochemicals. Alternative Names: 1-(5-isoquinolinesulfonyl)-2-methylpiperazine dihydrochloride. Grades: Molecular Biology Grade. CAS No. 108930-17-2. Pack Sizes: 25mg. US Biological Life Sciences. USBiological 1
Worldwide
Protein Kinase Inhibitor H-89 (PKI, N- (2-p-bromocinnamyl aminoeth yl ]-5-isoquinolinesulfonamid e ) (N- (2-p-bromocinnamyl aminoeth yl ]-5-isoquinolinesulfonamid e ) Protein Kinase Inhibitors. Group: Biochemicals. Grades: Molecular Biology Grade. CAS No. 127243-85-0. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 1
Worldwide
Protein Kinase Inhibitor H-8 (PKI) (N- [2-( methyl amino) ethy l ]-5-isoquinolinesulfonamid e dihydrochloride) Inhibits cyclic-nucleotide-dependent protein kinases. Group: Biochemicals. Alternative Names: N- [2-( methyl amino) ethy l ]-5-isoquinolinesulfonamid e dihydrochloride. Grades: Molecular Biology Grade. CAS No. 84478-11-5. Pack Sizes: 25mg. US Biological Life Sciences. USBiological 1
Worldwide
Protein Kinase Inhibitor H-9 (PKI) (N- (2-aminoethyl ) -5-isoquinolinesulfonamid e dihydrochloride) Competitive inhibitor of protein kinase C, cGMP- and cAMP-dependent protein kinases with respect to ATP binding. Group: Biochemicals. Alternative Names: N- (2-aminoethyl ) -5-isoquinolinesulfonamid e dihydrochloride. Grades: Molecular Biology Grade. CAS No. 84468-17-7. Pack Sizes: 25mg. US Biological Life Sciences. USBiological 1
Worldwide
Protein Kinase Inhibitor HA1004 (PKI) (N- (2-guanidinoethyl ] -5-isoquinolinesulfonamid e dihydrochloride) Calcium antagonist and vasodilator. Does not affect on cardiac function. Group: Biochemicals. Alternative Names: N- (2-guanidinoethyl ] -5-isoquinolinesulfonamid e dihydrochloride. Grades: Molecular Biology Grade. CAS No. 92564-34-6. Pack Sizes: 25mg. US Biological Life Sciences. USBiological 1
Worldwide
Protein Kinase Inhibitor ML-7 (PKI) (1-(5-Iodonaphthalene-1-sulfonyl)-1H-hexahydro-1,4-diazepine hydrochloride) Inhibits myosin light chain kinase. Group: Biochemicals. Alternative Names: 1-(5-Iodonaphthalene-1-sulfonyl)-1H-hexahydro-1,4-diazepine hydrochloride. Grades: Molecular Biology Grade. Pack Sizes: 5mg. US Biological Life Sciences. USBiological 1
Worldwide
Protein Kinase Inhibitor ML-9 (PKI) (1-(5-Chloronaphthalene-1-sulfonyl)-1H-hexahydro-1,4-diazepine hydrochloride) Competitive inhibitor of several protein kinases wrt ATP. Group: Biochemicals. Alternative Names: 1-(5-Chloronaphthalene-1-sulfonyl)-1H-hexahydro-1,4-diazepine hydrochloride. Grades: Molecular Biology Grade. CAS No. 105637-50-1. Pack Sizes: 25mg. US Biological Life Sciences. USBiological 1
Worldwide
Protein L-Agarose from Peptostreptococcus magnus recombinant, expressed in E. coli. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
protein-L-isoaspartate(D-aspartate) O-methyltransferase D-Aspartate (but not L-aspartate) residues in proteins can also act as acceptors. Previously also listed as EC 2.1.1.24. Group: Enzymes. Synonyms: protein-L-isoaspartate O-methyltransferase; protein-β-aspartate O-methyltransferase; D-aspartyl/L-isoaspartyl methyltransferase; L-isoaspartyl/D-aspartyl protein carboxyl methyltransferase; protein (D-aspartate) methyltransferase; protein D-aspartate methyltransferase; protein L-isoaspartate methyltransferase; protein L-isoaspartyl methyltransferase; protein O-methyltransferase (L-isoaspartate); L-aspartyl/L-isoaspartyl protein me. Enzyme Commission Number: EC 2.1.1.77. CAS No. 105638-50-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1978; protein-L-isoaspartate(D-aspartate) O-methyltransferase; EC 2.1.1.77; 105638-50-4; protein-L-isoaspartate O-methyltransferase; protein-β-aspartate O-methyltransferase; D-aspartyl/L-isoaspartyl methyltransferase; L-isoaspartyl/D-aspartyl protein carboxyl methyltransferase; protein (D-aspartate) methyltransferase; protein D-aspartate methyltransferase; protein L-isoaspartate methyltransferase; protein L-isoaspartyl methyltransferase; protein O-methyltransferase (L-isoaspartate); L-aspartyl/L-isoaspartyl protein methyltransferase. Cat No: EXWM-1978. Creative Enzymes
Protein LMWP LMWP can be used as a cell-penetrating peptide (CPP) to achieve efficient intracellular protein or gene delivery in the clinic. Synonyms: Low Molecular Weight Protamine; H-Val-Ser-Arg-Arg-Arg-Arg-Arg-Arg-Gly-Gly-Arg-Arg-Arg-Arg-OH; L-Arginine, L-valyl-L-seryl-L-arginyl-L-arginyl-L-arginyl-L-arginyl-L-arginyl-L-arginylglycylglycyl-L-arginyl-L-arginyl-L-arginyl-. Grade: ≥95%. CAS No. 121052-30-0. Molecular formula: C72H142N44O16. Mole weight: 1880.18. BOC Sciences 11
protein-lysine 6-oxidase Also acts on protein 5-hydroxylysine. This enzyme catalyses the final known enzymic step required for collagen and elastin cross-linking in the biosynthesis of normal mature extracellular matrices. These reactions play an important role for the development, elasticity and extensibility of connective tissue. The enzyme is also active on free amines, such as cadaverine or benzylamine. Group: Enzymes. Synonyms: lysyl oxidase. Enzyme Commission Number: EC 1.4.3.13. CAS No. 99676-44-5. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1469; protein-lysine 6-oxidase; EC 1.4.3.13; 99676-44-5; lysyl oxidase. Cat No: EXWM-1469. Creative Enzymes
Protein MW Marker, Detection, Biotin (HRP) Protein MW Marker, Detection, Biotin (HRP). Group: Molecular Biology. Pack Sizes: 650ul. US Biological Life Sciences. USBiological 1
Worldwide
Protein MW Marker, Detection, Prestained, 6.5-175kD (Biotin) ProteinSourceApparent MW (kD). Group: Molecular Biology. Pack Sizes: 650ul. US Biological Life Sciences. USBiological 1
Worldwide

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products