A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Photoinitiator - Surface Coatings. SUPPLIERS TO BUSINESS CUSTOMERS ONLY.
North America & APAC
Photomirex
A toxic metabolite of Mirex. A photodegradaton product of the insecticide Mirex, is an environmental contaminant that has been identified in Great Lakes fish, soil, and human adipose tissue. Group: Biochemicals. Alternative Names: 1, 1a, 2, 2, 3, 3a, 4, 5, 5, 5a, 5b-Undecachlorooctahydro-. Grades: Highly Purified. CAS No. 39801-14-4. Pack Sizes: 5mg. US Biological Life Sciences.
Contains chlorophyll, phylloquinones, carotenoids and [4Fe-4S] clusters.Cytochrome c6 can act as an alternative electron donor, and flavodoxin as an alternative acceptor in some species. Group: Enzymes. Enzyme Commission Number: EC 1.97.1.12. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1691; photosystem I; EC 1.97.1.12. Cat No: EXWM-1691.
photosystem II
Contains chlorophyll a, β-carotene, pheophytin, plastoquinone, a Mn4Ca cluster, heme and non-heme iron. Four successive photoreactions, resulting in a storage of four positive charges, are required to oxidize two water molecules to one oxygen molecule. Group: Enzymes. Enzyme Commission Number: EC 1.10.3.9. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0487; photosystem II; EC 1.10.3.9. Cat No: EXWM-0487.
Phoxim
Phoxim is an organic phosphorus pesticide and widely applies worldwide for agricultural purposes [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 14816-18-3. Pack Sizes: 120 μg (335.23 μM * 1.2 mL in Methanol). Product ID: HY-B0819.
PHP 501 trifluoroacetate
PHP 501 trifluoroacetate. Group: Biochemicals. Grades: Purified. CAS No. 1236105-75-1. Pack Sizes: 10mg, 50mg. US Biological Life Sciences.
Worldwide
PhpC
PhpC is a G-clamp analogue. PhpC shows antiproliferative activity against MCF7 cells, with an IC50 of 387.9 ?M. PhpC modulates G-quadruplex-RNA landscapes in human cells[1]. Uses: Scientific research. Group: Signaling pathways. Pack Sizes: 5 mg; 10 mg; 25 mg. Product ID: HY-164421.
PHPS1
PHPS1 is a potent and selective Shp2 inhibitor with K i s of 0.73, 5.8, 10.7, 5.8, and 0.47 μM for Shp2, Shp2-R362K, Shp1, PTP1B, and PTP1B-Q, respectively [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 314291-83-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-112368.
PHPS1
PHPS1 is an inhibitor of the protein tyrosine phosphatase Shp2. PHPS1 also efficiently inhibits activation of Erk1/2 by the leukemia-associated Shp2 mutant, Shp2-E76K, and blocks the anchorage-independent growth of a variety of human tumor cell lines. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PHPS1; PHPS 1; PHPS-1. Product Category: Inhibitors. Appearance: Solid powder. CAS No. 314291-83-3. Molecular formula: C21H15N5O6S. Mole weight: 465.44. Purity: >98%. IUPACName: 4-[2-[1,5-dihydro-3-(4-nitrophenyl)-5-oxo-1-phenyl-4H-pyrazol-4-ylidene]hydrazinyl]-benzenesulfonic Acid. Canonical SMILES: O=S(C1=CC=C(N/N=C2C(C3=CC=C([N+]([O-])=O)C=C3)=NN(C4=CC=CC=C4)C\2=O)C=C1)(O)=O. Product ID: ACM314291833-1. Alfa Chemistry ISO 9001:2015 Certified.
PHPS1 sodium
PHPS1 sodium is a potent and selective Shp2 inhibitor with K i s of 0.73, 5.8, 10.7, 5.8, and 0.47 μM for Shp2, Shp2-R362K, Shp1, PTP1B, and PTP1B-Q, respectively [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1177131-02-0. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-125108.
Phps1 sodium salt hydrate
Phps1 sodium salt hydrate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PTP Inhibitor V, PHPS1, CTK8E6636, 314291-83-3. Product Category: Heterocyclic Organic Compound. CAS No. 314291-83-3. Molecular formula: C21H14N5O6SNa.xH2O. Mole weight: 487.42 (anhydrous basis). Purity: 0.96. IUPACName: [4-[2-[3-[4-(nitromethyl)phenyl]-5-oxo-1-phenylpyrazol-4-ylidene]hydrazinyl]phenyl]methanesulfonic acid. Canonical SMILES: C1=CC=C(C=C1)N2C(=O)C(=NNC3=CC=C(C=C3)CS(=O)(=O)O)C(=N2)C4=CC=C(C=C4)C[N+](=O)[O-]. Product ID: ACM314291833. Alfa Chemistry ISO 9001:2015 Certified.
Phpy2. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PHPY2;2-[PHENYL(PYRIDIN-2-YL)PHOSPHINO]PYRIDINE. Product Category: Heterocyclic Organic Compound. CAS No. 68469-71-6. Molecular formula: C16H13N2P. Product ID: ACM68469716. Alfa Chemistry ISO 9001:2015 Certified.
Phrixotoxin 3. Group: Biochemicals. Grades: Purified. CAS No. 880886-00-0. Pack Sizes: 100ug. US Biological Life Sciences.
Worldwide
Phrixotoxin 3
Phrixotoxin 3, a peptide toxin produced by the Chilean copper tarantula (Paraphysa scrofa), is a potent blocker of voltage-gated sodium channels (IC50= 0.6, 42, and 72 nM for NaV1.2, NaV1.3 and NaV1.5 respectively). Synonyms: 6-(phenylsulfinyl)-tetrazolo[1,5-b]pyridazine; DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI. Grade: >99%. CAS No. 880886-00-0. Molecular formula: C176H269N51O48S6. Mole weight: 4059.74.
PHT 427
PHT 427. Group: Biochemicals. Grades: Purified. CAS No. 1191951-57-1. Pack Sizes: 10mg, 50mg. US Biological Life Sciences.
Worldwide
PHT-427
PHT-247 is an inhibitor of the pleckstrin homology (PH) domain of Akt , and it is also an inhibitor of PDPK1 with K i s of 2.7 μM and 5.2 μM and for Akt and PDPK1, respectively. Uses: Scientific research. Group: Signaling pathways. CAS No. 1191951-57-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg; 200 mg. Product ID: HY-12063.
PhTD1
PhTD1 is an antimicrobial peptide found in Papio hamadryas (Hamadryas baboon), and has antibacterial and antifungal activity. Synonyms: PhTD-1; BTD 1; Baboon theta defensin 1; Cyclo(L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-arginyl-L-arginylglycyl-L-valyl-L-cysteinyl-L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-L-threonyl-rginylglycyl-L-phenylalanyl-cysteinyl), cyclic(2→11),(4→9),(13→18)-tris(disulfide); θ-Defensin 1 (Papio anubis); θ-Defensin 1 (Papio hamadryas); θ-Defensin 1 (baboon). Grade: >98%. CAS No. 1085365-19-0. Molecular formula: C80H133N33O19S6. Mole weight: 2053.51.
PhTD3
PhTD3 is an antimicrobial peptide found in Papio hamadryas (Hamadryas baboon), and has antibacterial and antifungal activity. Synonyms: PhTD-3; BTD 3; Baboon theta defensin 3; Cyclo(L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-threonyl-L-arginylglycyl-L-phenylalanyl-L-cysteinyl-L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-L-threonyl-rginylglycyl-L-phenylalanyl-cysteinyl), cyclic(2→11),(4→9),(13→18)-tris(disulfide); θ-Defensin 3 (Papio anubis); θ-Defensin 3 (Papio hamadryas); θ-Defensin 3 (baboon). Grade: >98%. CAS No. 1085365-23-6. Molecular formula: C82H128N30O20S6. Mole weight: 2046.47.
Pht-Gly-b-Ala-OH 99+%
Pht-Gly-b-Ala-OH 99+%. Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 1g, 2.5g. US Biological Life Sciences.
Pht-Gly-beta-Ala-OH. Group: Biochemicals. Alternative Names: Phthaloyl-glycyl-b-alanine. Grades: Highly Purified. CAS No. 17896-84-3. Pack Sizes: 1g, 2g. US Biological Life Sciences.
Worldwide
Phthalaldehyde
Phthalaldehyde is a biochemical assay reagent, which modifies the amino acid and measure the derivative through HPLC. Phthalaldehyde forms a fluorescent compound with α-amino group [1] [2]. Uses: Scientific research. Group: Biochemical assay reagents. Alternative Names: Phthaldialdehyde. CAS No. 643-79-8. Pack Sizes: 25 g. Product ID: HY-W012669.
Phthalaldehyde
Phthalaldehyde. Group: Biochemicals. Grades: Highly Purified. CAS No. 643-79-8. Pack Sizes: 50g, 100g, 250g, 500g, 1kg. US Biological Life Sciences.
Worldwide
Phthalaldehydic Acid
Phthalaldehydic Acid. Group: Biochemicals. Alternative Names: Benzaldehyde-2-carboxylic Acid; 2-Carboxybenzaldehyde; 2-Formylbenzoic Acid. Grades: Highly Purified. CAS No. 119-67-5. Pack Sizes: 100g, 250g, 500g, 1Kg. US Biological Life Sciences.
Worldwide
Phthalamide
White powder, 97%. Synonym: 1,2-Benzenedicarboxamide. CAS No. 88-96-0. Pack Sizes: Typically in stock: 50g, 250g. Mole weight: 164.16. MP/BP: M.P. 223 dec. Order No: FR-0040.
Frinton Laboratories
Phthalan
Phthalan. Group: Biochemicals. Alternative Names: 1,3-Dihydroisobenzofuran; 2-Oxaindan; Dihydroisobenzofuran; Isocoumaran. Grades: Highly Purified. CAS No. 496-14-0. Pack Sizes: 10g. Molecular Formula: C8H8O, Molecular Weight: 120.15. US Biological Life Sciences.
Worldwide
phthalate 4,5-cis-dihydrodiol dehydrogenase
Involved in the phthalate degradation pathway in bacteria. Group: Enzymes. Enzyme Commission Number: EC 1.3.1.64. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1332; phthalate 4,5-cis-dihydrodiol dehydrogenase; EC 1.3.1.64. Cat No: EXWM-1332.
phthalate 4,5-dioxygenase
A system, containing a reductase which is an iron-sulfur flavoprotein (FMN), an iron-sulfur oxygenase, and no independent ferredoxin. Requires Fe2+. Group: Enzymes. Synonyms: PDO phthalate dioxygenase. Enzyme Commission Number: EC 1.14.12.7. CAS No. 63626-44-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0695; phthalate 4,5-dioxygenase; EC 1.14.12.7; 63626-44-8; PDO phthalate dioxygenase. Cat No: EXWM-0695.
Phthalate Ionophore I
function tested. Group: Ionophores potentiometric for ise.
, 1000 mg/L phthalate in water. Group: Anions and cations standards.
Phthalazine
25g Pack Size. Group: Building Blocks, Organics, Research Organics & Inorganics. Formula: C8H6N2. CAS No. 253-52-1. Prepack ID 90030981-25g. Molecular Weight 130.15. See USA prepack pricing.
Phthalazine
Phthalazine. Group: Biochemicals. Alternative Names: 2,3-Benzodiazine; 4,5-Benzopyridazine; [3,4-2]phthalazine. Grades: Highly Purified. CAS No. 253-52-1. Pack Sizes: 2g, 5g, 10g, 25g, 50g. Molecular Formula: C8H6N2. US Biological Life Sciences.
Worldwide
Phthalazine
Phthalazine is a substrate for human aldehyde oxidase 1 , which can lead to the production of ROS and subsequent enzyme inactivation [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 253-52-1. Pack Sizes: 10 mM * 1 mL; 5 g. Product ID: HY-W002016.
Phthalazinone pyrazole
Phthalazinone pyrazole is a potent inhibitor of Aurora A kinase (IC50 = 31 nM). Phthalazinone pyrazole displays good pharmacological profiles with significantly improved oral bioavailability compared to the well studied Aurora inhibitor VX-680. Uses: Designed for use in research and industrial production. Product Category: Inhibitors. Appearance: Solid powder. CAS No. 880487-62-7. Molecular formula: C18H15N5O. Mole weight: 317.35. Purity: >98%. IUPACName: 4-((5-methyl-1H-pyrazol-3-yl)amino)-2-phenylphthalazin-1(2H)-one. Canonical SMILES: O=C1C2=C(C=CC=C2)C(NC3=NNC(C)=C3)=NN1C4=CC=CC=C4. Product ID: ACM880487627. Alfa Chemistry ISO 9001:2015 Certified.
Phthaldialdehyde
Yellowish crystals, 97%. Synonym: Benzene-1,2-dicarboxakdehyde. CAS No. 643-79-8. Pack Sizes: Typically in stock: 10g, 50g. Mole weight: 134.13. MP/BP: M.P. 55-58. Order No: FR-2076.
Frinton Laboratories
Phthalein purple
Phthalein purple. Group: Biochemicals. Alternative Names: o-Cresolphthalein complexone; Metalphthalein; Xyl enyl phthaleinbisi minodiacetic acid. Grades: Highly Purified. CAS No. 2411-89-4. Pack Sizes: 25g, 50g, 100g, 250g. US Biological Life Sciences.
Worldwide
Phthalein purple ACS
Phthalein purple ACS. Group: Biochemicals. Grades: ACS Grade. Pack Sizes: 25g, 100g, 250g. US Biological Life Sciences.
Worldwide
Phthalhydrazide
Phthalhydrazide. Group: Biochemicals. Grades: Highly Purified. CAS No. 1445-69-8. Pack Sizes: 100g, 250g, 500g, 1kg. US Biological Life Sciences.
1kg Pack Size. Group: Building Blocks, Organics. Formula: C8H6O4. CAS No. 88-99-3. Prepack ID 38157787-1kg. Molecular Weight 166.13. See USA prepack pricing.
Phthalic acid
Phthalic acid is the final common metabolite of phthalic acid esters (PAEs). Phthalic acid can be used for the synthesis of synthetic agents, such as isophthalic acid (IPA), and terephthalic acid (TPA). Phthalic acid has applications in the preparation of phthalate ester plasticizers [1]. Uses: Scientific research. Group: Natural products. CAS No. 88-99-3. Pack Sizes: 10 mM * 1 mL; 1 g. Product ID: HY-I0508.
Phthalic acid
United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standardspesticides & metabolitespesticides & metaboliteseuropean pharmacopoeia (ph. eur.)pharmacopoeial standards. Alternative Names: Fluorescein Sodium Imp. B (EP), Fluorescein Imp. B (EP), Phthalic acid,Benzene-1,2-dicarboxylic Acid.
Phthalic Acid
Organic reagent used to synthesize phthalates. Group: Biochemicals. Alternative Names: 1,2-Benzenedicarboxylic Acid; M 2; NSC 5348; Sunftal 20; o-Benzenedicarboxylic Acid; o-Carboxybenzoic Acid; o-Dicarboxybenzene. Grades: Highly Purified. CAS No. 88-99-3. Pack Sizes: 10g. US Biological Life Sciences.
Worldwide
Phthalic Acid
Phthalic acid is an aromatic dicarboxylic acid, with formula C6H4(CO2H)2. It is an isomer of isophthalic acid and terephthalic acid. Although phthalic acid is of modest commercial importance, the closely related derivative phthalic anhydride is a commodity chemical produced on a large scale. Group: Monomers. Alternative Names: 1,2-Benzenedicarboxylic acid. CAS No. 88-99-3. Product ID: Phthalic acid. Molecular formula: 166.13. Mole weight: C8H6O4. C1=CC=C(C(=C1)C(=O)O)C(=O)O. InChI=1S/C8H6O4/c9-7 (10)5-3-1-2-4-6 (5)8 (11)12/h1-4H, (H, 9, 10) (H, 11, 12). XNGIFLGASWRNHJ-UHFFFAOYSA-N. 99%.
Phthalic Acid
Phthalic Acid. CAS No. 88-99-3. Molecular Formula C6H4(COOH)2. Chemical Reagents
Cater Chemicals Corp. Illinois IL
Phthalic Acid 1-(1,2-dimethylpropyl) Ester
Phthalic Acid 1-(1,2-dimethylpropyl) Ester, is used as an industrial plasticizer,that induces peroxisome proliferation. It is also shown to activate the nuclear receptors PPARs and induce differentiation of F9 cells. Group: Biochemicals. Grades: Highly Purified. CAS No. 198284-10-5. Pack Sizes: 250mg, 2.5g. Molecular Formula: C13H16O4, Molecular Weight: 236.26. US Biological Life Sciences.
Worldwide
Phthalic Acid 1-(1,2-dimethylpropyl) Ester-d4
Phthalic Acid 1-(1,2-dimethylpropyl) Ester-d4, is the labeled analogue of Phthalic Acid 1-(1,2-dimethylpropyl) Ester (P384490), used as an industrial plasticizer,that induces peroxisome proliferation. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 5mg, 50mg. Molecular Formula: C13H12D4O4, Molecular Weight: 240.29. US Biological Life Sciences.
Worldwide
Phthalic Acid-13C2
Labeled Phthalic Acid. Organic reagent used to synthesize phthalates. Group: Biochemicals. Alternative Names: 1,2-(Benzene-d4)dicarboxylic Acid; M 2-13C2; NSC 5348-13C2; Sunftal 20-13C2; o-(Benzene-13C2dicarboxylic Acid; o-Carboxybenzoic Acid-13C2; o-Dicarboxybenzene-13C2. Grades: Highly Purified. Pack Sizes: 50mg. US Biological Life Sciences.
Worldwide
Phthalic acid-[3,4,5,6-d4]
Phthalic acid-[3,4,5,6-d4]. Uses: Organic reagent used to synthesize phthalates. Synonyms: Phthalic acid-phenyl-d4; 1,2-(Benzene-d4)dicarboxylic Acid; NSC 5348-d4; Sunftal 20-d4; o-(Benzene-d4)dicarboxylic Acid; o-Carboxybenzoic Acid-d4; o-Dicarboxybenzene-d4. Grade: ≥98% by CP; ≥98% atom D. CAS No. 87976-26-9. Molecular formula: C8H2D4O4. Mole weight: 170.16.
Phthalic Acid 4,5-cis-Dihydrodiol
Phthalic Acid 4,5-cis-Dihydrodiol is a bacterial metabolite of phthalic acid (P384480) which is an organic reagent used to synthesize phthalates. Group: Biochemicals. Grades: Highly Purified. CAS No. 130073-64-2. Pack Sizes: 5mg, 50mg. Molecular Formula: C8H8O6, Molecular Weight: 200.15. US Biological Life Sciences.
Worldwide
Phthalic Acid 8-Methylnonyl Ester
Phthalic Acid 8-Methylnonyl Ester. Group: Biochemicals. Alternative Names: 1,2-Benzenedicarboxylic Acid 1-(8-Methylnonyl) Ester; 1,2-Benzenedicarboxylic Acid Mono(8-methylnonyl) Ester. Grades: Highly Purified. CAS No. 69725-01-5. Pack Sizes: 50mg. Molecular Formula: C18H26O4, Molecular Weight: 306.399999999999. US Biological Life Sciences.
Labeled Phthalic Acid. Organic reagent used to synthesize phthalates. Group: Biochemicals. Alternative Names: 1,2-(Benzene-d4)dicarboxylic Acid; M 2-d4; NSC 5348-d4; Sunftal 20-d4; o-(Benzene-d4)dicarboxylic Acid; o-Carboxybenzoic Acid-d4; o-Dicarboxybenzene-d4. Grades: Highly Purified. CAS No. 87976-26-9. Pack Sizes: 100mg. US Biological Life Sciences.
Worldwide
Phthalic anhydride
Our wide distribution network, with locations coast-to-coast, helps guarantee fast, reliable service to Univar's customers.
Phthalic Anhydride
Phthalic Anhydride. We stock inventory in warehouses throughout the United States, allowing us to serve customers in all regions in a timely and cost effective manner.
California
Phthalic Anhydride 85-44-9
Phthalic Anhydride - Surface Coatings. SUPPLIERS TO BUSINESS CUSTOMERS ONLY.
North America & APAC
Phthalic anhydride, 99.0-100.2% ACS
Phthalic Anhydride is an organic compound and the anhydride of phthalic acid. Phthalic Anhydride is an important industrial chemical commonly used in large-scale production of plasticizers for plastics. Recent research have also evaluated Phthalic Anhydride as potential antibacterial agent. Group: Biochemicals. Grades: ACS Grade. CAS No. 85-44-9. Pack Sizes: 250g, 1Kg, 2.5Kg, 5Kg. Molecular Formula: C?H?O?, Molecular Weight: 148.11. US Biological Life Sciences.
Phthalic Anhydride (Phenyl-13C6, D4) is labelled Phthalic Anhydride (P384485) which is the anhydride of phthalic acid (P384480). Phthalic Anhydride is an important industrial chemical commonly used in large-scale production of plasticizers for plastics. Recent research have also evaluated Phthalic Anhydride as potential antibacterial agent. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 1mg. Molecular Formula: C213C6D4O3, Molecular Weight: 158.1. US Biological Life Sciences.
Worldwide
Phthalic-D4-anhydride
Phthalic-D4-anhydride. Group: Biochemicals. Grades: Highly Purified. CAS No. 75935-32-9. Pack Sizes: 100mg, 250mg, 500mg, 1g, 2g. Molecular Formula: C8D4O3. US Biological Life Sciences.