American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
Protoporphyrin IX-d6 Protoporphyrin IX-d6 is the labeled version of Protoporphyrin IX (CAS: 553-12-8). Protoporphyrin IX (PPIX) is ubiquitously present in all living cells in small amounts as a precursor of heme and PPIX-based strategies have been used for cancer diagnosis and treatment. It can be used in biological study for role of protoporphyrin IX in skin photosensitivity, biliary stones, hepatobiliary damage, liver failure and cancer diagnosis and treatment in human. Group: Biochemicals. Alternative Names: Protoporphyrin IX di-Me Ester-d6; 3,7,12,17-Tetramethyl-8,13-divinyldimethyl Ester 2,18-Porphinedipropionic Acid-d6. Grades: Highly Purified. CAS No. 553-12-8 Unlabeled. Pack Sizes: 500ug, 2.5mg. Molecular Formula: C??H??D?N?O?, Molecular Weight: 596.75. US Biological Life Sciences. USBiological 5
Worldwide
Protoporphyrin ix,dimethyl ester Protoporphyrin ix,dimethyl ester. Uses: Designed for use in research and industrial production. Additional or Alternative Names: OOPORPYHRIN DIMETHYL ESTER;PROTOPORPHYRIN DIMETHYL ESTER;PROTOPORPHYRIN IX METHYL ESTER;DIMETHYL-8,13-BIS(VINYL)-3,7,12,17-TETRAMETHYL-21H,23H-PORPHINE-2,18-DIPROPIONATE;Dimethyl-8,13-bi8(vinyl)-3,7,12,17-tetramethyl-21H,23H-porphine-2,18-dipropionate. Product Category: Heterocyclic Organic Compound. CAS No. 6164-53-0. Molecular formula: C36H38N4O4. Mole weight: 590.71. Product ID: ACM6164530. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 5
Protoporphyrin IX dimethyl ester Protoporphyrin IX dimethyl ester. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Dimethyl8,13-divinyl-3,7,12,17-tetramethyl-21H,23H-porphine-2,18-dipropionate. Product Category: Porphyrins and Phthalocyanines. Appearance: Magenta solid. CAS No. 5522-66-7. Molecular formula: C36H38N404. Mole weight: 590.71. Purity: 0.95. IUPACName: Methyl3-[8,13-bis(ethenyl)-18-(3-methoxy-3-oxopropyl)-3,7,12,17-tetramethyl-22,23-dihydroporphyrin-2-yl]propanoate. Canonical SMILES: CC1=C(C2=CC3=NC(=CC4=NC(=CC5=C(C(=C(N5)C=C1N2)C=C)C)C(=C4CCC(=O)OC)C)C(=C3C)CCC(=O)OC)C=C. Density: 1.220 ± 0.06 g/ml. Product ID: ACM5522667-2. Alfa Chemistry — ISO 9001:2015 Certified. Categories: 6164-53-0. Alfa Chemistry.
Protoporphyrin IX zinc(II) guanylate cyclase inhibitor. Group: Photonic and optical materials. Alfa Chemistry Analytical Products 2
protoporphyrinogen IX dehydrogenase (menaquinone) This enzyme enables Escherichia coli to synthesize heme in both aerobic and anaerobic environments. Group: Enzymes. Synonyms: HemG. Enzyme Commission Number: EC 1.3.5.3. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1387; protoporphyrinogen IX dehydrogenase (menaquinone); EC 1.3.5.3; HemG. Cat No: EXWM-1387. Creative Enzymes
protoporphyrinogen oxidase This is the last common enzyme in the biosynthesis of chlorophylls and heme. Two isoenzymes exist in plants: one in plastids and the other in mitochondria. This is the target enzyme of phthalimide-type and diphenylether-type herbicides. The enzyme from oxygen-dependent species contains FAD. Also slowly oxidizes mesoporphyrinogen IX. Group: Enzymes. Synonyms: protoporphyrinogen IX oxidase; protoporphyrinogenase; PPO; Protox; HemG; HemY. Enzyme Commission Number: EC 1.3.3.4. CAS No. 53986-32-6. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1378; protoporphyrinogen oxidase; EC 1.3.3.4; 53986-32-6; protoporphyrinogen IX oxidase; protoporphyrinogenase; PPO; Protox; HemG; HemY. Cat No: EXWM-1378. Creative Enzymes
PROTO_PROSY Protonectin PROTO_PROSY Protonectin is an antimicrobial peptide found in Protonectarina sylveirae (Brazilian wasp), and has antibacterial activity against both gram-positive and gram-negative bacteria. It shows potent histamine releasing activities on rat peritoneal mast cells. Synonyms: Ile-Leu-Gly-Thr-Ile-Leu-Gly-Leu-Leu-Lys-Gly-Leu; Protonectin. Grade: ≥96%. Molecular formula: C58H107N13O14. Mole weight: 1210.57. BOC Sciences 11
Protopseudohypericin Protopseudohypericin. Group: Biochemicals. Grades: Plant Grade. CAS No. 54328-09-5. Pack Sizes: 10mg. Molecular Formula: C30H18O9, Molecular Weight: 522.46. US Biological Life Sciences. USBiological 9
Worldwide
Protosappanin B Protosappanin B. Group: Biochemicals. Grades: Plant Grade. CAS No. 102036-29-3. Pack Sizes: 20mg. Molecular Formula: C16H16O6, Molecular Weight: 304.3. US Biological Life Sciences. USBiological 9
Worldwide
Protosappanin B Protosappanin B is a natural compound found in the heart wood of Caesalpinia sappan L. Protosappanin B exhibits antitumor and anti-oxidant activity that can inhibit the oxidation of linoleic acid. Uses: Antitumor, anti-oxidant. Synonyms: (-)-Protosappanin B; 6H-Dibenz[b,d]oxocin-3,7,10,11-tetrol, 7,8-dihydro-7-(hydroxymethyl)-, (7S,12aS)-. Grade: >95%. CAS No. 102036-29-3. Molecular formula: C16H16O6. Mole weight: 304.30. BOC Sciences 9
protostadienol synthase (17Z)-Protosta-17(20),24-dien-3β-ol is a precursor of the steroidal antibiotic helvolic acid. Group: Enzymes. Synonyms: PdsA; (S)-2,3-epoxysqualene mutase [cyclizing, (17Z)-protosta-17(20),24-dien-3β-ol-forming]. Enzyme Commission Number: EC 5.4.99.32. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5573; protostadienol synthase; EC 5.4.99.32; PdsA; (S)-2,3-epoxysqualene mutase [cyclizing, (17Z)-protosta-17(20),24-dien-3β-ol-forming]. Cat No: EXWM-5573. Creative Enzymes
Protostemonine Botanical Source: Group: Biochemicals. Grades: Plant Grade. CAS No. 27495-40-5. Pack Sizes: 10mg, 20mg. US Biological Life Sciences. USBiological 9
Worldwide
Protostemotinine Formula: Group: Biochemicals. Grades: Plant Grade. CAS No. 169534-85-4. Pack Sizes: 5mg, 10mg. US Biological Life Sciences. USBiological 9
Worldwide
Protriptyline-d3 hydrochloride 100 ?g/mL in methanol (as free base), ampule of 1 mL, certified reference material. Group: Certified reference materials (crms). Alfa Chemistry Analytical Products
Protriptyline-d3 Hydrochloride Protriptyline-d3 Hydrochloride. Group: Biochemicals. Alternative Names: N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propanamine-d3 Hydrochloride; N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propanamine-d3 Hydrochloride; N-Methyl-5H-Dibenzo[a, d]cycloheptene-5-propylamine-d3 Hydrochloride; Concordin-d3; MK-240-d3; Maximed-d3; Maximet-d3; N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propylamine-d3 Hydrochloride; Normethyl EX4442-d3; Protriptyline-d3 Hydrochloride; Protryptyline-d3 Hydrochloride; Triptil-d3 Hydrochloride; Vivactil-d3 Hydrochloride. Grades: Highly Purified. CAS No. 1435934-21-6. Pack Sizes: 1mg. Molecular Formula: C19H19D3ClN, Molecular Weight: 302.86. US Biological Life Sciences. USBiological 3
Worldwide
Protriptyline hydrochloride Protriptyline hydrochloride is a tricyclic antidepressant (TCA), specifically a secondary amine, for the treatment of depression and ADHD. Uses: Scientific research. Group: Signaling pathways. CAS No. 1225-55-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-B0949. MedChemExpress MCE
Protriptyline Hydrochloride Protriptyline Hydrochloride. Group: Biochemicals. Alternative Names: N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propanamine Hydrochloride; N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propanamine Hydrochloride; N-Methyl-5H-Dibenzo[a, d]cycloheptene-5-propylamine Hydrochloride; Concordin; MK-240; Maximed; Maximet; N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propylamine Hydrochloride; Normethyl EX4442; Protriptyline hydrochloride; Protryptyline Hydrochloride; Triptil Hydrochloride; Vivactil Hydrochloride. Grades: Highly Purified. CAS No. 1225-55-4. Pack Sizes: 50mg. Molecular Formula: C19H22ClN, Molecular Weight: 299.839999999999. US Biological Life Sciences. USBiological 3
Worldwide
Pro-Trp-OH Pro-Trp-OH. Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 100mg, 250mg. US Biological Life Sciences. USBiological 5
Worldwide
Pro-Trp-OH Pro-Trp-OH. Synonyms: L-Prolyl-L-tryptophan; Pro Trp OH. Grade: ≥ 99% (TLC). CAS No. 35310-39-5. Molecular formula: C16H19N3O3. Mole weight: 301.35. BOC Sciences 11
ProTx I ProTx I. Group: Biochemicals. Grades: Purified. CAS No. 484598-35-8. Pack Sizes: 100ug. US Biological Life Sciences. USBiological 5
Worldwide
ProTx I ProTx I, a toxin that was originally isolated from the venom of Thrixopelma pruriens (Peruvian green velvet tarantula), blocks native mouse CaV3.1 channel and recombinant human CaV3.1 channel currents similarly, and blocks to a lesser extent CaV3.2 and CaV3.3 channel currents. Synonyms: ProTxI; ProTx-I; H-Glu-Cys(1)-Arg-Tyr-Trp-Leu-Gly-Gly-Cys(2)-Ser-Ala-Gly-Gln-Thr-Cys(3)-Cys(1)-Lys-His-Leu-Val-Cys(2)-Ser-Arg-Arg-His-Gly-Trp-Cys(3)-Val-Trp-Asp-Gly-Thr-Phe-Ser-OH; L-alpha-glutamyl-L-cysteinyl-L-arginyl-L-tyrosyl-L-tryptophyl-L-leucyl-glycyl-glycyl-L-cysteinyl-L-seryl-L-alanyl-glycyl-L-glutaminyl-L-threonyl-L-cysteinyl-L-cysteinyl-L-lysyl-L-histidyl-L-leucyl-L-valyl-L-cysteinyl-L-seryl-L-arginyl-L-arginyl-L-histidyl-glycyl-L-tryptophyl-L-cysteinyl-L-valyl-L-tryptophyl-L-alpha-aspartyl-glycyl-L-threonyl-L-phenylalanyl-L-serine (2->16),(9->21),(15->28)-tris(disulfide). Grade: >98%. CAS No. 484598-35-8. Molecular formula: C171H245N53O47S6. Mole weight: 3987.51. BOC Sciences
ProTx II ProTx II. Group: Biochemicals. Grades: Purified. CAS No. 484598-36-9. Pack Sizes: 100ug. US Biological Life Sciences. USBiological 5
Worldwide
ProTx II ProTx II is a selective NaV1.7 channel blocker with 100-fold selectivity over other sodium channel subtypes. Synonyms: YCQKWMWTCDSERKCCEGMVCRLWCKKKLW. Grade: >98%. CAS No. 484598-36-9. Molecular formula: C168H250N46O41S8. Mole weight: 3826.59. BOC Sciences
ProTx III ProTx III, isolated from the venom of the Peruvian green-velvet tarantula Thrixopelma pruriens, is a potent Nav1.7 blocker (IC50 = 2.5 nM) and also inhibits Nav1.1, Nav1.2, Nav1.3 and Nav1.6 in the nanomolar range. Synonyms: DCLKFGWKCNPRNDKCCSGLKCGSNHNWCKLHI. Grade: >98%. Molecular formula: C162H246N52O43S6. Mole weight: 3802.41. BOC Sciences
Pro-Tyr-OH Pro-Tyr-OH. Group: Biochemicals. Alternative Names: L-Prolyl-L-tyrosine. Grades: Highly Purified. CAS No. 19786-36-8. Pack Sizes: 100mg. US Biological Life Sciences. USBiological 8
Worldwide
Pro-Tyr-OH Pro-Tyr-OH. Synonyms: L-Prolyl-L-tyrosine; Pro Tyr OH. Grade: ≥ 99% (Assay). CAS No. 19786-36-8. Molecular formula: C14H18N2O4. Mole weight: 278.31. BOC Sciences 11
Pro-Tyr-OH ≥97%. Pro-Tyr-OH ≥97%. Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 100mg. US Biological Life Sciences. USBiological 5
Worldwide
Pro-Urokinase from Human, recombinant Urokinase or Urokinase-type plasminogen activator (uPA) is a serine protease (EC 3.4.21.73). It is secreted as a single-chain zymogen, pro-Urokinase, possessing little or no intrinsic enzymatic activity. The single chain zymogen is converted into the active two chain enzyme (tcuPA) by cleavage of the bond between Lys157 and Ile158. After activation, Urokinase specifically cleaves the proenzyme plasminogen to form the active enzyme plasmin. The active plasmin then catalyzes the breakdown of fibrin polymers of blood clots. Urokinase is involved in a number of biological functions including fibrinolysis, embryogenesis, cell migration, tissue remodeling, ovulation, and wound healing. Additionally, it is a potent marker of invasion and metastasis in a variety of human cancers associated with breast, stomach, colon, bladder, ovary, brain and endometrium. Group: Enzymes. Synonyms: Single chain Urokinase-type plasminogen activator; s. Purity: > 90% by SDS-PAGE. Pro-Urokinase. Mole weight: 49.3 kDa. Activity: >1200 mU/mg. Storage: Stable at -80°C for at least 1 year as supplied. Store reconstituted aliquots at -80°C. Avoid repeated freeze and thaw cycles. Form: Lyophilized powder. Source: E. coli. Species: Human. Single chain Urokinase-type plasminogen activator; scuPA; Urokinase-type Plasminogen Activator uPA; PLAU; Pro-Urokinase. Cat No: NATE-1689. Creative Enzymes
Provichem 0216 Provichem 0216. Group: Polymers. Alfa Chemistry Materials 3
Provichem 1102 Provichem 1102. Group: Polymers. Alfa Chemistry Materials 3
Provigil Provigil. CAS No: 68693-11-8 Sarchem Laboratories
Sarchem Laboratories New Jersey NJ
Proviplast 17820 Proviplast 17820. Group: Polymers. Alfa Chemistry Materials 3
Proviplast 1784 Proviplast 1784. Group: Polymers. Alfa Chemistry Materials 3
Pro Vitamin A 10% (Beta Carotene 10%) Pro Vitamin A 10% (Beta Carotene 10%) - Agriculture Chemicals. SUPPLIERS TO BUSINESS CUSTOMERS ONLY. Redox
North America & APAC
Pro-X dipeptidase Transferred to EC 3.4.13.18. Group: Enzymes. Enzyme Commission Number: EC 3.4.13.8. CAS No. 9025-33-6. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4041; Pro-X dipeptidase; EC 3.4.13.8; 9025-33-6. Cat No: EXWM-4041. Creative Enzymes
Proxyfan oxalate Proxyfan oxalate. Group: Biochemicals. Grades: Purified. CAS No. 177708-09-7. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
Pro-xylane Hydroxypropyl tetrahydropyrantriol has been used in trials studying the basic science of Aging. Alternative Names: Hydroxypropyl tetrahydropyrantriol. Mexoryl SBB. Pro-xylane (pharmaceutical). CAS No. 439685-79-7. Product ID: CIA439685797. Molecular formula: C8H16O5. Mole weight: 192.21. SMILES: CC(C[C@H]1[C@@H]([C@H]([C@@H](CO1)O)O)O)O. Appearance: White to off-white powder. Category: Cosmetic Ingredients and Additives. Protheragen
Pro-xylane Pro-xylane - Product ID: NST-10-141. Category: Glycosides. Alternative Names: C-?-D-Xylopyranoside-2-hydroxypropane. Purity: 98%. Test method: HPLC. CAS No. 439685-79-7. Pack Sizes: 5g, 10g, 25g, 50g. Appearance: White Powder. Molecular formula: C8H16O5. Mole weight: 192.21. Storage: +2 … +8 °C. NATURE SCIENCE TECHNOLOGIES
Pro-xylane (30% in water) Pro-xylane (30% in water) (Hydroxypropyl tetrahydropyrantriol) is a biologically active C-glycoside in aqueous media, acts as an activator of glycosaminoglycans (GAGs) biosynthesis. Pro-xylane (30% in water) has potential skin anti-aging properties and is eco-friendly, biodegradable, and can be used in cosmetic research [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: Hydroxypropyl tetrahydropyrantriol. CAS No. 439685-79-7. Pack Sizes: 50 mg (1.56 M * 166.67 μL in Water); 100 mg (1.56 M * 333.33 μL in Water). Product ID: HY-108036. MedChemExpress MCE
Proxylphylline Proxylphylline. Group: Biochemicals. Grades: Highly Purified. CAS No. 603-00-9. Pack Sizes: 25g, 50g, 100g. US Biological Life Sciences. USBiological 8
Worldwide
Proxyphylline Proxyphylline is a methylxanthine derivative used as a cardiac stimulant, vasodilator and bronchodilator [1]. Uses: Scientific research. Group: Natural products. CAS No. 603-00-9. Pack Sizes: 10 mM * 1 mL; 500 mg. Product ID: HY-B1742. MedChemExpress MCE
PrP 106-126 (human) Prion Protein 106-126 (human), a peptide fragment of the cellular prion protein PrP, is used as a model to investigate neurodegeneration in prion diseases. It exhibits neurotoxicity caused by amplification of PrPC-associated signaling responses and induces NF-κB-mediated apoptosis in the mouse neuroblastoma cell line N2a. Synonyms: Prion Protein Fragment 106-126 Human; Prion Protein 106-126 (human); Lys-Thr-Asn-Met-Lys-His-Met-Ala-Gly-Ala-Ala-Ala-Ala-Gly-Ala-Val-Val-Gly-Gly-Leu-Gly; L-lysyl-L-threonyl-L-asparagyl-L-methionyl-L-lysyl-L-histidyl-L-methionyl-L-alanyl-glycyl-L-alanyl-L-alanyl-L-alanyl-L-alanyl-glycyl-L-alanyl-L-valyl-L-valyl-glycyl-glycyl-L-leucyl-glycine. Grade: ≥95%. CAS No. 148439-49-0. Molecular formula: C80H138N26O24S2. Mole weight: 1912.24. BOC Sciences
PRT062607 PRT062607(P505-15; PRT-2607; BIIB-057) is a highly specific and potent inhibitor of Syk with IC50 of 1-2 nM; >80-fold selective for Syk than Fgr, Lyn, FAK, Pyk2 and Zap70. Uses: Scientific research. Group: Signaling pathways. Alternative Names: P505-15; PRT-2607; BIIB-057. CAS No. 1370261-96-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15322. MedChemExpress MCE
PRT062607 Hydrochloride PRT062607 (P505-15) Hydrochloride is an orally available Syk inhibitor (IC50: 1 nM) that inhibits inflammation and induction Apoptosis. PRT062607 Hydrochloride exerts potent antitumor activity in tumor xenograft mouse models[1][2]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: P505-15 Hydrochloride. CAS No. 1370261-97-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15323. MedChemExpress MCE
PRT4165 PRT4165 is a potent inhibitor of polycomb-repressive complex 1 (PRC1)-mediated H2A ubiquitylation. Uses: Scientific research. Group: Signaling pathways. Alternative Names: NSC600157. CAS No. 31083-55-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-19817. MedChemExpress MCE
PRT4165 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
PRT 4165 PRT 4165. Group: Biochemicals. Grades: Purified. CAS No. 31083-55-3. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
Prucalopride ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
Prucalopride Prucalopride is an orally active, selective and specific 5-HT 4 receptor agonist (high affinity), with pK i s of 8.6 and 8.1 for human 5-HT4a/4b receptors , respectively. Prucalopride improves intestinal motility by promoting regeneration of the intestinal nervous system in rats. Prucalopride also shows anticancer activity by blocking of the PI3K/AKT/mTor signaling pathway. Prucalopride can be used in studies of chronic constipation, pseudo-intestinal obstruction and cancer [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. CAS No. 179474-81-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-14151. MedChemExpress MCE
Prucalopride succinate Prucalopride succinate is an orally active, selective and specific 5-HT 4 receptor agonist (high affinity), with pK i s of 8.6 and 8.1 for human 5-HT4a/4b receptors , respectively. Prucalopride succinate improves intestinal motility by promoting regeneration of the intestinal nervous system in rats. Prucalopride succinate also shows anticancer activity by blocking of the PI3K/AKT/mTor signaling pathway. Prucalopride succinate can be used in studies of chronic constipation, pseudo-intestinal obstruction and cancer [1] [2] [3] [4]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: R-108512. CAS No. 179474-85-2. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg; 200 mg. Product ID: HY-12694. MedChemExpress MCE
Prucalopride Succinate Prucalopride is a selective 5-HT4 receptor agonist used effective for chronic constipation, but is not currently approved in the U.S. Prucalopride is approved for the treatment of chronic constipation in Europe. Group: Biochemicals. Alternative Names: 4-Amino-5-chloro-2,3-dihydro-N-[1-(3-methoxypropyl)-4-piperidinyl]-7-benzofurancarboxamide Butanedioic Acid; R 108512; Resolor. Grades: Highly Purified. CAS No. 179474-85-2. Pack Sizes: 50mg. US Biological Life Sciences. USBiological 2
Worldwide
Prucalopride Succinate-13CD3 Prucalopride Succinate-13CD3 is the labeled analogue of Prucalopride Succinate (P838950). Prucalopride is a selective 5-HT4 receptor agonist used effective for chronic constipation, but is not currently approved in the U.S. Prucalopride is approved for the treatment of chronic constipation in Europe. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 1mg. Molecular Formula: C2113CH29D3ClN3O7, Molecular Weight: 489.97. US Biological Life Sciences. USBiological 4
Worldwide
Prulifloxacin Prulifloxacin (NM441) is an orally active fluoroquinolone antibiotic with a broad spectrum of activity against Gram-positive and -negative bacteria. Prulifloxacin is a proagent of a thiazeto-quinoline carboxylic acid derivative Ulifloxacin (NM394). Prulifloxacin has the potential for lower urinary tract infections and exacerbations of chronic bronchitis [1] [2]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: NM441. CAS No. 123447-62-1. Pack Sizes: 10 mM * 1 mL; 100 mg; 500 mg. Product ID: HY-B0024. MedChemExpress MCE
Prulifloxacin Prulifloxacin is a synthetic chemotherapeutic antibiotic of the fluoroquinolone drug class. Prulifloxacin is a prodrug for active metabolite, Ulifloxacin. Antibacterial. Group: Biochemicals. Alternative Names: 6-Fluoro-1-methyl-7-[4-[(5-methyl-2-oxo-1,3-dioxol-4-yl)methyl]-1-piperazinyl]-4-oxo-. Grades: Highly Purified. CAS No. 123447-62-1. Pack Sizes: 100mg. US Biological Life Sciences. USBiological 2
Worldwide
Prulifloxacin-[d8] Prulifloxacin-[d8] is the labelled analogue of Prulifloxacin, which is an orally active fluoroquinolone antibiotic with a broad spectrum of activity against Gram-positive and Gram-negative bacteria. Synonyms: Prulifloxacin-d8; 6-Fluoro-1-methyl-7-[4-[(5-methyl-2-oxo-1,3-dioxol-4-yl)methyl]-1-(piperazinyl-d8)]-4-oxo-1H,4H-[1,3]thiazeto[3,2-a]quinoline-3-carboxylic Acid; NM 441-d8; Quisnon-d8; Sword-d8. Grade: ≥95%. CAS No. 1246819-37-3. Molecular formula: C21H12D8FN3O6S. Mole weight: 469.52. BOC Sciences 2
Prunasin Prunasin is a inhibitor of DNA Polymerase β [1]. Uses: Scientific research. Group: Natural products. CAS No. 99-18-3. Pack Sizes: 1 mg; 5 mg. Product ID: HY-N1548. MedChemExpress MCE
prunasin β-glucosidase Highly specific; does not act on amygdalin, linamarin or gentiobiose. (cf. EC 3.2.1.21 β-glucosidase). Group: Enzymes. Synonyms: prunasin hydrolase. Enzyme Commission Number: EC 3.2.1.118. CAS No. 9023-41-0. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3801; prunasin β-glucosidase; EC 3.2.1.118; 9023-41-0; prunasin hydrolase. Cat No: EXWM-3801. Creative Enzymes
Prune Fruit Powder Prune Fruit Powder. Pharma Resources International LLC
CA, FL & NJ
Prunella Prunella. CAS No. MIXTURE. VIGON Item # 502833. Categories: Speciality Ingrdients Suppliers, Fragrances, Perfumers, herbaceous. Vigon
America & Internationally
Prunetin ?98.0% (TLC). Group: Chemical class. Alfa Chemistry Analytical Products
Prunetin Prunetin, an O-methylated isoflavone, possesses anti-inflammatory activity. Prunetin is a potent human aldehyde dehydrogenases inhibitor [1] [2]. Uses: Scientific research. Group: Natural products. CAS No. 552-59-0. Pack Sizes: 5 mg; 10 mg. Product ID: HY-N2597. MedChemExpress MCE
Prunetin Botanical Source: Group: Biochemicals. Alternative Names: Padmakastein, Prunusetin. Grades: Plant Grade. CAS No. 552-59-0. Pack Sizes: 5mg, 10mg. US Biological Life Sciences. USBiological 9
Worldwide
Prunin Prunin is a potent inhibitor of human enterovirus A71 (HEVA71). Prunin shows strong inhibitory activity against protein tyrosine phosphatase 1B (PTP1B), with an IC50 of 5.5 μM. Uses: Designed for use in research and industrial production. Product Category: Inhibitors. Appearance: Solid. CAS No. 529-55-5. Molecular formula: C21H22O10. Mole weight: 434.39. Purity: 0.9992. Canonical SMILES: O=C1C[C@@H](C2=CC=C(O)C=C2)OC3=CC(O[C@H]4[C@@H]([C@H]([C@@H]([C@@H](CO)O4)O)O)O)=CC(O)=C13. Product ID: ACM529555. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry.
Prunin Prunin is a potent inhibitor of human enterovirus A71 (HEVA71). Prunin shows strong inhibitory activity against protein tyrosine phosphatase 1B (PTP1B), with an IC 50 of 5.5 μM [1] [2]. Uses: Scientific research. Group: Natural products. Alternative Names: Naringenin 7-0-glucoside. CAS No. 529-55-5. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg. Product ID: HY-N1549. MedChemExpress MCE
Prussian Blue 25g Pack Size. Group: Research Organics & Inorganics, Salts, Stains & Indicators. Formula: Fe4[Fe(CN)6]3. CAS No. 14038-43-8. Prepack ID 79912360-25g. Molecular Weight 859.24. See USA prepack pricing. Molekula Americas
Prussian blue insoluble Prussian blue soluble is a good adsorbent to be used as antidotes for poisoning with cesium or thallium ions. Prussian blue soluble has anticancerous and antibacterial properties. Prussian blue soluble can be used as a contrast agent in photoacoustic and magnetic resonance imaging (MRI) [1] [2] [3] [4]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: Iron(III) ferrocyanide; Milori blue. CAS No. 14038-43-8. Pack Sizes: 100 mg; 500 mg; 1 g. Product ID: HY-106594A. MedChemExpress MCE
Prussian blue insoluble, Technical grade Prussian blue insoluble, Technical grade. Group: Biochemicals. Grades: Purified. CAS No. 14038-43-8. Pack Sizes: 50g, 100g. US Biological Life Sciences. USBiological 8
Worldwide
Pruvanserin Pruvanserin (EMD 281014 free acid) is a selective 5-HT2A receptor antagonist. Pruvanserin alleviates tactile allodynia in diabetic rats. Pruvanserin can also be used for research of insomnia [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: EMD 281014 free acid; LY 2422347. CAS No. 443144-26-1. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-106246. MedChemExpress MCE
Pruvanserin Hydrochloride (EMD 281014) Pruvanserin Hydrochloride is a new class of selective, non-basic 5-HT2A receptor antagonists. Group: Biochemicals. Alternative Names: 1-[ (3-Cyano-1H-indol-7-yl) carbonyl]-4-[2- (4-fluorophenyl) ethyl]piperazine Monohydrochloride; EMD 281014; LSN 2420586; LY 2422347 HCl; LY 2422347 HCl; 7-[[4-[2-(4-Fluorophenyl)ethyl]-1-piperazinyl]carbonyl]-1H-indole-3-carbonitrile hydrochloride. Grades: Highly Purified. CAS No. 443144-27-2. Pack Sizes: 10mg, 50mg. Molecular Formula: C22H22ClFN4O, Molecular Weight: 412.89. US Biological Life Sciences. USBiological 5
Worldwide
Pruvonertinib YK-029A is an orally active inhibitor of mutant EGFR , targeting to both the T790M mutations (EGFR T790M ) and exon 20 insertion of EGFR (EGFRex20ins). YK-029A exhibits significant antitumor activity, and results tumor regression in EGFRex20ins-driven PDX models [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: YK-029A. CAS No. 2064269-82-3. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg. Product ID: HY-155537. MedChemExpress MCE

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products