A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| phosphoserine transaminase | A pyridoxal-phosphate protein. This enzyme catalyses the second step in the phosphorylated pathway of serine biosynthesis in Escherichia coli. It also catalyses the third step in the biosynthesis of the coenzyme pyridoxal 5'-phosphate in Escherichia coli (using Reaction 2 above). In Escherichia coli, pyridoxal 5'-phosphate is synthesized de novo by a pathway that involves EC 1.2.1.72 (erythrose-4-phosphate dehydrogenase), EC 1.1.1.290 (4-phosphoerythronate dehydrogenase), EC 2.6.1.52 (phosphoserine transaminase), EC 1.1.1.262 (4-hydroxythreonine-4-phosphate dehydrogenase), EC 2.6.99.2 (pyridoxine 5'-phosphate synthase) and EC 1.4.3.5 (with pyridoxine 5'-phosphate as substrate).ransaminase; 3-O-phospho-L-serine:2-oxoglutarate aminotransferase; SerC; PdxC; 3PHP transaminase. Enzyme Commission Number: EC 2.6.1.52. CAS No. 9030-90-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2894; phosphoserine transaminase; EC 2.6.1.52; 9030-90-4; PSAT; phosphoserine aminotransferase; 3-phosphoserine aminotransferase; hydroxypyruvic phosphate-glutamic transaminase; L-phosphoserine aminotransferase; phosphohydroxypyruvate transaminase; phosphohydroxypyruvic-glutamic transaminase; 3-O-phospho-L-serine:2-oxoglutarate aminotransferase; SerC; PdxC; 3PHP transaminase. Cat No: EXWM-2894. |  |
| phosphosulfolactate synthase | Requires Mg2+. The enzyme from the archaeon Methanococcus jannaschii catalyses the Michael addition of sulfite to phosphoenolpyruvate. It specifically requires phosphoenolpyruvate and its broad alkaline pH optimum suggests that it uses sulfite rather than hydrogensulfite. Group: Enzymes. Synonyms: (2R)-phospho-3-sulfolactate synthase; (2R)-O-phospho-3-sulfolactate sulfo-lyase. Enzyme Commission Number: EC 4.4.1.19. CAS No. 473575-53-0. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5320; phosphosulfolactate synthase; EC 4.4.1.19; 473575-53-0; (2R)-phospho-3-sulfolactate synthase; (2R)-O-phospho-3-sulfolactate sulfo-lyase. Cat No: EXWM-5320. | |
| Phosphothreonine-BSA | 2 mg/mL, buffered aqueous solution. Group: Fluorescence/luminescence spectroscopy. |  |
| Phosphotrienin (Fostriecin, Antibiotic CI 920, Antibiotic CL 1565A, Antibiotic PD 110161, NSC 339638), Sodium Salt | Fostriecin is the most fully characterized member of a family of phosphate esters of a triene antibiotic. The antitumor potential of fostriecin has attracted considerable interest, focused on its mode of action as a topoisomerase II inhibitor. Subsequent research has focused on this metabolite's selective inhibition of protein phosphatase PP2A. Group: Biochemicals. Alternative Names: Fostriecin, Phosphotrienin, Antibiotic CI 920, Antibiotic CL 1565A,Antibiotic PD 110161, NSC 339638. Grades: Highly Purified. CAS No. 87810-56-8. Pack Sizes: 100ug. US Biological Life Sciences. |  Worldwide |
| Phosphotungstic acid | Phosphotungstic acid. Group: Biochemicals. Alternative Names: Tungstophosphoric acid. Grades: Highly Purified. CAS No. 1343-93-7. Pack Sizes: 25g, 50g, 100g, 250g, 500g. Molecular Formula: H3O40PW12·xH2O. US Biological Life Sciences. | Worldwide |
| Phosphotungstic Acid | Phosphotungstic Acid. Group: other nano materials. CAS No. 12501-23-4. Molecular formula: 2880.05 g/mol. Mole weight: H3[P(W3O10)4] xH2O. 99%. |  |
| Phosphotungstic Acid | PHOSPHOTUNGSTIC ACID, HYDRATE, Reagent, crystal, (Synonym: Tungstophosphoric Acid, Hydrate), Formula: H3PO4.12WO3.xH2O. CAS No. 12067-99-1. Noah Chemicals San Antonio, Texas. ISO 9001:2015 Certified. Request a Quote Today! |  Texas TX |
| Phosphotungstic Acid | Phosphotungstic Acid. CAS No. 12501-23-4. Molecular Formula H3PO4 * 12WO3 * x H2O. Chemical Reagents |  Cater Chemicals Corp. Illinois IL |
| Phosphotungstic Acid | Phosphotungstic Acid. Grade: Reagent. CAS: 12067-99-1. Packing: Plastic Drums. |  New Jersey NJ |
| Phosphotungstic Acid | PHOSPHOTUNGSTIC ACID, SODIUM SALT, HYDRATE, Reagent, crystal, (Synonym: Tungstophosphoric Acid, Sodium Salt, Hydrate), Formula: Na3PO4.12WO3.xH2O. CAS No. 51312-42-6. Noah Chemicals San Antonio, Texas. ISO 9001:2015 Certified. Request a Quote Today! | Texas TX |
| Phosphotungstic acid, AR | Phosphotungstic acid, AR. Group: Electronic chemicals. CAS No. 12501-23-4. Product ID: phosphoric acid; trioxotungsten; hydrate. Molecular formula: 2898g/mol. Mole weight: H5O41PW12. O. OP(=O)(O)O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. InChI=1S/H3O4P.H2O.36O.12W/c1-5(2, 3)4; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; /h(H3, 1, 2, 3, 4); 1H2; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ;. AVFBYUADVDVJQL-UHFFFAOYSA-N. | |
| Phosphotungstic acid hydrate | Phosphotungstic acid hydrate. Group: Biochemicals. Grades: Reagent Grade. CAS No. 12501-23-4. Pack Sizes: 100g, 250g, 25g, 1Kg, 5Kg. US Biological Life Sciences. | Worldwide |
| Phosphotungstic acid hydrate | Phosphotungstic acid hydrate. Group: Electronic materials. Alternative Names: 12 TUNGSTO(VI) PHOSPHORIC ACID N-HYDRATE; 12 TUNGSTO(+6)PHOSPHORIC ACID N-HYDRATE; 12-TUNGSTOPHOSPHATE; 12-TUNGSTOPHOSPHORIC ACID HYDRATE; DODECA-TUNGSTOPHOSPHORIC ACID HYDRATE; PHOSPHOTUNGSTIC ACID HYDRATE; PHOSPHOTUNGSTIC ACID N-HYDRATE; PHOSPHOTUNGSTIC ACID. CAS No. 12501-23-4/12067-99-1. Molecular formula: 348.86. Mole weight: H6O8PW. | |
| Phosphotungstic acid hydrate | Phosphotungstic acid hydrate. Group: Electronic materials. Alternative Names: 12-Tungstophosphoric acid hydrate. CAS No. 12501-23-4. Product ID: Phosphoric acid; trioxotungsten; hydrate. Molecular formula: 2898.1. Mole weight: H5O41PW12. O. OP(=O)(O)O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. InChI=1S/H3O4P.H2O.36O.12W/c1-5(2, 3)4;/h(H3, 1, 2, 3, 4);1H2. AVFBYUADVDVJQL-UHFFFAOYSA-N. 99%+. | |
| Phosphotungstic acid hydrate | 100g Pack Size. Group: Building Blocks, Inorganic Chemicals. Formula: H3O40PW12 · xH2O. CAS No. 12501-23-4. Prepack ID 46336733-100g. Molecular Weight 2880.05. See USA prepack pricing. |  |
| Phosphotungstic acid hydrate | 99.995% trace metals basis (Purity excludes up to 300 ppm Si). Group: Electronic chemicals. | |
| Phosphotyrosine-BSA | 2 mg/mL, buffered aqueous solution. Group: Fluorescence/luminescence spectroscopy. | |
| Phosphotyrosine Control, EGF-Stimulated A431 Cell | Phosphotyrosine Control, EGF-Stimulated A431 Cell. Group: Biologicals. Grades: Lysate. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| PhosTAC7 | PhosTAC7 is a heterobifunctional molecule named as a Phosphorylation Targeting Chimera (PhosTAC). PhosTAC7 can dephosphorylate the PDCD4 protein, FOXO3a protein, and Tau protein by recruiting serine/threonine protein phosphatase 2A (PP2A). PhosTAC7 offers the advantage of selectively modulating the phosphorylation state of individual target proteins, making it a promising tool for research in cancer and tau protein-related neurodegenerative diseases[1][2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 3016307-75-5. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-145232. |  |
| Photinus-luciferin 4-monooxygenase (ATP-hydrolysing) | Photinus (firefly) is a bioluminescent insect. The first step in the reaction is the formation of an acid anhydride between the carboxylic group and AMP, with the release of diphosphate. The enzyme may be assayed by measurement of light emission. Group: Enzymes. Synonyms: firefly luciferase; luciferase (firefly luciferin); Photinus luciferin 4-monooxygenase (adenosine triphosphate-hydrolyzing); firefly luciferin luciferase; Photinus pyralis luciferase. Enzyme Commission Number: EC 1.13.12.7. CAS No. 61970-00-1. Luciferase. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0620; Photinus-luciferin 4-monooxygenase (ATP-hydrolysing); EC 1.13.12.7; 61970-00-1; firefly luciferase; luciferase (firefly luciferin); Photinus luciferin 4-monooxygenase (adenosine triphosphate-hydrolyzing); firefly luciferin luciferase; Photinus pyralis luciferase. Cat No: EXWM-0620. | |
| Photobiotin acetate | Photobiotin acetate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Photobiotin acetate salt, Biotin {3-[3-(4-azido-2-nitroanilino)-N-methylpropylamino]propylamide} acetate salt, 96087-38-6, A1935_SIGMA, CTK8G2402, BIP0695, AG-H-94850, N-(4-Azido-2-nitrophenyl)-N inverted exclamation marka-(3-biotinylaminopropyl)-N inverted exclamation marka-methyl-1,3-propanediamine acetate salt, N-(4-Azido-2-nitrophenyl)-N-(3-biotinylaminopropyl)-N-methyl-1,3-propanediamine acetate salt. Product Category: Heterocyclic Organic Compound. CAS No. 96087-38-6. Molecular formula: C25H39N9O6S. Mole weight: 593.7. Purity: 0.96. IUPACName: 5-[(3aS,4S,6aR)-2-oxo-1,3,3a,4,6,6a-hexahydrothieno[3,4-d]imidazol-4-yl]-N-[3-[3-(4-azido-2-nitroanilino)propyl-methylamino]propyl]pentanamide;acetic acid. Product ID: ACM96087386. Alfa Chemistry ISO 9001:2015 Certified. |  |
| Photobiotin acetate salt | Photobiotin acetate salt. Synonyms: Biotin {3-[3-(4-azido-2-nitroanilino)-N-methylpropylamino]propylamide} acetate salt, N-(4-Azido-2-nitrophenyl)-N-(3-biotinylaminopropyl)-N-methyl-1,3-propanediamine acetate salt. CAS No. 96087-38-6. Molecular formula: C25H39N9O6S. Mole weight: 593.70. |  |
| Photobiotin acetate salt | For labeling DNA probes for hybridizations. Group: Fluorescence/luminescence spectroscopy. | |
| Photochromic Ion Channel Blocker, QAQ (2, 2- ( (diazene-1, 2-diylbis (4, 1-phenylene))bis (azanediyl))bis (N, N, N-triethyl-2-oxoethanaminium) formate, Quaternary Ammonium-Azobenzene-Quaternary Ammonium) | A membrane-impermeant Na+, K+, and Ca2+ channel blocker that is structurally composed of two azo-linked QX-314 type quaternary amines. Both QX-314 and QAQ are shown to selectively target excitability of nociceptor neurons via TRPV1-dependent cellular uptake. Unlike QX-314, the channel blocking activity of QAQ can be quickly switched on and off via optical cis-to-trans (500nM) and trans-to-cis (320nM) isomerization. Its efficacy as a pain-selective, photochromic anesthetic has been demonstrated in rats in vivo. QAQ cellular uptake can also be achieved by ATP-activated P2X7 receptor. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| Photoinduced CuInS2(CIS)/ZnS Quantum Dots | Photoinduced CuInS2(CIS)/ZnS Quantum Dots. Group: Photoinduced cuins2(cis)/zns quantum dots. Water. | |
| Photoinitiator 947-19-3 | Photoinitiator - Surface Coatings. SUPPLIERS TO BUSINESS CUSTOMERS ONLY. |  North America & APAC |
| Photomirex | A toxic metabolite of Mirex. A photodegradaton product of the insecticide Mirex, is an environmental contaminant that has been identified in Great Lakes fish, soil, and human adipose tissue. Group: Biochemicals. Alternative Names: 1, 1a, 2, 2, 3, 3a, 4, 5, 5, 5a, 5b-Undecachlorooctahydro-. Grades: Highly Purified. CAS No. 39801-14-4. Pack Sizes: 5mg. US Biological Life Sciences. | Worldwide |
| Photoregulin3 | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| photosystem I | Contains chlorophyll, phylloquinones, carotenoids and [4Fe-4S] clusters.Cytochrome c6 can act as an alternative electron donor, and flavodoxin as an alternative acceptor in some species. Group: Enzymes. Enzyme Commission Number: EC 1.97.1.12. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1691; photosystem I; EC 1.97.1.12. Cat No: EXWM-1691. | |
| photosystem II | Contains chlorophyll a, β-carotene, pheophytin, plastoquinone, a Mn4Ca cluster, heme and non-heme iron. Four successive photoreactions, resulting in a storage of four positive charges, are required to oxidize two water molecules to one oxygen molecule. Group: Enzymes. Enzyme Commission Number: EC 1.10.3.9. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0487; photosystem II; EC 1.10.3.9. Cat No: EXWM-0487. | |
| Phoxim | Phoxim is an organic phosphorus pesticide and widely applies worldwide for agricultural purposes [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 14816-18-3. Pack Sizes: 120 μg (335.23 μM * 1.2 mL in Methanol). Product ID: HY-B0819. | |
| PHP 501 trifluoroacetate | PHP 501 trifluoroacetate. Group: Biochemicals. Grades: Purified. CAS No. 1236105-75-1. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| PhpC | PhpC is a G-clamp analogue. PhpC shows antiproliferative activity against MCF7 cells, with an IC50 of 387.9 ?M. PhpC modulates G-quadruplex-RNA landscapes in human cells[1]. Uses: Scientific research. Group: Signaling pathways. Pack Sizes: 5 mg; 10 mg; 25 mg. Product ID: HY-164421. | |
| PHPS1 | PHPS1 is a potent and selective Shp2 inhibitor with K i s of 0.73, 5.8, 10.7, 5.8, and 0.47 μM for Shp2, Shp2-R362K, Shp1, PTP1B, and PTP1B-Q, respectively [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 314291-83-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-112368. | |
| PHPS1 | PHPS1 is an inhibitor of the protein tyrosine phosphatase Shp2. PHPS1 also efficiently inhibits activation of Erk1/2 by the leukemia-associated Shp2 mutant, Shp2-E76K, and blocks the anchorage-independent growth of a variety of human tumor cell lines. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PHPS1; PHPS 1; PHPS-1. Product Category: Inhibitors. Appearance: Solid powder. CAS No. 314291-83-3. Molecular formula: C21H15N5O6S. Mole weight: 465.44. Purity: >98%. IUPACName: 4-[2-[1,5-dihydro-3-(4-nitrophenyl)-5-oxo-1-phenyl-4H-pyrazol-4-ylidene]hydrazinyl]-benzenesulfonic Acid. Canonical SMILES: O=S(C1=CC=C(N/N=C2C(C3=CC=C([N+]([O-])=O)C=C3)=NN(C4=CC=CC=C4)C\2=O)C=C1)(O)=O. Product ID: ACM314291833-1. Alfa Chemistry ISO 9001:2015 Certified. | |
| PHPS1 sodium | PHPS1 sodium is a potent and selective Shp2 inhibitor with K i s of 0.73, 5.8, 10.7, 5.8, and 0.47 μM for Shp2, Shp2-R362K, Shp1, PTP1B, and PTP1B-Q, respectively [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1177131-02-0. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-125108. | |
| Phps1 sodium salt hydrate | Phps1 sodium salt hydrate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PTP Inhibitor V, PHPS1, CTK8E6636, 314291-83-3. Product Category: Heterocyclic Organic Compound. CAS No. 314291-83-3. Molecular formula: C21H14N5O6SNa.xH2O. Mole weight: 487.42 (anhydrous basis). Purity: 0.96. IUPACName: [4-[2-[3-[4-(nitromethyl)phenyl]-5-oxo-1-phenylpyrazol-4-ylidene]hydrazinyl]phenyl]methanesulfonic acid. Canonical SMILES: C1=CC=C(C=C1)N2C(=O)C(=NNC3=CC=C(C=C3)CS(=O)(=O)O)C(=N2)C4=CC=C(C=C4)C[N+](=O)[O-]. Product ID: ACM314291833. Alfa Chemistry ISO 9001:2015 Certified. | |
| PHPS1 sodium salt hydrate | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| Phpy2 | Phpy2. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PHPY2;2-[PHENYL(PYRIDIN-2-YL)PHOSPHINO]PYRIDINE. Product Category: Heterocyclic Organic Compound. CAS No. 68469-71-6. Molecular formula: C16H13N2P. Product ID: ACM68469716. Alfa Chemistry ISO 9001:2015 Certified. | |
| Phrixotoxin-2 | >98% (HPLC), lyophilized powder. Group: Fluorescence/luminescence spectroscopy. | |
| Phrixotoxin 3 | Phrixotoxin 3, a peptide toxin produced by the Chilean copper tarantula (Paraphysa scrofa), is a potent blocker of voltage-gated sodium channels (IC50= 0.6, 42, and 72 nM for NaV1.2, NaV1.3 and NaV1.5 respectively). Synonyms: 6-(phenylsulfinyl)-tetrazolo[1,5-b]pyridazine; DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI. Grade: >99%. CAS No. 880886-00-0. Molecular formula: C176H269N51O48S6. Mole weight: 4059.74. | |
| Phrixotoxin 3 | Phrixotoxin 3. Group: Biochemicals. Grades: Purified. CAS No. 880886-00-0. Pack Sizes: 100ug. US Biological Life Sciences. | Worldwide |
| PHT 427 | PHT 427. Group: Biochemicals. Grades: Purified. CAS No. 1191951-57-1. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| PHT-427 | PHT-247 is an inhibitor of the pleckstrin homology (PH) domain of Akt , and it is also an inhibitor of PDPK1 with K i s of 2.7 μM and 5.2 μM and for Akt and PDPK1, respectively. Uses: Scientific research. Group: Signaling pathways. CAS No. 1191951-57-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg; 200 mg. Product ID: HY-12063. | |
| PhTD1 | PhTD1 is an antimicrobial peptide found in Papio hamadryas (Hamadryas baboon), and has antibacterial and antifungal activity. Synonyms: PhTD-1; BTD 1; Baboon theta defensin 1; Cyclo(L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-arginyl-L-arginylglycyl-L-valyl-L-cysteinyl-L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-L-threonyl-rginylglycyl-L-phenylalanyl-cysteinyl), cyclic(2→11),(4→9),(13→18)-tris(disulfide); θ-Defensin 1 (Papio anubis); θ-Defensin 1 (Papio hamadryas); θ-Defensin 1 (baboon). Grade: >98%. CAS No. 1085365-19-0. Molecular formula: C80H133N33O19S6. Mole weight: 2053.51. | |
| PhTD3 | PhTD3 is an antimicrobial peptide found in Papio hamadryas (Hamadryas baboon), and has antibacterial and antifungal activity. Synonyms: PhTD-3; BTD 3; Baboon theta defensin 3; Cyclo(L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-threonyl-L-arginylglycyl-L-phenylalanyl-L-cysteinyl-L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-L-threonyl-rginylglycyl-L-phenylalanyl-cysteinyl), cyclic(2→11),(4→9),(13→18)-tris(disulfide); θ-Defensin 3 (Papio anubis); θ-Defensin 3 (Papio hamadryas); θ-Defensin 3 (baboon). Grade: >98%. CAS No. 1085365-23-6. Molecular formula: C82H128N30O20S6. Mole weight: 2046.47. | |
| Pht-Gly-b-Ala-OH 99+% | Pht-Gly-b-Ala-OH 99+%. Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 1g, 2.5g. US Biological Life Sciences. | Worldwide |
| Pht-Gly-β-Ala-OH | Pht-Gly-β-Ala-OH. Synonyms: Phthaloyl-glycyl-β-alanine; 3-(2-(1,3-Dioxoisoindolin-2-yl)acetamido)propanoic acid; Pht Gly β Ala OH. Grade: ≥ 99%. CAS No. 17896-84-3. Molecular formula: C13H12N2O5. Mole weight: 276.25. | |
| Pht-Gly-beta-Ala-OH | Pht-Gly-beta-Ala-OH. Group: Biochemicals. Alternative Names: Phthaloyl-glycyl-b-alanine. Grades: Highly Purified. CAS No. 17896-84-3. Pack Sizes: 1g, 2g. US Biological Life Sciences. | Worldwide |
| Phthalaldehyde | Phthalaldehyde. Group: Biochemicals. Grades: Highly Purified. CAS No. 643-79-8. Pack Sizes: 50g, 100g, 250g, 500g, 1kg. US Biological Life Sciences. | Worldwide |
| Phthalaldehyde | Phthalaldehyde is a biochemical assay reagent, which modifies the amino acid and measure the derivative through HPLC. Phthalaldehyde forms a fluorescent compound with α-amino group [1] [2]. Uses: Scientific research. Group: Biochemical assay reagents. Alternative Names: Phthaldialdehyde. CAS No. 643-79-8. Pack Sizes: 25 g. Product ID: HY-W012669. | |
| Phthalaldehydic Acid | Phthalaldehydic Acid. Group: Biochemicals. Alternative Names: Benzaldehyde-2-carboxylic Acid; 2-Carboxybenzaldehyde; 2-Formylbenzoic Acid. Grades: Highly Purified. CAS No. 119-67-5. Pack Sizes: 100g, 250g, 500g, 1Kg. US Biological Life Sciences. | Worldwide |
| Phthalamide | White powder, 97%. Synonym: 1,2-Benzenedicarboxamide. CAS No. 88-96-0. Pack Sizes: Typically in stock: 50g, 250g. Mole weight: 164.16. MP/BP: M.P. 223 dec. Order No: FR-0040. |  Frinton Laboratories |
| Phthalan | Phthalan. Group: Biochemicals. Alternative Names: 1,3-Dihydroisobenzofuran; 2-Oxaindan; Dihydroisobenzofuran; Isocoumaran. Grades: Highly Purified. CAS No. 496-14-0. Pack Sizes: 10g. Molecular Formula: C8H8O, Molecular Weight: 120.15. US Biological Life Sciences. | Worldwide |
| phthalate 4,5-cis-dihydrodiol dehydrogenase | Involved in the phthalate degradation pathway in bacteria. Group: Enzymes. Enzyme Commission Number: EC 1.3.1.64. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1332; phthalate 4,5-cis-dihydrodiol dehydrogenase; EC 1.3.1.64. Cat No: EXWM-1332. | |
| phthalate 4,5-dioxygenase | A system, containing a reductase which is an iron-sulfur flavoprotein (FMN), an iron-sulfur oxygenase, and no independent ferredoxin. Requires Fe2+. Group: Enzymes. Synonyms: PDO phthalate dioxygenase. Enzyme Commission Number: EC 1.14.12.7. CAS No. 63626-44-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0695; phthalate 4,5-dioxygenase; EC 1.14.12.7; 63626-44-8; PDO phthalate dioxygenase. Cat No: EXWM-0695. | |
| Phthalate Ionophore I | function tested. Group: Ionophores potentiometric for ise. | |
| Phthalates | certified reference material. Group: Certified reference materials (crms). | |
| Phthalates - PT | Proficiency Testing Material. Group: Plasticizers & phthalates. | |
| Phthalate Standard for IC | , 1000 mg/L phthalate in water. Group: Anions and cations standards. | |
| Phthalazine | Phthalazine. Group: Biochemicals. Alternative Names: 2,3-Benzodiazine; 4,5-Benzopyridazine; [3,4-2]phthalazine. Grades: Highly Purified. CAS No. 253-52-1. Pack Sizes: 2g, 5g, 10g, 25g, 50g. Molecular Formula: C8H6N2. US Biological Life Sciences. | Worldwide |
| Phthalazine | 25g Pack Size. Group: Building Blocks, Organics, Research Organics & Inorganics. Formula: C8H6N2. CAS No. 253-52-1. Prepack ID 90030981-25g. Molecular Weight 130.15. See USA prepack pricing. | |
| Phthalazine | Phthalazine is a substrate for human aldehyde oxidase 1 , which can lead to the production of ROS and subsequent enzyme inactivation [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 253-52-1. Pack Sizes: 10 mM * 1 mL; 5 g. Product ID: HY-W002016. | |
| Phthalazinone pyrazole | Phthalazinone pyrazole is a potent inhibitor of Aurora A kinase (IC50 = 31 nM). Phthalazinone pyrazole displays good pharmacological profiles with significantly improved oral bioavailability compared to the well studied Aurora inhibitor VX-680. Uses: Designed for use in research and industrial production. Product Category: Inhibitors. Appearance: Solid powder. CAS No. 880487-62-7. Molecular formula: C18H15N5O. Mole weight: 317.35. Purity: >98%. IUPACName: 4-((5-methyl-1H-pyrazol-3-yl)amino)-2-phenylphthalazin-1(2H)-one. Canonical SMILES: O=C1C2=C(C=CC=C2)C(NC3=NNC(C)=C3)=NN1C4=CC=CC=C4. Product ID: ACM880487627. Alfa Chemistry ISO 9001:2015 Certified. | |
| Phthalazone - Suppliers needed. | PhthalazoneCategoryheterocyclic compound, pharmaceutical intermediate | Suppliers Needed |
| Phthaldialdehyde | Yellowish crystals, 97%. Synonym: Benzene-1,2-dicarboxakdehyde. CAS No. 643-79-8. Pack Sizes: Typically in stock: 10g, 50g. Mole weight: 134.13. MP/BP: M.P. 55-58. Order No: FR-2076. | Frinton Laboratories |
| Phthalein purple | Phthalein purple. Group: Biochemicals. Alternative Names: o-Cresolphthalein complexone; Metalphthalein; Xyl enyl phthaleinbisi minodiacetic acid. Grades: Highly Purified. CAS No. 2411-89-4. Pack Sizes: 25g, 50g, 100g, 250g. US Biological Life Sciences. | Worldwide |
| Phthalein purple ACS | Phthalein purple ACS. Group: Biochemicals. Grades: ACS Grade. Pack Sizes: 25g, 100g, 250g. US Biological Life Sciences. | Worldwide |
| Phthalhydrazide | Phthalhydrazide. Group: Biochemicals. Grades: Highly Purified. CAS No. 1445-69-8. Pack Sizes: 100g, 250g, 500g, 1kg. US Biological Life Sciences. | Worldwide |
| Phthalic acid | 1kg Pack Size. Group: Building Blocks, Organics. Formula: C8H6O4. CAS No. 88-99-3. Prepack ID 38157787-1kg. Molecular Weight 166.13. See USA prepack pricing. | |
Our database is helping our users find suppliers everyday.
