American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
protochlorophyllide reductase The enzyme catalyses a light-dependent trans-reduction of the D-ring of protochlorophyllide; the product has the (7S,8S)-configuration. Group: Enzymes. Synonyms: NADPH2-protochlorophyllide oxidoreductase; NADPH-protochlorophyllide oxidoreductase; NADPH-protochlorophyllide reductase; protochlorophyllide oxidoreductase (ambiguous); protochlorophyllide photooxidoreductase; light-dependent protochlorophyllide reductase. Enzyme Commission Number: EC 1.3.1.33. CAS No. 68518-04-7. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1306; protochlorophyllide reductase; EC 1.3.1.33; 68518-04-7; NADPH2-protochlorophyllide oxidoreductase; NADPH-protochlorophyllide oxidoreductase; NADPH-protochlorophyllide reductase; protochlorophyllide oxidoreductase (ambiguous); protochlorophyllide photooxidoreductase; light-dependent protochlorophyllide reductase. Cat No: EXWM-1306. Creative Enzymes
Protodeltonin Protodeltonin. Group: Biochemicals. Grades: Plant Grade. CAS No. 94992-08-2. Pack Sizes: 10mg. Molecular Formula: C51H84O23, Molecular Weight: 1065.21. US Biological Life Sciences. USBiological 9
Worldwide
protodeoxyviolaceinate monooxygenase The enzyme, characterized from the bacterium Chromobacterium violaceum, participates in the biosynthesis of the violet pigment violacein. The product, protoviolaceinate, can be acted upon by EC 1.14.13.224, violacein synthase, leading to violacein production. However, it is very labile, and in the presence of oxygen can undergo non-enzymic autooxidation to the shunt product proviolacein. Group: Enzymes. Synonyms: vioD (gene name); protoviolaceinate synthase. Enzyme Commission Number: EC 1.14.13.217. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0819; protodeoxyviolaceinate monooxygenase; EC 1.14.13.217; vioD (gene name); protoviolaceinate synthase. Cat No: EXWM-0819. Creative Enzymes
Protodioscin Protodioscin. Group: Biochemicals. Alternative Names: Saponin C. Grades: Plant Grade. CAS No. 55056-80-9. Pack Sizes: 20mg. Molecular Formula: C51H84O22, Molecular Weight: 1049.2. US Biological Life Sciences. USBiological 9
Worldwide
Protodioscin Protodioscin - Product ID: NST-10-58. Category: Sterols. Purity: 98%. Test method: HPLC. CAS No. 55056-80-9. Pack Sizes: 0,05g, 0,1g, 0,25g, 0,5g. Appearance: White to beige colored powder. Molecular formula: C51H84O22. Mole weight: 1049.2. Storage: +2 … +8 °C. NATURE SCIENCE TECHNOLOGIES
Protodioscin Protodioscin, a major steroidal saponin in Trigonella foenum-graecum Linn., has been shown to exhibit multiple biological actions, such as anti-hyperlipidemia, anti-cancer, sexual effects and cardiovascular properties. Uses: Scientific research. Group: Natural products. CAS No. 55056-80-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-N0799. MedChemExpress MCE
Protodioscin Protodioscin has been demonstrated to trigger release of nitric oxide in corpus cavernosum tissue, and also to produce statistically significant increases in the levels of the hormones testosterone, dihydrotestosterone and dehydroepiandrosterone in animal studies. Uses: Antihyperlipidemic. Synonyms: (3b, 25R)-26-(b-D-glucopyranosyloxy)-22-hydroxyfurost-5-en-3-yl O-6-deoxy-a-L-mannopyranosyl-(1-2)-O-[6-deoxy-a-L-mannopyranosyl-(1-4)]-b-D-glucopyranoside. Grades: >98%. CAS No. 55056-80-9. Molecular formula: C51H84O22. Mole weight: 1049.22. BOC Sciences
Protodioscin 26-O-b-D-Glycopyranosyl-22-hydroxyfurost-5-ene-3b,26-diol-3-O-b-diglucorhamnoside. CAS No. 55056-80-9. Product ID: 2-08397. Molecular formula: C51H84O22. Mole weight: 1049.21. Purity: 0.98. Properties: mp 190-196C. CarboMer Inc
protodioscin 26-O-β-D-glucosidase The enzyme has been characterized from the plants Cheilocostus speciosus and Solanum torvum. It also hydrolyses the 26-β-D-glucose group from related steroid glucosides such as protogracillin, torvoside A and torvoside H. Group: Enzymes. Synonyms: F26G; torvosidase; CSF26G1; furostanol glycoside 26-O-β-D-glucosidase; furostanol 26-O-β-D-glucoside glucohydrolase. Enzyme Commission Number: EC 3.2.1.186. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3870; protodioscin 26-O-β-D-glucosidase; EC 3.2.1.186; F26G; torvosidase; CSF26G1; furostanol glycoside 26-O-β-D-glucosidase; furostanol 26-O-β-D-glucoside glucohydrolase. Cat No: EXWM-3870. Creative Enzymes
Protogracillin Protogracillin. Group: Biochemicals. Grades: Plant Grade. CAS No. 54848-30-5. Pack Sizes: 10mg. Molecular Formula: C51H84O23, Molecular Weight: 1065.21. US Biological Life Sciences. USBiological 9
Worldwide
Protoneogracillin Protoneogracillin, a furostanol glycoside, shows anti-fungal activity against the plant pathogenic fungus P.oryzae (MMDC=94.0 μM) and cytotoxic activity on K562 cancer cells (IC50=6.6 μM). Uses: Designed for use in research and industrial production. Product Category: Inhibitors. Appearance: Solid. CAS No. 191334-50-6. Molecular formula: C51H84O23. Mole weight: 1065.2. Canonical SMILES: C[C@@]12[C@](C[C@@]3([H])[C@]2([H])[C@@H]([C@](O)(O3)CC[C@H](C)CO[C@@H]4O[C@@H]([C@H]([C@@H]([C@H]4O)O)O)CO)C)([H])[C@@]5([H])[C@]([C@@]6(C(C[C@H](CC6)O[C@H]7[C@@H]([C@H]([C@@H]([C@H](O7)CO)O)O[C@@H]8O[C@@H]([C@H]([C@@H]([C@H]8O)O)O)CO)O[C@H]9[C@@H]([C@@H]([C@H]([C@@H](O9)C)O)O)O)=CC5)C)([H])CC1. Product ID: ACM191334506. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry.
proton-translocating NAD(P)+ transhydrogenase The enzyme is a membrane bound proton-translocating pyridine nucleotide transhydrogenase that couples the reversible reduction of NADP by NADH to an inward proton translocation across the membrane. In the bacterium Escherichia coli the enzyme provides a major source of cytosolic NADPH. Detoxification of reactive oxygen species in mitochondria by glutathione peroxidases depends on NADPH produced by this enzyme. Group: Enzymes. Synonyms: pntA (gene name); pntB (gene name); NNT (gene name). Enzyme Commission Number: EC 7.1.1.1 (Formerly EC 1.6.1.5). Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1578; proton-translocating NAD(P)+ transhydrogenase; EC 1.6.1.5; pntA (gene name); pntB (gene name); NNT (gene name). Cat No: EXWM-1578. Creative Enzymes
Proto-oncogene PIM1 (191-199) Proto-oncogene PIM1 (191-199) is a 9-aa peptide. Pim-1's role in oncogenic signalling has led to it becoming a widely studied target in cancer research, with numerous drug candidates under investigation which target it. BOC Sciences 3
Protopanaxadiol, 20S- Protopanaxadiol, 20S-. Group: Biochemicals. CAS No. 30636-90-9. Pack Sizes: 5mg. US Biological Life Sciences. USBiological 9
Worldwide
protopanaxadiol 6-hydroxylase A heme-thiolate protein (P-450). Involved in the biosynthetic pathway of ginsenosides. Isolated from the rhizomes of ginseng (Panax ginseng). Group: Enzymes. Synonyms: protopanaxatriol synthase; P6H; CYP716A53v2; protopanaxadiol,NADPH:O2 oxidoreductase (6α-hydroxylating). Enzyme Commission Number: EC 1.14.13.184. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0783; protopanaxadiol 6-hydroxylase; EC 1.14.13.184; protopanaxatriol synthase; P6H; CYP716A53v2; protopanaxadiol,NADPH:O2 oxidoreductase (6α-hydroxylating). Cat No: EXWM-0783. Creative Enzymes
Protopanaxatriol Botanical Source: Group: Biochemicals. Alternative Names: (20R)-Protopanaxatriol. Grades: Plant Grade. CAS No. 1453-93-6. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 9
Worldwide
Protopanaxatriol, 20S- Protopanaxatriol, 20S-. Group: Biochemicals. CAS No. 34080-08-5. Pack Sizes: 5mg. US Biological Life Sciences. USBiological 9
Worldwide
Protopine Protopine (Corydinine), an isoquinoline alkaloid, is a specific reversible and competitive inhibitor of acetylcholinesterase. Protopine exhibits anti-inflammation, anti-microbial, anti-angiogenic and anti-tumour activity [1] [2]. Uses: Scientific research. Group: Natural products. Alternative Names: Corydinine. CAS No. 130-86-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-N0793. MedChemExpress MCE
Protopine Protopine is a Ca2+ channel blocker and antiplatelet agent. Immunomodulator. Group: Biochemicals. Alternative Names: 4,6,7,14-Tetrahydro-5-methyl-. Grades: Highly Purified. CAS No. 130-86-9. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 2
Worldwide
protopine 6-monooxygenase A heme-thiolate protein (P-450) involved in benzophenanthridine alkaloid synthesis in higher plants. Group: Enzymes. Synonyms: protopine 6-hydroxylase. Enzyme Commission Number: EC 1.14.13.55. CAS No. 128561-60-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0862; protopine 6-monooxygenase; EC 1.14.13.55; 128561-60-4; protopine 6-hydroxylase. Cat No: EXWM-0862. Creative Enzymes
Protopine hydrochloride ?98%, solid. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Protopine N-Oxide Protopine N-Oxide. Uses: For analytical and research use. Group: Impurity standards. CAS No. 87264-51-5. Molecular formula: C20H19NO6. Mole weight: 369.37. Catalog: APS87264515. SMILES: C[N+]1([O-])CCc2cc3OCOc3cc2C(=O)Cc4ccc5OCOc5c4C1. Format: Neat. Shipping: Room Temperature. Alfa Chemistry Analytical Products 4
Protoporphyrinato zinc Protoporphyrinato zinc. Group: other materials. Alternative Names: PROTOPORPHYRINATO ZINC; dihydrogen [3, 8, 13, 17-tetramethyl-7, 12-divinyl-21H, 23H-porphine-2, 18-dipropionato(4-)-N21, N22, N23, N24]zincate(4-); Zinc protoporphyrin trihydrate; Zinc protoporphyrin trihydrate, 95+%. CAS No. 15442-64-5. Product ID: zinc; 3-[18-(2-carboxyethyl)-8,13-bis(ethenyl)-3,7,12,17-tetramethylporphyrin-21,23-diid-2-yl]propanoic acid. Molecular formula: 626g/mol. Mole weight: C34H32N4O4Zn. CC1=C (C2=CC3=NC (=CC4=C (C (=C ([N-]4)C=C5C (=C (C (=N5)C=C1[N-]2)C)C=C)C)C=C)C (=C3CCC (=O)O)C)CCC (=O)O. [Zn+2]. InChI=1S/C34H34N4O4. Zn/c1-7-21-17 (3)25-13-26-19 (5)23 (9-11-33 (39)40)31 (37-26)16-32-24 (10-12-34 (41)42)20 (6)28 (38-32)15-30-22 (8-2)18 (4)27 (36-30)14-29 (21)35-25; /h7-8, 13-16H, 1-2, 9-12H2, 3-6H3, (H4, 35, 36, 37, 38, 39, 40, 41, 42); /q; +2/p-2. FUTVBRXUIKZACV-UHFFFAOYSA-L. Alfa Chemistry Materials 6
protoporphyrin ferrochelatase The enzyme catalyses the terminal step in the heme biosynthesis pathways of eukaryotes and Gram-negative bacteria. Group: Enzymes. Synonyms: ferro-protoporphyrin chelatase; iron chelatase (ambiguous); heme synthetase (ambiguous); heme synthase (ambiguous); protoheme ferro-lyase; ferrochelatase (ambiguous). Enzyme Commission Number: EC 4.99.1.1. CAS No. 9012-93-5. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5358; protoporphyrin ferrochelatase; EC 4.99.1.1; 9012-93-5; ferro-protoporphyrin chelatase; iron chelatase (ambiguous); heme synthetase (ambiguous); heme synthase (ambiguous); protoheme ferro-lyase; ferrochelatase (ambiguous). Cat No: EXWM-5358. Creative Enzymes
Protoporphyrin IX Protoporphyrin IX is a final intermediate in the heme biosynthetic pathway, which acts as a radiation sensitizer enhancing ROS generation even in a hypoxic state and inducing DNA damage. Protoporphyrin IX also acts as a photo sensitizer undergoing photobleaching that occurs through direct degradation by light irradiation. Protoporphyrin IX is formed and accumulated following 5-aminolevulinic acid (5-ALA) (HY-W000450) administration in the tumor cells of rats. Protoporphyrin IX causes selective improvement of basal cell carcinoma when activated red fluorescence of a peak wavelength at 405 nm. Protoporphyrin IX is promising for research of sonodynamic and photodynamic agents for a wide range of cancers, such as bladder cancer and nodular basal cell carcinoma [1] [2] [3] [4] [5]. Uses: Scientific research. Group: Natural products. CAS No. 553-12-8. Pack Sizes: 100 mg; 250 mg. Product ID: HY-B1247. MedChemExpress MCE
Protoporphyrin IX Protoporphyrin IX. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Protoporphyrin; Ooporphyrin. Product Category: Porphyrins and Phthalocyanines. Appearance: Purple powder. CAS No. 553-12-8. Molecular formula: C34H34N4O4. Mole weight: 562.67. Purity: 0.95. IUPACName: 3-[18-(2-carboxyethyl)-8,13-bis(ethenyl)-3,7,12,17-tetramethyl-22,23-dihydroporphyrin-2-yl]propanoic acid. Product ID: ACM553128-3. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry.
Protoporphyrin IX Created by the enzyme protoporphyrinogen oxidase, protoporphyrin IX is an important precursor to biologically essential prosthetic groups. Uses: Metabolism of porphyrin. Synonyms: Protoporphyrin; 3-[18-(2-carboxyethyl)-8,13-bis(ethenyl)-3,7,12,17-tetramethyl-22,23-dihydroporphyrin-2-yl]propanoic acid. Grades: ≥95%. CAS No. 553-12-8. Molecular formula: C34H34N4O4. Mole weight: 562.66. BOC Sciences 8
Protoporphyrin IX ?95%. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
Protoporphyrin IX Protoporphyrin IX is an important precursor to biologically essential prosthetic groups such as heme, cytochrome c, and chlorophylls. As a result, a number of organisms are able to synthesize this tetrapyrrole from basic precursors such as glycine and succinyl CoA, or glutamate. Despite the wide range of organisms that synthesize protoporphyrin IX the process is largely conserved from bacteria to mammals with a few distinct exceptions in higher plants.[1][2][3]. Group: Biochemicals. Alternative Names: 3,18-Divinyl-2,7,13,17-tetramethylporphine-8, 12-dipropionic acid. Grades: Reagent Grade. CAS No. 553-12-8. Pack Sizes: 100mg, 250mg, 1g, 5g. US Biological Life Sciences. USBiological 5
Worldwide
Protoporphyrin IX-d6 Protoporphyrin IX-d6 is the labeled version of Protoporphyrin IX (CAS: 553-12-8). Protoporphyrin IX (PPIX) is ubiquitously present in all living cells in small amounts as a precursor of heme and PPIX-based strategies have been used for cancer diagnosis and treatment. It can be used in biological study for role of protoporphyrin IX in skin photosensitivity, biliary stones, hepatobiliary damage, liver failure and cancer diagnosis and treatment in human. Group: Biochemicals. Alternative Names: Protoporphyrin IX di-Me Ester-d6; 3,7,12,17-Tetramethyl-8,13-divinyldimethyl Ester 2,18-Porphinedipropionic Acid-d6. Grades: Highly Purified. CAS No. 553-12-8 Unlabeled. Pack Sizes: 500ug, 2.5mg. Molecular Formula: C??H??D?N?O?, Molecular Weight: 596.75. US Biological Life Sciences. USBiological 5
Worldwide
Protoporphyrin ix,dimethyl ester Protoporphyrin ix,dimethyl ester. Uses: Designed for use in research and industrial production. Additional or Alternative Names: OOPORPYHRIN DIMETHYL ESTER;PROTOPORPHYRIN DIMETHYL ESTER;PROTOPORPHYRIN IX METHYL ESTER;DIMETHYL-8,13-BIS(VINYL)-3,7,12,17-TETRAMETHYL-21H,23H-PORPHINE-2,18-DIPROPIONATE;Dimethyl-8,13-bi8(vinyl)-3,7,12,17-tetramethyl-21H,23H-porphine-2,18-dipropionate. Product Category: Heterocyclic Organic Compound. CAS No. 6164-53-0. Molecular formula: C36H38N4O4. Mole weight: 590.71. Product ID: ACM6164530. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 5
Protoporphyrin IX dimethyl ester Protoporphyrin IX dimethyl ester. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Dimethyl8,13-divinyl-3,7,12,17-tetramethyl-21H,23H-porphine-2,18-dipropionate. Product Category: Porphyrins and Phthalocyanines. Appearance: Magenta solid. CAS No. 5522-66-7. Molecular formula: C36H38N404. Mole weight: 590.71. Purity: 0.95. IUPACName: Methyl3-[8,13-bis(ethenyl)-18-(3-methoxy-3-oxopropyl)-3,7,12,17-tetramethyl-22,23-dihydroporphyrin-2-yl]propanoate. Canonical SMILES: CC1=C(C2=CC3=NC(=CC4=NC(=CC5=C(C(=C(N5)C=C1N2)C=C)C)C(=C4CCC(=O)OC)C)C(=C3C)CCC(=O)OC)C=C. Density: 1.220 ± 0.06 g/ml. Product ID: ACM5522667-2. Alfa Chemistry — ISO 9001:2015 Certified. Categories: 6164-53-0. Alfa Chemistry.
Protoporphyrin IX zinc(II) guanylate cyclase inhibitor. Group: Photonic and optical materials. Alfa Chemistry Analytical Products 2
protoporphyrinogen IX dehydrogenase (menaquinone) This enzyme enables Escherichia coli to synthesize heme in both aerobic and anaerobic environments. Group: Enzymes. Synonyms: HemG. Enzyme Commission Number: EC 1.3.5.3. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1387; protoporphyrinogen IX dehydrogenase (menaquinone); EC 1.3.5.3; HemG. Cat No: EXWM-1387. Creative Enzymes
protoporphyrinogen oxidase This is the last common enzyme in the biosynthesis of chlorophylls and heme. Two isoenzymes exist in plants: one in plastids and the other in mitochondria. This is the target enzyme of phthalimide-type and diphenylether-type herbicides. The enzyme from oxygen-dependent species contains FAD. Also slowly oxidizes mesoporphyrinogen IX. Group: Enzymes. Synonyms: protoporphyrinogen IX oxidase; protoporphyrinogenase; PPO; Protox; HemG; HemY. Enzyme Commission Number: EC 1.3.3.4. CAS No. 53986-32-6. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1378; protoporphyrinogen oxidase; EC 1.3.3.4; 53986-32-6; protoporphyrinogen IX oxidase; protoporphyrinogenase; PPO; Protox; HemG; HemY. Cat No: EXWM-1378. Creative Enzymes
PROTO_PROSY Protonectin PROTO_PROSY Protonectin is an antimicrobial peptide found in Protonectarina sylveirae (Brazilian wasp), and has antibacterial activity against both gram-positive and gram-negative bacteria. It shows potent histamine releasing activities on rat peritoneal mast cells. Synonyms: Ile-Leu-Gly-Thr-Ile-Leu-Gly-Leu-Leu-Lys-Gly-Leu; Protonectin. Grades: ≥96%. Molecular formula: C58H107N13O14. Mole weight: 1210.57. BOC Sciences 4
Protopseudohypericin Protopseudohypericin. Group: Biochemicals. Grades: Plant Grade. CAS No. 54328-09-5. Pack Sizes: 10mg. Molecular Formula: C30H18O9, Molecular Weight: 522.46. US Biological Life Sciences. USBiological 9
Worldwide
Protosappanin B Protosappanin B. Group: Biochemicals. Grades: Plant Grade. CAS No. 102036-29-3. Pack Sizes: 20mg. Molecular Formula: C16H16O6, Molecular Weight: 304.3. US Biological Life Sciences. USBiological 9
Worldwide
protostadienol synthase (17Z)-Protosta-17(20),24-dien-3β-ol is a precursor of the steroidal antibiotic helvolic acid. Group: Enzymes. Synonyms: PdsA; (S)-2,3-epoxysqualene mutase [cyclizing, (17Z)-protosta-17(20),24-dien-3β-ol-forming]. Enzyme Commission Number: EC 5.4.99.32. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5573; protostadienol synthase; EC 5.4.99.32; PdsA; (S)-2,3-epoxysqualene mutase [cyclizing, (17Z)-protosta-17(20),24-dien-3β-ol-forming]. Cat No: EXWM-5573. Creative Enzymes
Protostemonine Botanical Source: Group: Biochemicals. Grades: Plant Grade. CAS No. 27495-40-5. Pack Sizes: 10mg, 20mg. US Biological Life Sciences. USBiological 9
Worldwide
Protostemotinine Formula: Group: Biochemicals. Grades: Plant Grade. CAS No. 169534-85-4. Pack Sizes: 5mg, 10mg. US Biological Life Sciences. USBiological 9
Worldwide
Protriptyline-10,11-Epoxide A metabolite of Protriptyline. Protriptyline is a tricyclic antidepressant for the treatment of depression and ADHD. Grades: > 95%. Molecular formula: C19H21NO. Mole weight: 279.39. BOC Sciences 7
Protriptyline-d3 hydrochloride 100 ?g/mL in methanol (as free base), ampule of 1 mL, certified reference material. Group: Certified reference materials (crms). Alfa Chemistry Analytical Products
Protriptyline-d3 Hydrochloride Protriptyline-d3 Hydrochloride. Group: Biochemicals. Alternative Names: N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propanamine-d3 Hydrochloride; N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propanamine-d3 Hydrochloride; N-Methyl-5H-Dibenzo[a, d]cycloheptene-5-propylamine-d3 Hydrochloride; Concordin-d3; MK-240-d3; Maximed-d3; Maximet-d3; N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propylamine-d3 Hydrochloride; Normethyl EX4442-d3; Protriptyline-d3 Hydrochloride; Protryptyline-d3 Hydrochloride; Triptil-d3 Hydrochloride; Vivactil-d3 Hydrochloride. Grades: Highly Purified. CAS No. 1435934-21-6. Pack Sizes: 1mg. Molecular Formula: C19H19D3ClN, Molecular Weight: 302.86. US Biological Life Sciences. USBiological 3
Worldwide
Protriptyline hydrochloride Protriptyline hydrochloride is a tricyclic antidepressant (TCA), specifically a secondary amine, for the treatment of depression and ADHD. Uses: Scientific research. Group: Signaling pathways. CAS No. 1225-55-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-B0949. MedChemExpress MCE
Protriptyline Hydrochloride The hydrochloride salt of Protriptyline which is a norepinephrine uptake blocker that could be effective as an antidepressant. Uses: The hydrochloride salt of protriptyline which is a norepinephrine uptake blocker that could be effective as an antidepressant. Synonyms: PROTRIPTYLINE HCL;PROTRIPTYLINE HYDROCHLORIDE; 5-(3-methylaminopropyl)-5h-dibenzo(a, d)cycloheptenehydrochloride; concordin; d)cyclohepten-5-propylamine, n-methyl-5h-dibenzo(hydrochloride; maximed; mk-240; n-methyl-5h-dibenzo(a, d)cycloheptene-5-propylaminehydroc. Grades: 95%. CAS No. 1225-55-4. Molecular formula: C19H21N.HCl. Mole weight: 299.84. BOC Sciences 7
Protriptyline Hydrochloride Protriptyline Hydrochloride. Group: Biochemicals. Alternative Names: N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propanamine Hydrochloride; N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propanamine Hydrochloride; N-Methyl-5H-Dibenzo[a, d]cycloheptene-5-propylamine Hydrochloride; Concordin; MK-240; Maximed; Maximet; N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propylamine Hydrochloride; Normethyl EX4442; Protriptyline hydrochloride; Protryptyline Hydrochloride; Triptil Hydrochloride; Vivactil Hydrochloride. Grades: Highly Purified. CAS No. 1225-55-4. Pack Sizes: 50mg. Molecular Formula: C19H22ClN, Molecular Weight: 299.839999999999. US Biological Life Sciences. USBiological 3
Worldwide
Protriptyline-N-Oxide A metabolite of Protriptyline. Protriptyline is a tricyclic antidepressant for the treatment of depression and ADHD. Grades: > 95%. Molecular formula: C19H21NO. Mole weight: 279.39. BOC Sciences 7
Pro-Trp-OH Pro-Trp-OH. Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 100mg, 250mg. US Biological Life Sciences. USBiological 5
Worldwide
Pro-Trp-OH Synonyms: L-Prolyl-L-tryptophan; Pro Trp OH. Grades: ≥ 99% (TLC). CAS No. 35310-39-5. Molecular formula: C16H19N3O3. Mole weight: 301.35. BOC Sciences 5
ProTx I ProTx I, a toxin that was originally isolated from the venom of Thrixopelma pruriens (Peruvian green velvet tarantula), blocks native mouse CaV3.1 channel and recombinant human CaV3.1 channel currents similarly, and blocks to a lesser extent CaV3.2 and CaV3.3 channel currents. Synonyms: ProTxI; ProTx-I; H-Glu-Cys(1)-Arg-Tyr-Trp-Leu-Gly-Gly-Cys(2)-Ser-Ala-Gly-Gln-Thr-Cys(3)-Cys(1)-Lys-His-Leu-Val-Cys(2)-Ser-Arg-Arg-His-Gly-Trp-Cys(3)-Val-Trp-Asp-Gly-Thr-Phe-Ser-OH; L-alpha-glutamyl-L-cysteinyl-L-arginyl-L-tyrosyl-L-tryptophyl-L-leucyl-glycyl-glycyl-L-cysteinyl-L-seryl-L-alanyl-glycyl-L-glutaminyl-L-threonyl-L-cysteinyl-L-cysteinyl-L-lysyl-L-histidyl-L-leucyl-L-valyl-L-cysteinyl-L-seryl-L-arginyl-L-arginyl-L-histidyl-glycyl-L-tryptophyl-L-cysteinyl-L-valyl-L-tryptophyl-L-alpha-aspartyl-glycyl-L-threonyl-L-phenylalanyl-L-serine (2->16),(9->21),(15->28)-tris(disulfide). Grades: >98%. CAS No. 484598-35-8. Molecular formula: C171H245N53O47S6. Mole weight: 3987.51. BOC Sciences 3
ProTx I ProTx I. Group: Biochemicals. Grades: Purified. CAS No. 484598-35-8. Pack Sizes: 100ug. US Biological Life Sciences. USBiological 5
Worldwide
ProTx II ProTx II is a selective NaV1.7 channel blocker with 100-fold selectivity over other sodium channel subtypes. Synonyms: YCQKWMWTCDSERKCCEGMVCRLWCKKKLW. Grades: >98%. CAS No. 484598-36-9. Molecular formula: C168H250N46O41S8. Mole weight: 3826.59. BOC Sciences 3
ProTx II ProTx II. Group: Biochemicals. Grades: Purified. CAS No. 484598-36-9. Pack Sizes: 100ug. US Biological Life Sciences. USBiological 5
Worldwide
ProTx III ProTx III, isolated from the venom of the Peruvian green-velvet tarantula Thrixopelma pruriens, is a potent Nav1.7 blocker (IC50 = 2.5 nM) and also inhibits Nav1.1, Nav1.2, Nav1.3 and Nav1.6 in the nanomolar range. Synonyms: DCLKFGWKCNPRNDKCCSGLKCGSNHNWCKLHI. Grades: >98%. Molecular formula: C162H246N52O43S6. Mole weight: 3802.41. BOC Sciences 3
Pro-Tyr-OH Synonyms: L-Prolyl-L-tyrosine; Pro Tyr OH. Grades: ≥ 99% (Assay). CAS No. 19786-36-8. Molecular formula: C14H18N2O4. Mole weight: 278.31. BOC Sciences 5
Pro-Tyr-OH Pro-Tyr-OH. Group: Biochemicals. Alternative Names: L-Prolyl-L-tyrosine. Grades: Highly Purified. CAS No. 19786-36-8. Pack Sizes: 100mg. US Biological Life Sciences. USBiological 8
Worldwide
Pro-Tyr-OH ≥97%. Pro-Tyr-OH ≥97%. Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 100mg. US Biological Life Sciences. USBiological 5
Worldwide
Pro-Urokinase from Human, recombinant Urokinase or Urokinase-type plasminogen activator (uPA) is a serine protease (EC 3.4.21.73). It is secreted as a single-chain zymogen, pro-Urokinase, possessing little or no intrinsic enzymatic activity. The single chain zymogen is converted into the active two chain enzyme (tcuPA) by cleavage of the bond between Lys157 and Ile158. After activation, Urokinase specifically cleaves the proenzyme plasminogen to form the active enzyme plasmin. The active plasmin then catalyzes the breakdown of fibrin polymers of blood clots. Urokinase is involved in a number of biological functions including fibrinolysis, embryogenesis, cell migration, tissue remodeling, ovulation, and wound healing. Additionally, it is a potent marker of invasion and metastasis in a variety of human cancers associated with breast, stomach, colon, bladder, ovary, brain and endometrium. Group: Enzymes. Synonyms: Single chain Urokinase-type plasminogen activator; s. Purity: > 90% by SDS-PAGE. Pro-Urokinase. Mole weight: 49.3 kDa. Activity: >1200 mU/mg. Storage: Stable at -80°C for at least 1 year as supplied. Store reconstituted aliquots at -80°C. Avoid repeated freeze and thaw cycles. Form: Lyophilized powder. Source: E. coli. Species: Human. Single chain Urokinase-type plasminogen activator; scuPA; Urokinase-type Plasminogen Activator uPA; PLAU; Pro-Urokinase. Cat No: NATE-1689. Creative Enzymes
Provichem 0216 Provichem 0216. Group: Polymers. Alfa Chemistry Materials 3
Provichem 1102 Provichem 1102. Group: Polymers. Alfa Chemistry Materials 3
Provigil Provigil. CAS No: 68693-11-8 Sarchem Laboratories
Sarchem Laboratories New Jersey NJ
Proviplast 17820 Proviplast 17820. Group: Polymers. Alfa Chemistry Materials 3
Proviplast 1784 Proviplast 1784. Group: Polymers. Alfa Chemistry Materials 3
Pro Vitamin A 10% (Beta Carotene 10%) Pro Vitamin A 10% (Beta Carotene 10%) - Agriculture Chemicals. SUPPLIERS TO BUSINESS CUSTOMERS ONLY. Redox
North America & APAC
Proxalutamide Proxalutamide is a non-steroidal androgen receptor (AR) antagonist with potential anti-tumor activity for the treatment of prostate cancer and breast cancer. Synonyms: GT 0918; pruxelutamide; Benzonitrile, 4-[4,4-dimethyl-3-[6-[3-(2-oxazolyl)propyl]-3-pyridinyl]-5-oxo-2-thioxo-1-imidazolidinyl]-3-fluoro-2-(trifluoromethyl)-. Grades: 98.79%. CAS No. 1398046-21-3. Molecular formula: C24H19F4N5O2S. Mole weight: 517.5. BOC Sciences 10
Pro-X dipeptidase Transferred to EC 3.4.13.18. Group: Enzymes. Enzyme Commission Number: EC 3.4.13.8. CAS No. 9025-33-6. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4041; Pro-X dipeptidase; EC 3.4.13.8; 9025-33-6. Cat No: EXWM-4041. Creative Enzymes
Proxmethol Proxmethol, a analogue of hydroxytetramethylpiperidine, could be used in studies of medicine resistance reversal in neoplastic diseases. Synonyms: 3-(Hydroxymethyl)-1-oxy-2,2,5,5-tetramethylpyrrolidine; 3-(Hydroxymethyl)-2,2,5,5-tetramethyl-1-pyrrolidinyloxy. Grades: > 95%. CAS No. 27298-75-5. Molecular formula: C9H19NO2. Mole weight: 173.26. BOC Sciences 7
Proxyfan maleate Proxyfan oxalate is a high affinity histamine H3 receptor ligand (pKi = 8.62), acting as a protean agonist with activity ranges from full agonist to inverse agonist depending on system used. Uses: Histamine antagonists. Synonyms: 4-[3-(Phenylmethoxy)propyl]-1H-imidazole oxalate. Grades: ≥98% by HPLC. CAS No. 177708-09-7. Molecular formula: C17H20N2O5. Mole weight: 332.4. BOC Sciences 10
Proxyfan oxalate Proxyfan oxalate. Group: Biochemicals. Grades: Purified. CAS No. 177708-09-7. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products