American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
Photoinduced CuInS2(CIS)/ZnS Quantum Dots Photoinduced CuInS2(CIS)/ZnS Quantum Dots. Group: Photoinduced cuins2(cis)/zns quantum dots. Water. Alfa Chemistry Materials 7
Photoinitiator 947-19-3 Photoinitiator - Surface Coatings. SUPPLIERS TO BUSINESS CUSTOMERS ONLY. Redox
North America & APAC
Photomirex A toxic metabolite of Mirex. A photodegradaton product of the insecticide Mirex, is an environmental contaminant that has been identified in Great Lakes fish, soil, and human adipose tissue. Group: Biochemicals. Alternative Names: 1, 1a, 2, 2, 3, 3a, 4, 5, 5, 5a, 5b-Undecachlorooctahydro-. Grades: Highly Purified. CAS No. 39801-14-4. Pack Sizes: 5mg. US Biological Life Sciences. USBiological 2
Worldwide
Photoregulin3 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
photosystem I Contains chlorophyll, phylloquinones, carotenoids and [4Fe-4S] clusters.Cytochrome c6 can act as an alternative electron donor, and flavodoxin as an alternative acceptor in some species. Group: Enzymes. Enzyme Commission Number: EC 1.97.1.12. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1691; photosystem I; EC 1.97.1.12. Cat No: EXWM-1691. Creative Enzymes
photosystem II Contains chlorophyll a, β-carotene, pheophytin, plastoquinone, a Mn4Ca cluster, heme and non-heme iron. Four successive photoreactions, resulting in a storage of four positive charges, are required to oxidize two water molecules to one oxygen molecule. Group: Enzymes. Enzyme Commission Number: EC 1.10.3.9. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0487; photosystem II; EC 1.10.3.9. Cat No: EXWM-0487. Creative Enzymes
Phoxim Phoxim is an organic phosphorus pesticide and widely applies worldwide for agricultural purposes [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 14816-18-3. Pack Sizes: 120 μg (335.23 μM * 1.2 mL in Methanol). Product ID: HY-B0819. MedChemExpress MCE
PHP 501 trifluoroacetate PHP 501 trifluoroacetate. Group: Biochemicals. Grades: Purified. CAS No. 1236105-75-1. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
PhpC PhpC is a G-clamp analogue. PhpC shows antiproliferative activity against MCF7 cells, with an IC50 of 387.9 ?M. PhpC modulates G-quadruplex-RNA landscapes in human cells[1]. Uses: Scientific research. Group: Signaling pathways. Pack Sizes: 5 mg; 10 mg; 25 mg. Product ID: HY-164421. MedChemExpress MCE
PHPS1 PHPS1 is a potent and selective Shp2 inhibitor with K i s of 0.73, 5.8, 10.7, 5.8, and 0.47 μM for Shp2, Shp2-R362K, Shp1, PTP1B, and PTP1B-Q, respectively [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 314291-83-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-112368. MedChemExpress MCE
PHPS1 PHPS1 is an inhibitor of the protein tyrosine phosphatase Shp2. PHPS1 also efficiently inhibits activation of Erk1/2 by the leukemia-associated Shp2 mutant, Shp2-E76K, and blocks the anchorage-independent growth of a variety of human tumor cell lines. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PHPS1; PHPS 1; PHPS-1. Product Category: Inhibitors. Appearance: Solid powder. CAS No. 314291-83-3. Molecular formula: C21H15N5O6S. Mole weight: 465.44. Purity: >98%. IUPACName: 4-[2-[1,5-dihydro-3-(4-nitrophenyl)-5-oxo-1-phenyl-4H-pyrazol-4-ylidene]hydrazinyl]-benzenesulfonic Acid. Canonical SMILES: O=S(C1=CC=C(N/N=C2C(C3=CC=C([N+]([O-])=O)C=C3)=NN(C4=CC=CC=C4)C\2=O)C=C1)(O)=O. Product ID: ACM314291833-1. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry.
PHPS1 sodium PHPS1 sodium is a potent and selective Shp2 inhibitor with K i s of 0.73, 5.8, 10.7, 5.8, and 0.47 μM for Shp2, Shp2-R362K, Shp1, PTP1B, and PTP1B-Q, respectively [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1177131-02-0. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-125108. MedChemExpress MCE
Phps1 sodium salt hydrate Phps1 sodium salt hydrate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PTP Inhibitor V, PHPS1, CTK8E6636, 314291-83-3. Product Category: Heterocyclic Organic Compound. CAS No. 314291-83-3. Molecular formula: C21H14N5O6SNa.xH2O. Mole weight: 487.42 (anhydrous basis). Purity: 0.96. IUPACName: [4-[2-[3-[4-(nitromethyl)phenyl]-5-oxo-1-phenylpyrazol-4-ylidene]hydrazinyl]phenyl]methanesulfonic acid. Canonical SMILES: C1=CC=C(C=C1)N2C(=O)C(=NNC3=CC=C(C=C3)CS(=O)(=O)O)C(=N2)C4=CC=C(C=C4)C[N+](=O)[O-]. Product ID: ACM314291833. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 5
PHPS1 sodium salt hydrate ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
Phpy2 Phpy2. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PHPY2;2-[PHENYL(PYRIDIN-2-YL)PHOSPHINO]PYRIDINE. Product Category: Heterocyclic Organic Compound. CAS No. 68469-71-6. Molecular formula: C16H13N2P. Product ID: ACM68469716. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 5
Phrixotoxin-2 >98% (HPLC), lyophilized powder. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Phrixotoxin 3 Phrixotoxin 3, a peptide toxin produced by the Chilean copper tarantula (Paraphysa scrofa), is a potent blocker of voltage-gated sodium channels (IC50= 0.6, 42, and 72 nM for NaV1.2, NaV1.3 and NaV1.5 respectively). Synonyms: 6-(phenylsulfinyl)-tetrazolo[1,5-b]pyridazine; DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI. Grade: >99%. CAS No. 880886-00-0. Molecular formula: C176H269N51O48S6. Mole weight: 4059.74. BOC Sciences
Phrixotoxin 3 Phrixotoxin 3. Group: Biochemicals. Grades: Purified. CAS No. 880886-00-0. Pack Sizes: 100ug. US Biological Life Sciences. USBiological 5
Worldwide
PHT 427 PHT 427. Group: Biochemicals. Grades: Purified. CAS No. 1191951-57-1. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
PHT-427 PHT-247 is an inhibitor of the pleckstrin homology (PH) domain of Akt , and it is also an inhibitor of PDPK1 with K i s of 2.7 μM and 5.2 μM and for Akt and PDPK1, respectively. Uses: Scientific research. Group: Signaling pathways. CAS No. 1191951-57-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg; 200 mg. Product ID: HY-12063. MedChemExpress MCE
PhTD1 PhTD1 is an antimicrobial peptide found in Papio hamadryas (Hamadryas baboon), and has antibacterial and antifungal activity. Synonyms: PhTD-1; BTD 1; Baboon theta defensin 1; Cyclo(L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-arginyl-L-arginylglycyl-L-valyl-L-cysteinyl-L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-L-threonyl-rginylglycyl-L-phenylalanyl-cysteinyl), cyclic(2→11),(4→9),(13→18)-tris(disulfide); θ-Defensin 1 (Papio anubis); θ-Defensin 1 (Papio hamadryas); θ-Defensin 1 (baboon). Grade: >98%. CAS No. 1085365-19-0. Molecular formula: C80H133N33O19S6. Mole weight: 2053.51. BOC Sciences 11
PhTD3 PhTD3 is an antimicrobial peptide found in Papio hamadryas (Hamadryas baboon), and has antibacterial and antifungal activity. Synonyms: PhTD-3; BTD 3; Baboon theta defensin 3; Cyclo(L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-threonyl-L-arginylglycyl-L-phenylalanyl-L-cysteinyl-L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-L-threonyl-rginylglycyl-L-phenylalanyl-cysteinyl), cyclic(2→11),(4→9),(13→18)-tris(disulfide); θ-Defensin 3 (Papio anubis); θ-Defensin 3 (Papio hamadryas); θ-Defensin 3 (baboon). Grade: >98%. CAS No. 1085365-23-6. Molecular formula: C82H128N30O20S6. Mole weight: 2046.47. BOC Sciences 11
Pht-Gly-b-Ala-OH 99+% Pht-Gly-b-Ala-OH 99+%. Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 1g, 2.5g. US Biological Life Sciences. USBiological 5
Worldwide
Pht-Gly-β-Ala-OH Pht-Gly-β-Ala-OH. Synonyms: Phthaloyl-glycyl-β-alanine; 3-(2-(1,3-Dioxoisoindolin-2-yl)acetamido)propanoic acid; Pht Gly β Ala OH. Grade: ≥ 99%. CAS No. 17896-84-3. Molecular formula: C13H12N2O5. Mole weight: 276.25. BOC Sciences 11
Pht-Gly-beta-Ala-OH Pht-Gly-beta-Ala-OH. Group: Biochemicals. Alternative Names: Phthaloyl-glycyl-b-alanine. Grades: Highly Purified. CAS No. 17896-84-3. Pack Sizes: 1g, 2g. US Biological Life Sciences. USBiological 8
Worldwide
Phthalaldehyde Phthalaldehyde. Group: Biochemicals. Grades: Highly Purified. CAS No. 643-79-8. Pack Sizes: 50g, 100g, 250g, 500g, 1kg. US Biological Life Sciences. USBiological 8
Worldwide
Phthalaldehyde Phthalaldehyde is a biochemical assay reagent, which modifies the amino acid and measure the derivative through HPLC. Phthalaldehyde forms a fluorescent compound with α-amino group [1] [2]. Uses: Scientific research. Group: Biochemical assay reagents. Alternative Names: Phthaldialdehyde. CAS No. 643-79-8. Pack Sizes: 25 g. Product ID: HY-W012669. MedChemExpress MCE
Phthalaldehydic Acid Phthalaldehydic Acid. Group: Biochemicals. Alternative Names: Benzaldehyde-2-carboxylic Acid; 2-Carboxybenzaldehyde; 2-Formylbenzoic Acid. Grades: Highly Purified. CAS No. 119-67-5. Pack Sizes: 100g, 250g, 500g, 1Kg. US Biological Life Sciences. USBiological 8
Worldwide
Phthalamide White powder, 97%. Synonym: 1,2-Benzenedicarboxamide. CAS No. 88-96-0. Pack Sizes: Typically in stock: 50g, 250g. Mole weight: 164.16. MP/BP: M.P. 223 dec. Order No: FR-0040. Frinton Laboratories Inc
Frinton Laboratories
Phthalan Phthalan. Group: Biochemicals. Alternative Names: 1,3-Dihydroisobenzofuran; 2-Oxaindan; Dihydroisobenzofuran; Isocoumaran. Grades: Highly Purified. CAS No. 496-14-0. Pack Sizes: 10g. Molecular Formula: C8H8O, Molecular Weight: 120.15. US Biological Life Sciences. USBiological 3
Worldwide
phthalate 4,5-cis-dihydrodiol dehydrogenase Involved in the phthalate degradation pathway in bacteria. Group: Enzymes. Enzyme Commission Number: EC 1.3.1.64. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1332; phthalate 4,5-cis-dihydrodiol dehydrogenase; EC 1.3.1.64. Cat No: EXWM-1332. Creative Enzymes
phthalate 4,5-dioxygenase A system, containing a reductase which is an iron-sulfur flavoprotein (FMN), an iron-sulfur oxygenase, and no independent ferredoxin. Requires Fe2+. Group: Enzymes. Synonyms: PDO phthalate dioxygenase. Enzyme Commission Number: EC 1.14.12.7. CAS No. 63626-44-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0695; phthalate 4,5-dioxygenase; EC 1.14.12.7; 63626-44-8; PDO phthalate dioxygenase. Cat No: EXWM-0695. Creative Enzymes
Phthalate Ionophore I function tested. Group: Ionophores potentiometric for ise. Alfa Chemistry Analytical Products 2
Phthalates certified reference material. Group: Certified reference materials (crms). Alfa Chemistry Analytical Products
Phthalates - PT Proficiency Testing Material. Group: Plasticizers & phthalates. Alfa Chemistry Analytical Products
Phthalate Standard for IC , 1000 mg/L phthalate in water. Group: Anions and cations standards. Alfa Chemistry Analytical Products
Phthalazine 25g Pack Size. Group: Building Blocks, Organics, Research Organics & Inorganics. Formula: C8H6N2. CAS No. 253-52-1. Prepack ID 90030981-25g. Molecular Weight 130.15. See USA prepack pricing. Molekula Americas
Phthalazine Phthalazine is a substrate for human aldehyde oxidase 1 , which can lead to the production of ROS and subsequent enzyme inactivation [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 253-52-1. Pack Sizes: 10 mM * 1 mL; 5 g. Product ID: HY-W002016. MedChemExpress MCE
Phthalazine Phthalazine. Group: Biochemicals. Alternative Names: 2,3-Benzodiazine; 4,5-Benzopyridazine; [3,4-2]phthalazine. Grades: Highly Purified. CAS No. 253-52-1. Pack Sizes: 2g, 5g, 10g, 25g, 50g. Molecular Formula: C8H6N2. US Biological Life Sciences. USBiological 8
Worldwide
Phthalazinone pyrazole Phthalazinone pyrazole is a potent inhibitor of Aurora A kinase (IC50 = 31 nM). Phthalazinone pyrazole displays good pharmacological profiles with significantly improved oral bioavailability compared to the well studied Aurora inhibitor VX-680. Uses: Designed for use in research and industrial production. Product Category: Inhibitors. Appearance: Solid powder. CAS No. 880487-62-7. Molecular formula: C18H15N5O. Mole weight: 317.35. Purity: >98%. IUPACName: 4-((5-methyl-1H-pyrazol-3-yl)amino)-2-phenylphthalazin-1(2H)-one. Canonical SMILES: O=C1C2=C(C=CC=C2)C(NC3=NNC(C)=C3)=NN1C4=CC=CC=C4. Product ID: ACM880487627. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry.
Phthaldialdehyde Yellowish crystals, 97%. Synonym: Benzene-1,2-dicarboxakdehyde. CAS No. 643-79-8. Pack Sizes: Typically in stock: 10g, 50g. Mole weight: 134.13. MP/BP: M.P. 55-58. Order No: FR-2076. Frinton Laboratories Inc
Frinton Laboratories
Phthalein purple Phthalein purple. Group: Biochemicals. Alternative Names: o-Cresolphthalein complexone; Metalphthalein; Xyl enyl phthaleinbisi minodiacetic acid. Grades: Highly Purified. CAS No. 2411-89-4. Pack Sizes: 25g, 50g, 100g, 250g. US Biological Life Sciences. USBiological 8
Worldwide
Phthalein purple ACS Phthalein purple ACS. Group: Biochemicals. Grades: ACS Grade. Pack Sizes: 25g, 100g, 250g. US Biological Life Sciences. USBiological 5
Worldwide
Phthalhydrazide Phthalhydrazide. Group: Biochemicals. Grades: Highly Purified. CAS No. 1445-69-8. Pack Sizes: 100g, 250g, 500g, 1kg. US Biological Life Sciences. USBiological 8
Worldwide
Phthalic acid Phthalic acid is the final common metabolite of phthalic acid esters (PAEs). Phthalic acid can be used for the synthesis of synthetic agents, such as isophthalic acid (IPA), and terephthalic acid (TPA). Phthalic acid has applications in the preparation of phthalate ester plasticizers [1]. Uses: Scientific research. Group: Natural products. CAS No. 88-99-3. Pack Sizes: 10 mM * 1 mL; 1 g. Product ID: HY-I0508. MedChemExpress MCE
Phthalic acid analytical standard. Group: Processing & packaging contaminant standards. Alfa Chemistry Analytical Products
Phthalic acid 1kg Pack Size. Group: Building Blocks, Organics. Formula: C8H6O4. CAS No. 88-99-3. Prepack ID 38157787-1kg. Molecular Weight 166.13. See USA prepack pricing. Molekula Americas
Phthalic acid United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standardspesticides & metabolitespesticides & metaboliteseuropean pharmacopoeia (ph. eur.)pharmacopoeial standards. Alternative Names: Fluorescein Sodium Imp. B (EP), Fluorescein Imp. B (EP), Phthalic acid,Benzene-1,2-dicarboxylic Acid. Alfa Chemistry Analytical Products
Phthalic Acid Phthalic Acid. CAS No. 88-99-3. Molecular Formula C6H4(COOH)2. Chemical Reagents Cater Chemicals Corp.
Cater Chemicals Corp. Illinois IL
Phthalic Acid Organic reagent used to synthesize phthalates. Group: Biochemicals. Alternative Names: 1,2-Benzenedicarboxylic Acid; M 2; NSC 5348; Sunftal 20; o-Benzenedicarboxylic Acid; o-Carboxybenzoic Acid; o-Dicarboxybenzene. Grades: Highly Purified. CAS No. 88-99-3. Pack Sizes: 10g. US Biological Life Sciences. USBiological 2
Worldwide
Phthalic Acid Phthalic acid is an aromatic dicarboxylic acid, with formula C6H4(CO2H)2. It is an isomer of isophthalic acid and terephthalic acid. Although phthalic acid is of modest commercial importance, the closely related derivative phthalic anhydride is a commodity chemical produced on a large scale. Group: Monomers. Alternative Names: 1,2-Benzenedicarboxylic acid. CAS No. 88-99-3. Product ID: Phthalic acid. Molecular formula: 166.13. Mole weight: C8H6O4. C1=CC=C(C(=C1)C(=O)O)C(=O)O. InChI=1S/C8H6O4/c9-7 (10)5-3-1-2-4-6 (5)8 (11)12/h1-4H, (H, 9, 10) (H, 11, 12). XNGIFLGASWRNHJ-UHFFFAOYSA-N. 99%. Alfa Chemistry Materials 4
Phthalic Acid 1-(1,2-dimethylpropyl) Ester Phthalic Acid 1-(1,2-dimethylpropyl) Ester, is used as an industrial plasticizer,that induces peroxisome proliferation. It is also shown to activate the nuclear receptors PPARs and induce differentiation of F9 cells. Group: Biochemicals. Grades: Highly Purified. CAS No. 198284-10-5. Pack Sizes: 250mg, 2.5g. Molecular Formula: C13H16O4, Molecular Weight: 236.26. US Biological Life Sciences. USBiological 3
Worldwide
Phthalic Acid 1-(1,2-dimethylpropyl) Ester-d4 Phthalic Acid 1-(1,2-dimethylpropyl) Ester-d4, is the labeled analogue of Phthalic Acid 1-(1,2-dimethylpropyl) Ester (P384490), used as an industrial plasticizer,that induces peroxisome proliferation. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 5mg, 50mg. Molecular Formula: C13H12D4O4, Molecular Weight: 240.29. US Biological Life Sciences. USBiological 2
Worldwide
Phthalic Acid-13C2 Labeled Phthalic Acid. Organic reagent used to synthesize phthalates. Group: Biochemicals. Alternative Names: 1,2-(Benzene-d4)dicarboxylic Acid; M 2-13C2; NSC 5348-13C2; Sunftal 20-13C2; o-(Benzene-13C2dicarboxylic Acid; o-Carboxybenzoic Acid-13C2; o-Dicarboxybenzene-13C2. Grades: Highly Purified. Pack Sizes: 50mg. US Biological Life Sciences. USBiological 2
Worldwide
Phthalic acid-[3,4,5,6-d4] Phthalic acid-[3,4,5,6-d4]. Uses: Organic reagent used to synthesize phthalates. Synonyms: Phthalic acid-phenyl-d4; 1,2-(Benzene-d4)dicarboxylic Acid; NSC 5348-d4; Sunftal 20-d4; o-(Benzene-d4)dicarboxylic Acid; o-Carboxybenzoic Acid-d4; o-Dicarboxybenzene-d4. Grade: ≥98% by CP; ≥98% atom D. CAS No. 87976-26-9. Molecular formula: C8H2D4O4. Mole weight: 170.16. BOC Sciences 2
Phthalic Acid 4,5-cis-Dihydrodiol Phthalic Acid 4,5-cis-Dihydrodiol is a bacterial metabolite of phthalic acid (P384480) which is an organic reagent used to synthesize phthalates. Group: Biochemicals. Grades: Highly Purified. CAS No. 130073-64-2. Pack Sizes: 5mg, 50mg. Molecular Formula: C8H8O6, Molecular Weight: 200.15. US Biological Life Sciences. USBiological 1
Worldwide
Phthalic Acid 8-Methylnonyl Ester Phthalic Acid 8-Methylnonyl Ester. Group: Biochemicals. Alternative Names: 1,2-Benzenedicarboxylic Acid 1-(8-Methylnonyl) Ester; 1,2-Benzenedicarboxylic Acid Mono(8-methylnonyl) Ester. Grades: Highly Purified. CAS No. 69725-01-5. Pack Sizes: 50mg. Molecular Formula: C18H26O4, Molecular Weight: 306.399999999999. US Biological Life Sciences. USBiological 3
Worldwide
Phthalic Acid 8-Methylnonyl Ester-d4 Phthalic Acid 8-Methylnonyl Ester-d4. Group: Biochemicals. Alternative Names: 1,2-Benzenedicarboxylic Acid 1-(8-Methylnonyl) Ester-d4; 1,2-Benzenedicarboxylic Acid Mono(8-methylnonyl) Ester-d4. Grades: Highly Purified. Pack Sizes: 5mg. Molecular Formula: C18H24D4O4, Molecular Weight: 310.42. US Biological Life Sciences. USBiological 3
Worldwide
Phthalic Acid Anhydride-13C2 Organic reagent used to synthesize phthalates. Group: Biochemicals. Alternative Names: 1,2-Benzenedicarboxylic Anhydride-13C2; 1,3-Phthalandione-13C2; 2-Benzofuran-1,3-dione-13C2; Araldite HT 901-13C2; ESEN-13C2; HT 901-13C2; NSC 10431-13C2; Phthalandione-13C2; Phthalanhydride-13C2; Phthalic acid anhydride-13C2; Retarder AK-13C2; Retarder B-C-13C2; Retarder ESEN-13C2; Retarder PD-13C2; Rikacid PA-13C2; Sconoc 5-13C2; Sconoc 7-13C2; TGL 6525-13C2; Vulkalent B/C-13C2. Grades: Highly Purified. Pack Sizes: 25mg. US Biological Life Sciences. USBiological 2
Worldwide
Phthalic Acid Bis(2-butoxyethyl) Ester Liquid. Group: Plastic additivesplasticizers. CAS No. 117-83-9. Product ID: bis(2-butoxyethyl) benzene-1,2-dicarboxylate. Molecular formula: 366.4g/mol. Mole weight: C20H30O6. CCCCOCCOC (=O)C1=CC=CC=C1C (=O)OCCOCCCC. InChI=1S / C20H30O6 / c1-3-5-11-23-13-15-25-19 (21) 17-9-7-8-10-18 (17) 20 (22) 26-16-14-24-12-6-4-2 / h7-10H, 3-6, 11-16H2, 1-2H3. CMCJNODIWQEOAI-UHFFFAOYSA-N. Alfa Chemistry Materials 4
Phthalic Acid Cyclohexyl Isobutyl Ester-d4 Phthalic Acid Cyclohexyl Isobutyl Ester-d4. Group: Biochemicals. Alternative Names: NSC 2387-d4;NSC 67410-d4; 1,2-Benzenedicarboxylic Acid, Cyclohexyl 2-Methylpropyl Ester-d4; 1,2-Benzenedicarboxylic Acid, 1-Cyclohexyl 2-(2-Methylpropyl) Ester-d4. Grades: Highly Purified. Pack Sizes: 5mg. Molecular Formula: C18H20D4O4, Molecular Weight: 308.41. US Biological Life Sciences. USBiological 3
Worldwide
Phthalic Acid-d4 Labeled Phthalic Acid. Organic reagent used to synthesize phthalates. Group: Biochemicals. Alternative Names: 1,2-(Benzene-d4)dicarboxylic Acid; M 2-d4; NSC 5348-d4; Sunftal 20-d4; o-(Benzene-d4)dicarboxylic Acid; o-Carboxybenzoic Acid-d4; o-Dicarboxybenzene-d4. Grades: Highly Purified. CAS No. 87976-26-9. Pack Sizes: 100mg. US Biological Life Sciences. USBiological 2
Worldwide
Phthalic anhydride Our wide distribution network, with locations coast-to-coast, helps guarantee fast, reliable service to Univar's customers. Univar Solutions
Phthalic Anhydride Phthalic Anhydride. We stock inventory in warehouses throughout the United States, allowing us to serve customers in all regions in a timely and cost effective manner. Neuchem
California
Phthalic Anhydride 85-44-9 Phthalic Anhydride - Surface Coatings. SUPPLIERS TO BUSINESS CUSTOMERS ONLY. Redox
North America & APAC
Phthalic anhydride, 99.0-100.2% ACS Phthalic Anhydride is an organic compound and the anhydride of phthalic acid. Phthalic Anhydride is an important industrial chemical commonly used in large-scale production of plasticizers for plastics. Recent research have also evaluated Phthalic Anhydride as potential antibacterial agent. Group: Biochemicals. Grades: ACS Grade. CAS No. 85-44-9. Pack Sizes: 250g, 1Kg, 2.5Kg, 5Kg. Molecular Formula: C?H?O?, Molecular Weight: 148.11. US Biological Life Sciences. USBiological 5
Worldwide
Phthalic anhydride-[d4] Phthalic anhydride-[d4]. Synonyms: Phthalic anhydride-d4; Phthalic-d4 Anhydride; 1,2-Benzenedicarboxylic Anhydride-d4; 1,3-Phthalandione-d4; 2-Benzofuran-1,3-dione-d4; NSC 10431-d4; Phthalandione-d4; Phthalanhydride-d4; Phthalic Acid Anhydride-d4. Grade: 99%; 98% atom D. CAS No. 75935-32-9. Molecular formula: C8D4O3. Mole weight: 152.14. BOC Sciences 2
Phthalic Anhydride (Phenyl-13C6, D4) Phthalic Anhydride (Phenyl-13C6, D4) is labelled Phthalic Anhydride (P384485) which is the anhydride of phthalic acid (P384480). Phthalic Anhydride is an important industrial chemical commonly used in large-scale production of plasticizers for plastics. Recent research have also evaluated Phthalic Anhydride as potential antibacterial agent. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 1mg. Molecular Formula: C213C6D4O3, Molecular Weight: 158.1. US Biological Life Sciences. USBiological 5
Worldwide
Phthalic-D4-anhydride Phthalic-D4-anhydride. Group: Biochemicals. Grades: Highly Purified. CAS No. 75935-32-9. Pack Sizes: 100mg, 250mg, 500mg, 1g, 2g. Molecular Formula: C8D4O3. US Biological Life Sciences. USBiological 8
Worldwide
Phthalic Hydrazide Phthalic Hydrazide. Group: Biochemicals. Alternative Names: 2,3-Dihydro-1,4-phthalazinedione; Cyclic Hydrazide-1,2-benzenedicarboxylic Acid; 1,4-Dihydroxyphthalazine; 1,4-Phthalazinediol; 2,3-Dihydro-1,4-phthalazinedione; 4-Hydroxyphthalazin-1(2H)-one; Hydrazine, 1,2-(1,2-phenylenedicarbonyl)-; N,N'-Phthaloylhydrazine; NSC 201511; NSC 651; Phthalazine-1,4(2H,3H)-dione; Phthalhydrazide; Phthalic Acid Cyclic Hydrazide; Phthalocyclohydrazide. Grades: Highly Purified. CAS No. 1445-69-8. Pack Sizes: 1g. Molecular Formula: C8H6N2O2, Molecular Weight: 162.15. US Biological Life Sciences. USBiological 3
Worldwide

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products