A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| Phosphorus (V) Oxide | Phosphorus (V) Oxide. Grades: 99.998% Extremely High (>=99%). CAS No. 1314-56-3. Pack Sizes: Gram Quantities: 100 gm, 500 gm. Order Number: 2857. |  www.prochemonline.com |
| Phosphorus(V) Oxychloride | High purity Phosphorus(V) Oxychloride is used as an n-type dopant in the semiconductor industry for applications such as solar cell fabrication. Group: Biochemicals. Grades: Highly Purified. CAS No. 10025-87-3. Pack Sizes: 5g, 25g. Molecular Formula: Cl3OP, Molecular Weight: 153.33. US Biological Life Sciences. |  Worldwide |
| Phosphorylase a from rabbit muscle | Phosphorylase a from rabbit muscle. Uses: For analytical and research use. CAS No. 9032-10-4. EC Number: 232-878-8. Catalog: AP9032104. |  |
| Phosphorylase a, rabbit muscle | Phosphorylase a, rabbit muscle is glycogen phosphorylase isolated from rabbit muscle. Phosphorylase a, rabbit muscle catalyzes glycogenolysis, converting glycogen and inorganic phosphate into glucose-1-phosphate to supply energy for muscle contraction[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 9032-10-4. Pack Sizes: 5 mg. Product ID: HY-P2734. |  |
| Phosphorylase b from rabbit muscle | Phosphorylase b from rabbit muscle. Alternative Names: α-Glucan Phosphorylase. CAS No. 9012-69-5. Product ID: ACM9012695-1. Alfa Chemistry - ISO 9001:32057 Certified. |  |
| phosphorylase kinase | Requires Ca2+ and calmodulin for activity. The enzyme phosphorylates a specific serine residue in each of the subunits of the dimeric phosphorylase b. For muscle phosphorylase but not liver phosphorylase, this is accompaniedby a further dimerization to form a tetrameric phosphorylase. The enzyme couples muscle contraction with energy production via glycogenolysis-glycolysis by catalysing the Ca2+-dependent phosphorylation and activation of glycogen phosphorylase b. The γ subunit of the tetramericenzyme is the catalytic subunit. Group: Enzymes. Synonyms: dephosphophosphorylase kinase; glycogen phosphorylase kinase; PHK; phosphorylase b kinase; phosphorylase B kinase; phosphorylase kinase (phosphorylating); STK17. Enzyme Commission Number: EC 2.7.11.19. CAS No. 9001-88-1. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3138; phosphorylase kinase; EC 2.7.11.19; 9001-88-1; dephosphophosphorylase kinase; glycogen phosphorylase kinase; PHK; phosphorylase b kinase; phosphorylase B kinase; phosphorylase kinase (phosphorylating); STK17. Cat No: EXWM-3138. |  |
| Phosphorylase Kinase β-Subunit Fragment 420-436 | It is the β-subunit fragment (peptide 430-436) of phosphorylase kinase. Phosphokinase is a serine/threonine specific protein kinase that activates glycogen phosphorylase to release glucose-1-phosphate from glycogen. Synonyms: Lys-Arg-Asn-Pro-Gly-Ser-Gln-Lys-Arg-Phe-Pro-Ser-Asn-Cys-Gly-Arg-Asp; L-lysyl-L-arginyl-L-asparagyl-L-prolyl-glycyl-L-seryl-L-glutaminyl-L-lysyl-L-arginyl-L-phenylalanyl-L-prolyl-L-seryl-L-asparagyl-L-cysteinyl-glycyl-L-arginyl-L-aspartic acid; Phosphorylase Kinase b-Subunit Fragment (420-436). Grade: ≥95%. CAS No. 150829-21-3. Molecular formula: C79H131N31O25S. Mole weight: 1947.14. |  |
| Phosphorylcholine | Phosphorylcholine. Alternative Names: Choline phosphate; N-Trimethyl-2-aminoethylphosphonate; o-Phosphocholine; phosphorylcholine; O-Phosphonocholine; O-phosphoryl choline. CAS No. 107-73-3. Purity: 97%+. Product ID: ACM107733. Molecular formula: C5H15ClNO4P. Mole weight: 219.60. IUPAC Name: phosphocholine. Alfa Chemistry - ISO 9001:32057 Certified. | |
| Phosphorylcholine | Phosphatidylcholine is the main phospholipid component in eukaryotic biofilms. Phosphatidylcholine exists in commensal or pathogenic bacteria associated with eukaryotes in prokaryotes. Phosphorylcholine exhibits a surprising range of immunomodulatory properties[1]. Uses: Scientific research. Category: Induced disease models products. Alternative Names: Phosphocholine. CAS No. 3616-4-4. Pack Sizes: 10 mM * 1 mL in Water; 100 mg; 500 mg. Product ID: HY-B2233B. | |
| Phosphorylcholine chloride | Phosphorylcholine chloride (Phosphocholine chloride) is the main phospholipid component in eukaryotic biofilms. Phosphorylcholine chloride exists in commensal or pathogenic bacteria associated with eukaryotes in prokaryotes. Phosphorylcholine chloride exhibits a surprising range of immunomodulatory properties[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Phosphocholine chloride. CAS No. 107-73-3. Pack Sizes: 10 mM * 1 mL in Water; 500 mg. Product ID: HY-B2233. | |
| Phosphorylcholine chloride sodium salt | Phosphorylcholine chloride sodium salt. Alternative Names: Phosphocholine chloride sodium salt. CAS No. 16904-96-4. Purity: 98+%. Product ID: ACM16904964-1. Molecular formula: C5H13ClNNa2O4P. Mole weight: 263.57. Alfa Chemistry - ISO 9001:32057 Certified. | |
| Phosphorylethanolamine | Phosphorylethanolamine is used in the synthesis of Sphingomyelin, a type of sphingolipid found in animal cell membrane. Phosphorylethanolamine participates in phospholipid metabolism. Its release can be stimulated occasionally by depolarizing stimuli. Reduction of phosphorylethanolamine levels has been observed in Alzheimer?s and Huntington?s disease. Group: Biochemicals. Alternative Names: 2-Aminoethanol 1-(Dihydrogen Phosphate); 2-Aminoethanol Dihydrogen Phosphate Ester; 2-Aminoethanol Phosphate; Phosphoric Acid 2-Aminoethyl Ester; 2-Aminoethanol O-Phosphate; 2-Aminoethyl Dihydrogen Phosphate; Colamine phosphate; Ethanolamine O-Phosphate; Mono(2-aminoethyl) phosphate; Monoaminoethyl Phosphate; NSC 254167; O-Phosphoethanolamine; O-Phosphoryl ethanolamine; Phosphoethanolamine; Phosphonoethanolamine. Grades: Highly Purified. CAS No. 1071-23-4. Pack Sizes: 10g, 25g. Molecular Formula: C2H8NO4P, Molecular Weight: 141.06. US Biological Life Sciences. | Worldwide |
| Phosphorylethanolamine | Phosphorylethanolamine (Monoaminoethyl phosphate) is a membrane phospholipid and an important precursor of Phosphatidylcholine (HY-B2233B). It is found in most animal tissues and various human extracranial tumors, playing a critical role in membrane integrity, cell division, mitochondrial respiratory function, and more. Studies have shown that changes in the abundance of Phosphorylethanolamine are associated with Alzheimer's disease and Parkinson's disease. Lowering the ratio of Phosphorylethanolamine to Phosphatidylcholine in the liver can improve insulin signaling. Phosphorylethanolamine holds promise for research in the fields of cancer, neurodegenerative disorders, and metabolic diseases[1][2][3][4][5]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Monoaminoethyl phosphate; NSC 254167; O-Phosphoethanolamine. CAS No. 1071-23-4. Pack Sizes: 10 mM * 1 mL in Water; 5 g; 10 g; 25 g; 50 g; 100 g. Product ID: HY-N5034. | |
| Phosphorylethanolamine-d4 | Labeled analogue of Phosphoryl ethanolamine. Phosphorylethanolamine is used in the synthesis of Sphingomyelin, a type of sphingolipid found in animal cell membrane. Group: Biochemicals. Alternative Names: 2-Aminoethanol-d4 1-(Dihydrogen Phosphate); 2-Aminoethanol-d4 Dihydrogen Phosphate Ester; 2-Aminoethanol-d4 Phosphate; Phosphoric Acid 2-Aminoethy-d4 Ester; 2-Aminoethanol-d4 O-Phosphate2-Aminoethyl-d4 Dihydrogen Phosphate; Colamine phosphate; Ethanolamine-d4 O-Phosphate; Mono(2-aminoethyl-d4) phosphate; Monoaminoethyl-d4 Phosphate; NSC 254167-d4; O-Phosphoethanolamine-d4; O-Phosphorylethanolamine-d4; Phosphoethanolamine-d4; Phosphonoethanolamine-d4. Grades: Highly Purified. CAS No. 1169692-38-9. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| Phospho-S6 Ribosomal Protein (S235/236) Antibody [G7G11] | Phospho-S6 Ribosomal Protein (Ser235/236),RPS6 (phospho S235 + S236). Group: Antibodies. Alternative Names: Phospho-S6 Ribosomal Protein (Ser235/236),RPS6 (phospho S235 + S236). Pack Sizes: 20ul. Product ID: F0198. Storage Conditions: -20°C (avoid freeze-thaw cycles), 2 years. |  United States; Europe |
| phosphoserine phosphatase | This enzyme belongs to the family of hydrolases, specifically those acting on phosphoric monoester bonds. The systematic name of this enzyme class is O-phosphoserine phosphohydrolase. This enzyme participates in glycine, serine and threonine metabolism. Group: Enzymes. Enzyme Commission Number: EC 3.1.3.3. CAS No. 9025-73-4. PSP. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3633; phosphoserine phosphatase; EC 3.1.3.3; 9025-73-4. Cat No: EXWM-3633. | |
| Phosphoserine Phosphatase from Human, Recombinant | Human Phosphoserine phosphatase (hPSP) is an important enzyme in the phosphorylated pathway of serine biosynthesis, which contributes a major portion of the endogenous L-serine. Similar to known L-3-phosphoserine phosphatases, it catalyzed the Mg2+-dependent hydrolysis of L-phosphoserine and an exchange reaction between L-serine and L-phosphoserine. Recently, its complex structures reveal that the open-closed environmental change of the active site, generated-helical bundle domain, is important to substrate by local rearrangement of the recognition and hydrolysis. Phosphoserine phosphatase human recombinant produced in e. coli is a single, non-glycosylated polypeptid.3-phosphoserine phosphatase; PSPH. Enzyme Commission Number: EC 3.1.3.3. CAS No. 9025-73-4. Purity: Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. PSP. Mole weight: 25 kDa. Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles. Appearance: Sterile filtered colorless solution. Source: E. coli. Species: Human. Phosphoserine phosphatase; EC 3.1.3.3; PSP; O-phosphoserine phosphohydrolase; PSPase; L-3-phosphoserine phosphatase; PSPH. Cat No: NATE-0911. | |
| phosphoserine transaminase | A pyridoxal-phosphate protein. This enzyme catalyses the second step in the phosphorylated pathway of serine biosynthesis in Escherichia coli. It also catalyses the third step in the biosynthesis of the coenzyme pyridoxal 5'-phosphate in Escherichia coli (using Reaction 2 above). In Escherichia coli, pyridoxal 5'-phosphate is synthesized de novo by a pathway that involves EC 1.2.1.72 (erythrose-4-phosphate dehydrogenase), EC 1.1.1.290 (4-phosphoerythronate dehydrogenase), EC 2.6.1.52 (phosphoserine transaminase), EC 1.1.1.262 (4-hydroxythreonine-4-phosphate dehydrogenase), EC 2.6.99.2 (pyridoxine 5'-phosphate synthase) and EC 1.4.3.5 (with pyridoxine 5'-phosphate as substrate).ransaminase; 3-O-phospho-L-serine:2-oxoglutarate aminotransferase; SerC; PdxC; 3PHP transaminase. Enzyme Commission Number: EC 2.6.1.52. CAS No. 9030-90-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2894; phosphoserine transaminase; EC 2.6.1.52; 9030-90-4; PSAT; phosphoserine aminotransferase; 3-phosphoserine aminotransferase; hydroxypyruvic phosphate-glutamic transaminase; L-phosphoserine aminotransferase; phosphohydroxypyruvate transaminase; phosphohydroxypyruvic-glutamic transaminase; 3-O-phospho-L-serine:2-oxoglutarate aminotransferase; SerC; PdxC; 3PHP transaminase. Cat No: EXWM-2894. | |
| Phospho-Smad3 (Ser423/Ser425) Antibody [L3N2] | Phospho-Smad3 (Ser423/425),Smad3 (phospho S423 + S425), Smad5 (463/465), Smad1 (Ser 463/465), Smad2 (Ser 465/467)d5 (Se. Group: Antibodies. Alternative Names: Phospho-Smad3 (Ser 423/425)+Smad5 (Ser 463/465)+Smad1 (Ser 463/465)+Smad2 (Ser 465/467). Pack Sizes: 20uL. Product ID: F2846. Storage Conditions: -20°C (avoid freeze-thaw cycles), 2 years. | United States; Europe |
| Phospho-Src Family (Tyr416) Antibody [H4N15] | Tyrosine-protein kinase Yes, Proto-oncogene c-Yes, p61-Yes, YES1, YES, Tyrosine-protein kinase Lyn, Lck/Yes-related novel protein tyrosine kinase, V-yes-1 Yamaguchi sarcoma viral related oncogene homolog, p53Lyn, p56Lyn, LYN, JTK8, Tyrosine-protein kinase Lck, LSK, Lymphocyte cell-specific protein-tyrosine kinase, Protein YT16, Proto-oncogene Lck, T cell-specific protein-tyrosine kinase, p56-LCK, Tyrosine-protein kinase HCK, Hematopoietic cell kinase, Hemopoietic cell kinase, p59-HCK/p60-HCK, p59Hck, p61Hck, Proto-oncogene tyrosine-protein kinase Src, Proto-oncogene c-Src, p60-Src, SRC, SRC1, Tyrosine-protein kinase Fyn, Proto-oncogene Syn, Proto-oncogene c-Fyn, SLK, p59-Fyn. Group: Antibodies. Alternative Names: YES, LYN, LSK, HCK,SRC, SLK. Pack Sizes: 20uL. Product ID: F0304. Storage Conditions: -20°C (avoid freeze-thaw cycles), 2 years. | United States; Europe |
| Phospho-STAT1 (Tyr701) Antibody [N19D1] | Phospho-Stat1 (Tyr701),p-Stat1,STAT1 (phospho Y701). Group: Antibodies. Alternative Names: Phospho-Stat1 (Tyr701),p-Stat1,STAT1 (phospho Y701). Pack Sizes: 20uL. Product ID: F0199. Storage Conditions: -20°C (avoid freeze-thaw cycles), 2 years. | United States; Europe |
| Phospho-STAT3 (Ser727) Antibody [B8F21] | Phospho-Stat3 (Ser727),STAT3 (phospho S727). Group: Antibodies. Alternative Names: Phospho STAT3 (Ser 727), STAT3. CAS No. Pack Sizes: 20ul. Product ID: F1212. Storage Conditions: -20°C (avoid freeze-thaw cycles), 2 years. | United States; Europe |
| Phospho-STAT3 (Tyr705) Antibody [B17F7] | Phospho-Stat3 (Tyr705),p-Stat3,STAT3 (phospho Y705). Group: Antibodies. Alternative Names: Phospho-Stat3 (Tyr705),p-Stat3,STAT3 (phospho Y705), STAT3. CAS No. Pack Sizes: 20uL. Product ID: F0157. Storage Conditions: -20°C (avoid freeze-thaw cycles), 2 years. | United States; Europe |
| Phospho-STAT6 (Tyr641) Antibody [A16N6] | Phospho-Stat6 (Tyr641),STAT6 (phospho Y641). Group: Antibodies. Alternative Names: Phospho-Stat6 (Tyr641),STAT6 (phospho Y641). Pack Sizes: 20uL. Product ID: F0555. Storage Conditions: -20°C (avoid freeze-thaw cycles), 2 years. | United States; Europe |
| phosphosulfolactate synthase | Requires Mg2+. The enzyme from the archaeon Methanococcus jannaschii catalyses the Michael addition of sulfite to phosphoenolpyruvate. It specifically requires phosphoenolpyruvate and its broad alkaline pH optimum suggests that it uses sulfite rather than hydrogensulfite. Group: Enzymes. Synonyms: (2R)-phospho-3-sulfolactate synthase; (2R)-O-phospho-3-sulfolactate sulfo-lyase. Enzyme Commission Number: EC 4.4.1.19. CAS No. 473575-53-0. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5320; phosphosulfolactate synthase; EC 4.4.1.19; 473575-53-0; (2R)-phospho-3-sulfolactate synthase; (2R)-O-phospho-3-sulfolactate sulfo-lyase. Cat No: EXWM-5320. | |
| Phospho-TBK1/NAK (Ser172) Antibody [H16A23] | NAK/TBK1 (phospho S172),Phospho-TBK1/NAK (Ser172). Group: Antibodies. Alternative Names: Phospho NAK (Ser172). Pack Sizes: 20ul. Product ID: F0255. Storage Conditions: -20°C (avoid freeze-thaw cycles), 2 years. | United States; Europe |
| Phosphotungstic acid | Phosphotungstic acid. Group: Biochemicals. Alternative Names: Tungstophosphoric acid. Grades: Highly Purified. CAS No. 1343-93-7. Pack Sizes: 25g, 50g, 100g, 250g, 500g. Molecular Formula: H3O40PW12·xH2O. US Biological Life Sciences. | Worldwide |
| Phosphotungstic Acid | Phosphotungstic Acid. CAS No. 12501-23-4. Molecular Formula H3PO4 * 12WO3 * x H2O. Chemical Reagents |  Cater Chemicals Corp. Illinois IL |
| Phosphotungstic Acid | PHOSPHOTUNGSTIC ACID, SODIUM SALT, HYDRATE, Reagent, crystal, (Synonym: Tungstophosphoric Acid, Sodium Salt, Hydrate), Formula: Na3PO4.12WO3.xH2O. CAS No. 51312-42-6. Noah Chemicals San Antonio, Texas. ISO 9001:2015 Certified. Request a Quote Today! |  Texas TX |
| Phosphotungstic Acid | Phosphotungstic Acid. CAS No. 12501-23-4. Molecular formula: H3[P(W3O10)4]; xH2O. Mole weight: 2880.05 g/mol. Purity: 99%. |  |
| Phosphotungstic Acid | PHOSPHOTUNGSTIC ACID, HYDRATE, Reagent, crystal, (Synonym: Tungstophosphoric Acid, Hydrate), Formula: H3PO4.12WO3.xH2O. CAS No. 12067-99-1. Noah Chemicals San Antonio, Texas. ISO 9001:2015 Certified. Request a Quote Today! | Texas TX |
| Phosphotungstic Acid | Phosphotungstic Acid. Grade: Reagent. CAS: 12067-99-1. Packing: Plastic Drums. |  New Jersey NJ |
| Phosphotungstic Acid | Phosphotungstic Acid. Uses: For analytical and research use. Alternative Names: Tungstophosphoric acid; 12-Phosphotungstic acid. CAS No. 12501-23-4. Molecular formula: H5O41PW12. Mole weight: 2880.2. IUPAC Name: phosphoric acid;trioxotungsten;hydrate. Catalog: APB12501234-1. | |
| Phosphotungstic acid, AR | Phosphotungstic acid, AR. CAS No. 12501-23-4. Molecular formula: H5O41PW12. Mole weight: 2898g/mol. IUPAC Name: phosphoric acid;trioxotungsten;hydrate. SMILES: O.OP(=O)(O)O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O. InChI: InChI=1S/H3O4P.H2O.36O.12W/c1-5(2,3)4;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;/h(H3,1,2,3,4);1H2;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;; | |
| Phosphotungstic acid hydrate | 100g Pack Size. Group: Building Blocks, Inorganic Chemicals. Formula: H3O40PW12 · xH2O. CAS No. 12501-23-4. Prepack ID 46336733-100g. Molecular Weight 2880.05. See USA prepack pricing. |  |
| Phosphotungstic acid hydrate | Phosphotungstic acid hydrate. Alternative Names: 12 TUNGSTO(VI) PHOSPHORIC ACID N-HYDRATE;12 TUNGSTO(+6)PHOSPHORIC ACID N-HYDRATE;12-TUNGSTOPHOSPHATE;12-TUNGSTOPHOSPHORIC ACID HYDRATE;DODECA-TUNGSTOPHOSPHORIC ACID HYDRATE;PHOSPHOTUNGSTIC ACID HYDRATE;PHOSPHOTUNGSTIC ACID N-HYDRATE;PHOSPHOTUNGSTIC ACID. CAS No. 12501-23-4 / 12067-99-1. Molecular formula: H6O8PW. Mole weight: 348.86. | |
| Phosphotungstic acid hydrate | Phosphotungstic acid hydrate. Alternative Names: 12-Tungstophosphoric acid hydrate. CAS No. 12501-23-4. Molecular formula: H5O41PW12. Mole weight: 2898.1. Purity: 99%+. IUPAC Name: Phosphoric acid;trioxotungsten;hydrate. SMILES: O.OP(=O)(O)O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O. InChI: InChI=1S/H3O4P.H2O.36O.12W/c1-5(2,3)4;/h(H3,1,2,3,4);1H2. | |
| Phosphotungstic acid hydrate | Phosphotungstic acid hydrate. Alternative Names: 12 TUNGSTO(VI) PHOSPHORIC ACID N-HYDRATE;12 TUNGSTO(+6)PHOSPHORIC ACID N-HYDRATE;12-TUNGSTOPHOSPHATE;12-TUNGSTOPHOSPHORIC ACID HYDRATE;DODECA-TUNGSTOPHOSPHORIC ACID HYDRATE;PHOSPHOTUNGSTIC ACID HYDRATE;PHOSPHOTUNGSTIC ACID N-HYDRATE;PHOSPHOTUNGSTIC ACID. CAS No. 12067-99-1 / 12501-23-4. Product ID: ACM12067991. Molecular formula: H6O8PW. Mole weight: 348.86. Alfa Chemistry - ISO 9001:32057 Certified. | |
| Phosphotungstic acid hydrate | Phosphotungstic acid hydrate. Group: Biochemicals. Grades: Reagent Grade. CAS No. 12501-23-4. Pack Sizes: 100g, 250g, 25g, 1Kg, 5Kg. US Biological Life Sciences. | Worldwide |
| Phospho-YAP (Ser127) Antibody [K8E8] | Phospho-YAP (Ser127),YAP1 (phospho S127). Group: Antibodies. Alternative Names: Hippo; P-YAP; Yes; Yes-associated. Pack Sizes: 20uL. Product ID: F0352. Storage Conditions: -20°C (avoid freeze-thaw cycles), 2 years. | United States; Europe |
| Phospho-Zap-70 (Tyr319)/Syk (Tyr352) Antibody [L15L21] | Tyrosine-protein kinase ZAP-70, 70 kDa zeta-chain associated protein, Syk-related tyrosine kinase, ZAP70, SRK, Tyrosine-protein kinase SYK, Spleen tyrosine kinase, p72-Syk, SYK. Group: Antibodies. Alternative Names: Phospho Zap-70 (Tyr319), Phospho Syk (Tyr 352). Pack Sizes: 20uL. Product ID: F0556. Storage Conditions: -20°C (avoid freeze-thaw cycles), 2 years. | United States; Europe |
| PhosTAC5 | PhosTAC5 is a phosphorylation targeting chimera (PhosTAC) molecule composed of a linker with fivePEG groups. PhosTAC5 induces dephosphorylation of PDCD4 and FOXO3a[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 3064090-15-6. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-148509. | |
| PhosTAC7 | PhosTAC7 is a heterobifunctional molecule named as a Phosphorylation Targeting Chimera (PhosTAC). PhosTAC7 can dephosphorylate the PDCD4 protein, FOXO3a protein, and tau protein by recruiting serine/threonine protein phosphatase 2A (PP2A). PhosTAC7 offers the advantage of selectively modulating the phosphorylation state of individual target proteins, making it a promising tool for research in cancer and tau protein-related neurodegenerative diseases (Alzheimer's disease)[1][2]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: OGTAC-3. CAS No. 3016307-75-5. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-145232. | |
| Photinus-luciferin 4-monooxygenase (ATP-hydrolysing) | Photinus (firefly) is a bioluminescent insect. The first step in the reaction is the formation of an acid anhydride between the carboxylic group and AMP, with the release of diphosphate. The enzyme may be assayed by measurement of light emission. Group: Enzymes. Synonyms: firefly luciferase; luciferase (firefly luciferin); Photinus luciferin 4-monooxygenase (adenosine triphosphate-hydrolyzing); firefly luciferin luciferase; Photinus pyralis luciferase. Enzyme Commission Number: EC 1.13.12.7. CAS No. 61970-00-1. Luciferase. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0620; Photinus-luciferin 4-monooxygenase (ATP-hydrolysing); EC 1.13.12.7; 61970-00-1; firefly luciferase; luciferase (firefly luciferin); Photinus luciferin 4-monooxygenase (adenosine triphosphate-hydrolyzing); firefly luciferin luciferase; Photinus pyralis luciferase. Cat No: EXWM-0620. | |
| Photobiotin acetate salt | Photobiotin acetate salt. Synonyms: Biotin {3-[3-(4-azido-2-nitroanilino)-N-methylpropylamino]propylamide} acetate salt, N-(4-Azido-2-nitrophenyl)-N-(3-biotinylaminopropyl)-N-methyl-1,3-propanediamine acetate salt. CAS No. 96087-38-6. Molecular formula: C25H39N9O6S. Mole weight: 593.70. | |
| Photoclick myristic acid | Photoclick myristic acid is a derivative of Myristic acid (HY-N2041) with an alkyne group and a photo-activatable diazirine group. Photoclick myristic acid can be used as a probe in protein research[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2707485-30-9. Pack Sizes: 500 μg; 1 mg. Product ID: HY-W895359. | |
| Photodegradation impurity 3 of dexamethasone sodium phosphate | Photodegradation impurity 3 of dexamethasone sodium phosphate. Uses: For analytical and research use. Molecular formula: C22H30FO8P. Mole weight: 472.45. Catalog: APB07559. | |
| Photoinduced CuInS2(CIS)/ZnS Quantum Dots | Photoinduced CuInS2(CIS)/ZnS Quantum Dots. Purity: Water. | |
| Photoinitiator 947-19-3 | Photoinitiator - Surface Coatings. SUPPLIERS TO BUSINESS CUSTOMERS ONLY. |  North America & APAC |
| photosystem I | Contains chlorophyll, phylloquinones, carotenoids and [4Fe-4S] clusters.Cytochrome c6 can act as an alternative electron donor, and flavodoxin as an alternative acceptor in some species. Group: Enzymes. Enzyme Commission Number: EC 1.97.1.12. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1691; photosystem I; EC 1.97.1.12. Cat No: EXWM-1691. | |
| photosystem II | Contains chlorophyll a, β-carotene, pheophytin, plastoquinone, a Mn4Ca cluster, heme and non-heme iron. Four successive photoreactions, resulting in a storage of four positive charges, are required to oxidize two water molecules to one oxygen molecule. Group: Enzymes. Enzyme Commission Number: EC 1.10.3.9. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0487; photosystem II; EC 1.10.3.9. Cat No: EXWM-0487. | |
| Phox-I2 | Phox-I2 is a selective inhibitor of p67phox-Rac1 interaction, binds to p67phox with high affinity with a Kd of ~150 nM. Phox-I2 is a NADPH oxidase 2 (NOX2) inhibitor and inhibits reactive oxygen species (ROS) production[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 353495-22-4. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg. Product ID: HY-119576. | |
| PHP 501 trifluoroacetate | PHP 501 trifluoroacetate. Group: Biochemicals. Grades: Purified. CAS No. 1236105-75-1. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| PHPS1 | PHPS1 is a potent and selective Shp2 inhibitor with Kis of 0.73, 5.8, 10.7, 5.8, and 0.47 μM for Shp2, Shp2-R362K, Shp1, PTP1B, and PTP1B-Q, respectively[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 314291-83-3. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-112368. | |
| pH Receptor Probe | pH Receptor Probe is a pH-sensitive cyanine derivative and a environmental sensitive fluorophore. pH Receptor Probe has a pH-sensitive maximal absorption at 644 nm and emission at 664 nm. pH Receptor Probe has been used as a pH sensor of lysosomal compartments[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 312961-83-4. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-D1563. | |
| Phrixotoxin 3 | Phrixotoxin 3, a peptide toxin produced by the Chilean copper tarantula (Paraphysa scrofa), is a potent blocker of voltage-gated sodium channels (IC50= 0.6, 42, and 72 nM for NaV1.2, NaV1.3 and NaV1.5 respectively). Synonyms: 6-(phenylsulfinyl)-tetrazolo[1,5-b]pyridazine; DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI. Grade: >99%. CAS No. 880886-00-0. Molecular formula: C176H269N51O48S6. Mole weight: 4059.74. | |
| Phrixotoxin 3 | Phrixotoxin 3. Group: Biochemicals. Grades: Purified. CAS No. 880886-00-0. Pack Sizes: 100ug. US Biological Life Sciences. | Worldwide |
| PHT 427 | PHT 427. Group: Biochemicals. Grades: Purified. CAS No. 1191951-57-1. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| PHT-7.3 | PHT-7.3 is a selective inhibitor of connector enhancer of kinase suppressor of Ras 1 (Cnk1) pleckstrin homology (PH) domain (Kd=4.7 μM). PHT-7.3 inhibits mut-KRas, but not wild-type KRas cancer cell and tumor growth and signaling. PHT-7.3 has antitumor activity[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1614225-93-2. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-128590. | |
| PhTD1 | PhTD1 is an antimicrobial peptide found in Papio hamadryas (Hamadryas baboon), and has antibacterial and antifungal activity. Synonyms: PhTD-1; BTD 1; Baboon theta defensin 1; Cyclo(L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-arginyl-L-arginylglycyl-L-valyl-L-cysteinyl-L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-L-threonyl-rginylglycyl-L-phenylalanyl-cysteinyl), cyclic(2→11),(4→9),(13→18)-tris(disulfide); θ-Defensin 1 (Papio anubis); θ-Defensin 1 (Papio hamadryas); θ-Defensin 1 (baboon). Grade: >98%. CAS No. 1085365-19-0. Molecular formula: C80H133N33O19S6. Mole weight: 2053.51. | |
| PhTD3 | PhTD3 is an antimicrobial peptide found in Papio hamadryas (Hamadryas baboon), and has antibacterial and antifungal activity. Synonyms: PhTD-3; BTD 3; Baboon theta defensin 3; Cyclo(L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-threonyl-L-arginylglycyl-L-phenylalanyl-L-cysteinyl-L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-L-threonyl-rginylglycyl-L-phenylalanyl-cysteinyl), cyclic(2→11),(4→9),(13→18)-tris(disulfide); θ-Defensin 3 (Papio anubis); θ-Defensin 3 (Papio hamadryas); θ-Defensin 3 (baboon). Grade: >98%. CAS No. 1085365-23-6. Molecular formula: C82H128N30O20S6. Mole weight: 2046.47. | |
| Pht-Gly-β-Ala-OH | Pht-Gly-β-Ala-OH. Synonyms: Phthaloyl-glycyl-β-alanine; 3-(2-(1,3-Dioxoisoindolin-2-yl)acetamido)propanoic acid; Pht Gly β Ala OH. Grade: ≥ 99%. CAS No. 17896-84-3. Molecular formula: C13H12N2O5. Mole weight: 276.25. | |
| Pht-Gly-beta-Ala-OH | Pht-Gly-beta-Ala-OH. Group: Biochemicals. Alternative Names: Phthaloyl-glycyl-b-alanine. Grades: Highly Purified. CAS No. 17896-84-3. Pack Sizes: 1g, 2g. US Biological Life Sciences. | Worldwide |
| Phthalaldehyde | Phthalaldehyde. Group: Biochemicals. Grades: Highly Purified. CAS No. 643-79-8. Pack Sizes: 50g, 100g, 250g, 500g, 1kg. US Biological Life Sciences. | Worldwide |
| Phthalaldehyde | Phthalaldehyde (Phthaldialdehyde) reacts with proteins containing primary amines and blocked amino-terminal peptides of amino acids. Phthalaldehyde stabilizes bacterial outer membranes and cell walls, increases the optical density of bacterial cell suspensions, and inhibits bacterial lysis induced by ethylenediaminetetraacetic acid and sodium dodecyl sulfate. Phthalaldehyde exhibits bactericidal activity against Gram-negative vegetative bacteria[1][2]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Phthaldialdehyde. CAS No. 643-79-8. Pack Sizes: 10 mM * 1 mL in DMSO; 25 g. Product ID: HY-W012669. | |
| Phthalaldehyde-d6 | Phthalaldehyde-d6 is the deuterium labeled Phthalaldehyde (HY-W012669). Phthalaldehyde is a biochemical assay reagent, which modifies the amino acid and measure the derivative through HPLC. Phthalaldehyde forms a fluorescent compound with α-amino group[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 68234-47-9. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-W738417. | |
| Phthalaldehydic Acid | Phthalaldehydic Acid. Group: Biochemicals. Alternative Names: Benzaldehyde-2-carboxylic Acid; 2-Carboxybenzaldehyde; 2-Formylbenzoic Acid. Grades: Highly Purified. CAS No. 119-67-5. Pack Sizes: 100g, 250g, 500g, 1Kg. US Biological Life Sciences. | Worldwide |
| Phthalamide | White powder, 97%. Synonym: 1,2-Benzenedicarboxamide. CAS No. 88-96-0. Pack Sizes: Typically in stock: 50g, 250g. Mole weight: 164.16. MP/BP: M.P. 223 dec. Order No: FR-0040. |  Frinton Laboratories |
| phthalate 4,5-cis-dihydrodiol dehydrogenase | Involved in the phthalate degradation pathway in bacteria. Group: Enzymes. Enzyme Commission Number: EC 1.3.1.64. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1332; phthalate 4,5-cis-dihydrodiol dehydrogenase; EC 1.3.1.64. Cat No: EXWM-1332. | |
| phthalate 4,5-dioxygenase | A system, containing a reductase which is an iron-sulfur flavoprotein (FMN), an iron-sulfur oxygenase, and no independent ferredoxin. Requires Fe2+. Group: Enzymes. Synonyms: PDO phthalate dioxygenase. Enzyme Commission Number: EC 1.14.12.7. CAS No. 63626-44-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0695; phthalate 4,5-dioxygenase; EC 1.14.12.7; 63626-44-8; PDO phthalate dioxygenase. Cat No: EXWM-0695. | |
Our database is helping our users find suppliers everyday.
