A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| Phospho-STAT3 (Tyr705) Antibody [B17F7] | Phospho-Stat3 (Tyr705),p-Stat3,STAT3 (phospho Y705). Group: Antibodies. Alternative Names: Phospho-Stat3 (Tyr705),p-Stat3,STAT3 (phospho Y705), STAT3. CAS No. Pack Sizes: 20uL. Product ID: F0157. Storage Conditions: -20°C (avoid freeze-thaw cycles), 2 years. |  United States; Europe |
| Phospho-STAT6 (Tyr641) Antibody [A16N6] | Phospho-Stat6 (Tyr641),STAT6 (phospho Y641). Group: Antibodies. Alternative Names: Phospho-Stat6 (Tyr641),STAT6 (phospho Y641). Pack Sizes: 20uL. Product ID: F0555. Storage Conditions: -20°C (avoid freeze-thaw cycles), 2 years. | United States; Europe |
| phosphosulfolactate synthase | Requires Mg2+. The enzyme from the archaeon Methanococcus jannaschii catalyses the Michael addition of sulfite to phosphoenolpyruvate. It specifically requires phosphoenolpyruvate and its broad alkaline pH optimum suggests that it uses sulfite rather than hydrogensulfite. Group: Enzymes. Synonyms: (2R)-phospho-3-sulfolactate synthase; (2R)-O-phospho-3-sulfolactate sulfo-lyase. Enzyme Commission Number: EC 4.4.1.19. CAS No. 473575-53-0. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5320; phosphosulfolactate synthase; EC 4.4.1.19; 473575-53-0; (2R)-phospho-3-sulfolactate synthase; (2R)-O-phospho-3-sulfolactate sulfo-lyase. Cat No: EXWM-5320. |  |
| Phospho-TBK1/NAK (Ser172) Antibody [H16A23] | NAK/TBK1 (phospho S172),Phospho-TBK1/NAK (Ser172). Group: Antibodies. Alternative Names: Phospho NAK (Ser172). Pack Sizes: 20ul. Product ID: F0255. Storage Conditions: -20°C (avoid freeze-thaw cycles), 2 years. | United States; Europe |
| Phosphotungstic acid | Phosphotungstic acid. Group: Biochemicals. Alternative Names: Tungstophosphoric acid. Grades: Highly Purified. CAS No. 1343-93-7. Pack Sizes: 25g, 50g, 100g, 250g, 500g. Molecular Formula: H3O40PW12·xH2O. US Biological Life Sciences. |  Worldwide |
| Phosphotungstic acid | Phosphotungstic acid. Alternative Names: Phosphotungstic acid; Phosphotungstic acid, 44-hydrate; Tungstophosphoric acid. Grades: 95%. CAS No. 12067-99-1. Molecular formula: H3O40PW12.xH2O. Mole weight: 2880.05 (anhydrous basis). |  |
| Phosphotungstic Acid | Phosphotungstic Acid. CAS No. 12501-23-4. Molecular formula: H3[P(W3O10)4]; xH2O. Mole weight: 2880.05 g/mol. Purity: 99%. |  |
| Phosphotungstic Acid | Phosphotungstic Acid. Uses: For analytical and research use. Alternative Names: Tungstophosphoric acid; 12-Phosphotungstic acid. CAS No. 12501-23-4. Molecular formula: H5O41PW12. Mole weight: 2880.2. IUPAC Name: phosphoric acid;trioxotungsten;hydrate. Catalog: APB12501234-1. |  |
| Phosphotungstic Acid | PHOSPHOTUNGSTIC ACID, SODIUM SALT, HYDRATE, Reagent, crystal, (Synonym: Tungstophosphoric Acid, Sodium Salt, Hydrate), Formula: Na3PO4.12WO3.xH2O. CAS No. 51312-42-6. Noah Chemicals San Antonio, Texas. ISO 9001:2015 Certified. Request a Quote Today! |  Texas TX |
| Phosphotungstic Acid | Phosphotungstic Acid. CAS No. 12501-23-4. Molecular Formula H3PO4 * 12WO3 * x H2O. Chemical Reagents |  Cater Chemicals Corp. Illinois IL |
| Phosphotungstic Acid | PHOSPHOTUNGSTIC ACID, HYDRATE, Reagent, crystal, (Synonym: Tungstophosphoric Acid, Hydrate), Formula: H3PO4.12WO3.xH2O. CAS No. 12067-99-1. Noah Chemicals San Antonio, Texas. ISO 9001:2015 Certified. Request a Quote Today! | Texas TX |
| Phosphotungstic Acid | Phosphotungstic Acid. Grade: Reagent. CAS: 12067-99-1. Packing: Plastic Drums. |  New Jersey NJ |
| Phosphotungstic acid, AR | Phosphotungstic acid, AR. CAS No. 12501-23-4. Molecular formula: H5O41PW12. Mole weight: 2898g/mol. IUPAC Name: phosphoric acid;trioxotungsten;hydrate. SMILES: O.OP(=O)(O)O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O. InChI: InChI=1S/H3O4P.H2O.36O.12W/c1-5(2,3)4;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;/h(H3,1,2,3,4);1H2;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;; | |
| Phosphotungstic acid hydrate | Phosphotungstic acid hydrate. Alternative Names: 12 TUNGSTO(VI) PHOSPHORIC ACID N-HYDRATE;12 TUNGSTO(+6)PHOSPHORIC ACID N-HYDRATE;12-TUNGSTOPHOSPHATE;12-TUNGSTOPHOSPHORIC ACID HYDRATE;DODECA-TUNGSTOPHOSPHORIC ACID HYDRATE;PHOSPHOTUNGSTIC ACID HYDRATE;PHOSPHOTUNGSTIC ACID N-HYDRATE;PHOSPHOTUNGSTIC ACID. CAS No. 12501-23-4 / 12067-99-1. Molecular formula: H6O8PW. Mole weight: 348.86. | |
| Phosphotungstic acid hydrate | Phosphotungstic acid hydrate. Alternative Names: 12-Tungstophosphoric acid hydrate. CAS No. 12501-23-4. Molecular formula: H5O41PW12. Mole weight: 2898.1. Purity: 99%+. IUPAC Name: Phosphoric acid;trioxotungsten;hydrate. SMILES: O.OP(=O)(O)O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O.O=[W](=O)=O. InChI: InChI=1S/H3O4P.H2O.36O.12W/c1-5(2,3)4;/h(H3,1,2,3,4);1H2. | |
| Phosphotungstic acid hydrate | Phosphotungstic acid hydrate. Group: Biochemicals. Grades: Reagent Grade. CAS No. 12501-23-4. Pack Sizes: 100g, 250g, 25g, 1Kg, 5Kg. US Biological Life Sciences. | Worldwide |
| Phosphotungstic acid hydrate | Phosphotungstic acid hydrate. Alternative Names: 12 TUNGSTO(VI) PHOSPHORIC ACID N-HYDRATE;12 TUNGSTO(+6)PHOSPHORIC ACID N-HYDRATE;12-TUNGSTOPHOSPHATE;12-TUNGSTOPHOSPHORIC ACID HYDRATE;DODECA-TUNGSTOPHOSPHORIC ACID HYDRATE;PHOSPHOTUNGSTIC ACID HYDRATE;PHOSPHOTUNGSTIC ACID N-HYDRATE;PHOSPHOTUNGSTIC ACID. CAS No. 12067-99-1 / 12501-23-4. Product ID: ACM12067991. Molecular formula: H6O8PW. Mole weight: 348.86. Alfa Chemistry - ISO 9001:32057 Certified. |  |
| Phosphotungstic acid hydrate | Phosphotungstic acid hydrate. Alternative Names: 12 TUNGSTO(VI) PHOSPHORIC ACID N-HYDRATE; 12 TUNGSTO(+6)PHOSPHORIC ACID N-HYDRATE; 12-TUNGSTOPHOSPHATE; 12-TUNGSTOPHOSPHORIC ACID HYDRATE; DODECA-TUNGSTOPHOSPHORIC ACID HYDRATE; PHOSPHOTUNGSTIC ACID HYDRATE. Grades: Reagent. CAS No. 12501-23-4. Molecular formula: H3PO4.12(WO3).H2O. Mole weight: 2898.07. | |
| Phosphotungstic acid hydrate | 100g Pack Size. Group: Building Blocks, Inorganic Chemicals. Formula: H3O40PW12 · xH2O. CAS No. 12501-23-4. Prepack ID 46336733-100g. Molecular Weight 2880.05. See USA prepack pricing. |  |
| Phospho-YAP (Ser127) Antibody [K8E8] | Phospho-YAP (Ser127),YAP1 (phospho S127). Group: Antibodies. Alternative Names: Hippo; P-YAP; Yes; Yes-associated. Pack Sizes: 20uL. Product ID: F0352. Storage Conditions: -20°C (avoid freeze-thaw cycles), 2 years. | United States; Europe |
| Phospho-Zap-70 (Tyr319)/Syk (Tyr352) Antibody [L15L21] | Tyrosine-protein kinase ZAP-70, 70 kDa zeta-chain associated protein, Syk-related tyrosine kinase, ZAP70, SRK, Tyrosine-protein kinase SYK, Spleen tyrosine kinase, p72-Syk, SYK. Group: Antibodies. Alternative Names: Phospho Zap-70 (Tyr319), Phospho Syk (Tyr 352). Pack Sizes: 20uL. Product ID: F0556. Storage Conditions: -20°C (avoid freeze-thaw cycles), 2 years. | United States; Europe |
| PhosTAC5 | PhosTAC5 is a phosphorylation targeting chimera (PhosTAC) molecule composed of a linker with fivePEG groups. PhosTAC5 induces dephosphorylation of PDCD4 and FOXO3a[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 3064090-15-6. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-148509. |  |
| PhosTAC7 | PhosTAC7 is a heterobifunctional molecule named as a Phosphorylation Targeting Chimera (PhosTAC). PhosTAC7 can dephosphorylate the PDCD4 protein, FOXO3a protein, and tau protein by recruiting serine/threonine protein phosphatase 2A (PP2A). PhosTAC7 offers the advantage of selectively modulating the phosphorylation state of individual target proteins, making it a promising tool for research in cancer and tau protein-related neurodegenerative diseases (Alzheimer's disease)[1][2]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: OGTAC-3. CAS No. 3016307-75-5. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-145232. | |
| Photinus-luciferin 4-monooxygenase (ATP-hydrolysing) | Photinus (firefly) is a bioluminescent insect. The first step in the reaction is the formation of an acid anhydride between the carboxylic group and AMP, with the release of diphosphate. The enzyme may be assayed by measurement of light emission. Group: Enzymes. Synonyms: firefly luciferase; luciferase (firefly luciferin); Photinus luciferin 4-monooxygenase (adenosine triphosphate-hydrolyzing); firefly luciferin luciferase; Photinus pyralis luciferase. Enzyme Commission Number: EC 1.13.12.7. CAS No. 61970-00-1. Luciferase. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0620; Photinus-luciferin 4-monooxygenase (ATP-hydrolysing); EC 1.13.12.7; 61970-00-1; firefly luciferase; luciferase (firefly luciferin); Photinus luciferin 4-monooxygenase (adenosine triphosphate-hydrolyzing); firefly luciferin luciferase; Photinus pyralis luciferase. Cat No: EXWM-0620. | |
| Photoclick myristic acid | Photoclick myristic acid is a derivative of Myristic acid (HY-N2041) with an alkyne group and a photo-activatable diazirine group. Photoclick myristic acid can be used as a probe in protein research[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2707485-30-9. Pack Sizes: 500 μg; 1 mg. Product ID: HY-W895359. | |
| Photoclick Sphingosine-1-Phosphate | Photoclick Sphingosine-1-Phosphate is an innovative instrument utilized for investigating intricate biological phenomena associated with Sphingosine-1-Phosphate (S1P), encompassing cell migration, proliferation, and apoptosis. By employing light-mediated activation, this advancement grants meticulous regulation of S1P concentrations, thereby fostering rigorous exploration into S1P-targeted pharmaceuticals for maladies including cancer and autoimmune disorders. Alternative Names: (2S,3R,E)-2-ammonio-3-hydroxy-13-(3-(pent-4-yn-1-yl)-3H-diazirin-3-yl)tridec-4-en-1-yl hydrogen phosphate. Grades: >99%. CAS No. 2342575-04-4. Molecular formula: C19H34N3O5P. Mole weight: 415.47. | |
| Photodegradation impurity 3 of dexamethasone sodium phosphate | Photodegradation impurity 3 of dexamethasone sodium phosphate. Uses: For analytical and research use. Molecular formula: C22H30FO8P. Mole weight: 472.45. Catalog: APB07559. | |
| Photofrin | Photofrin. Alternative Names: Photofrin; Porfimer sodium. Grades: 95%. CAS No. 87806-31-3. Molecular formula: C34H38N4O5?Na. Mole weight: 605.6872. | |
| Photoinduced CuInS2(CIS)/ZnS Quantum Dots | Photoinduced CuInS2(CIS)/ZnS Quantum Dots. Purity: Water. | |
| Photoinitiator 947-19-3 | Photoinitiator - Surface Coatings. SUPPLIERS TO BUSINESS CUSTOMERS ONLY. |  North America & APAC |
| Photo-stabilizer 944 | Photo-stabilizer 944. Grades: 95%. CAS No. 70624-18-9. Molecular formula: (C24H50N4?C8H19N?C3Cl3N. Mole weight: 708.345. | |
| photosystem I | Contains chlorophyll, phylloquinones, carotenoids and [4Fe-4S] clusters.Cytochrome c6 can act as an alternative electron donor, and flavodoxin as an alternative acceptor in some species. Group: Enzymes. Enzyme Commission Number: EC 1.97.1.12. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1691; photosystem I; EC 1.97.1.12. Cat No: EXWM-1691. | |
| photosystem II | Contains chlorophyll a, β-carotene, pheophytin, plastoquinone, a Mn4Ca cluster, heme and non-heme iron. Four successive photoreactions, resulting in a storage of four positive charges, are required to oxidize two water molecules to one oxygen molecule. Group: Enzymes. Enzyme Commission Number: EC 1.10.3.9. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0487; photosystem II; EC 1.10.3.9. Cat No: EXWM-0487. | |
| Phox-I2 | Phox-I2 is a selective inhibitor of p67phox-Rac1 interaction, binds to p67phox with high affinity with a Kd of ~150 nM. Phox-I2 is a NADPH oxidase 2 (NOX2) inhibitor and inhibits reactive oxygen species (ROS) production[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 353495-22-4. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg. Product ID: HY-119576. | |
| PHP 501 trifluoroacetate | PHP 501 trifluoroacetate. Group: Biochemicals. Grades: Purified. CAS No. 1236105-75-1. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| PHPS1 | PHPS1 is a potent and selective Shp2 inhibitor with Kis of 0.73, 5.8, 10.7, 5.8, and 0.47 μM for Shp2, Shp2-R362K, Shp1, PTP1B, and PTP1B-Q, respectively[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 314291-83-3. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-112368. | |
| pH Receptor Probe | pH Receptor Probe is a pH-sensitive cyanine derivative and a environmental sensitive fluorophore. pH Receptor Probe has a pH-sensitive maximal absorption at 644 nm and emission at 664 nm. pH Receptor Probe has been used as a pH sensor of lysosomal compartments[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 312961-83-4. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-D1563. | |
| Phrixotoxin 3 | Phrixotoxin 3, a peptide toxin produced by the Chilean copper tarantula (Paraphysa scrofa), is a potent blocker of voltage-gated sodium channels (IC50= 0.6, 42, and 72 nM for NaV1.2, NaV1.3 and NaV1.5 respectively). Alternative Names: 6-(phenylsulfinyl)-tetrazolo[1,5-b]pyridazine; DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI. Grades: >99%. CAS No. 880886-00-0. Molecular formula: C176H269N51O48S6. Mole weight: 4059.74. | |
| Phrixotoxin 3 | Phrixotoxin 3. Group: Biochemicals. Grades: Purified. CAS No. 880886-00-0. Pack Sizes: 100ug. US Biological Life Sciences. | Worldwide |
| PHT 427 | PHT 427. Group: Biochemicals. Grades: Purified. CAS No. 1191951-57-1. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| PHT-7.3 | PHT-7.3 is a selective inhibitor of connector enhancer of kinase suppressor of Ras 1 (Cnk1) pleckstrin homology (PH) domain (Kd=4.7 μM). PHT-7.3 inhibits mut-KRas, but not wild-type KRas cancer cell and tumor growth and signaling. PHT-7.3 has antitumor activity[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1614225-93-2. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-128590. | |
| PhTD1 | PhTD1 is an antimicrobial peptide found in Papio hamadryas (Hamadryas baboon), and has antibacterial and antifungal activity. Alternative Names: PhTD-1; BTD 1; Baboon theta defensin 1; Cyclo(L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-arginyl-L-arginylglycyl-L-valyl-L-cysteinyl-L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-L-threonyl-rginylglycyl-L-phenylalanyl-cysteinyl), cyclic(2→11),(4→9),(13→18)-tris(disulfide); θ-Defensin 1 (Papio anubis); θ-Defensin 1 (Papio hamadryas); θ-Defensin 1 (baboon). Grades: >98%. CAS No. 1085365-19-0. Molecular formula: C80H133N33O19S6. Mole weight: 2053.51. | |
| PhTD3 | PhTD3 is an antimicrobial peptide found in Papio hamadryas (Hamadryas baboon), and has antibacterial and antifungal activity. Alternative Names: PhTD-3; BTD 3; Baboon theta defensin 3; Cyclo(L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-threonyl-L-arginylglycyl-L-phenylalanyl-L-cysteinyl-L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-L-threonyl-rginylglycyl-L-phenylalanyl-cysteinyl), cyclic(2→11),(4→9),(13→18)-tris(disulfide); θ-Defensin 3 (Papio anubis); θ-Defensin 3 (Papio hamadryas); θ-Defensin 3 (baboon). Grades: >98%. CAS No. 1085365-23-6. Molecular formula: C82H128N30O20S6. Mole weight: 2046.47. | |
| Pht-Gly-β-Ala-OH | Pht-Gly-β-Ala-OH. Alternative Names: Phthaloyl-glycyl-β-alanine; 3-(2-(1,3-Dioxoisoindolin-2-yl)acetamido)propanoic acid; Pht Gly β Ala OH. Grades: ≥ 99%. CAS No. 17896-84-3. Molecular formula: C13H12N2O5. Mole weight: 276.25. | |
| Pht-Gly-beta-Ala-OH | Pht-Gly-beta-Ala-OH. Group: Biochemicals. Alternative Names: Phthaloyl-glycyl-b-alanine. Grades: Highly Purified. CAS No. 17896-84-3. Pack Sizes: 1g, 2g. US Biological Life Sciences. | Worldwide |
| Phthalaldehyde | Phthalaldehyde. Group: Biochemicals. Grades: Highly Purified. CAS No. 643-79-8. Pack Sizes: 50g, 100g, 250g, 500g, 1kg. US Biological Life Sciences. | Worldwide |
| Phthalaldehyde | Phthalaldehyde (Phthaldialdehyde) reacts with proteins containing primary amines and blocked amino-terminal peptides of amino acids. Phthalaldehyde stabilizes bacterial outer membranes and cell walls, increases the optical density of bacterial cell suspensions, and inhibits bacterial lysis induced by ethylenediaminetetraacetic acid and sodium dodecyl sulfate. Phthalaldehyde exhibits bactericidal activity against Gram-negative vegetative bacteria[1][2]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Phthaldialdehyde. CAS No. 643-79-8. Pack Sizes: 10 mM * 1 mL in DMSO; 25 g. Product ID: HY-W012669. | |
| Phthalaldehyde-d6 | Phthalaldehyde-d6 is the deuterium labeled Phthalaldehyde (HY-W012669). Phthalaldehyde is a biochemical assay reagent, which modifies the amino acid and measure the derivative through HPLC. Phthalaldehyde forms a fluorescent compound with α-amino group[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 68234-47-9. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-W738417. | |
| Phthalaldehydic Acid | Phthalaldehydic Acid. Group: Biochemicals. Alternative Names: Benzaldehyde-2-carboxylic Acid; 2-Carboxybenzaldehyde; 2-Formylbenzoic Acid. Grades: Highly Purified. CAS No. 119-67-5. Pack Sizes: 100g, 250g, 500g, 1Kg. US Biological Life Sciences. | Worldwide |
| Phthalamide | White powder, 97%. Synonym: 1,2-Benzenedicarboxamide. CAS No. 88-96-0. Pack Sizes: Typically in stock: 50g, 250g. Mole weight: 164.16. MP/BP: M.P. 223 dec. Order No: FR-0040. |  Frinton Laboratories |
| phthalate 4,5-cis-dihydrodiol dehydrogenase | Involved in the phthalate degradation pathway in bacteria. Group: Enzymes. Enzyme Commission Number: EC 1.3.1.64. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1332; phthalate 4,5-cis-dihydrodiol dehydrogenase; EC 1.3.1.64. Cat No: EXWM-1332. | |
| phthalate 4,5-dioxygenase | A system, containing a reductase which is an iron-sulfur flavoprotein (FMN), an iron-sulfur oxygenase, and no independent ferredoxin. Requires Fe2+. Group: Enzymes. Synonyms: PDO phthalate dioxygenase. Enzyme Commission Number: EC 1.14.12.7. CAS No. 63626-44-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0695; phthalate 4,5-dioxygenase; EC 1.14.12.7; 63626-44-8; PDO phthalate dioxygenase. Cat No: EXWM-0695. | |
| PHTHALAZIN-5-AMINE | PHTHALAZIN-5-AMINE. Alternative Names: 5-AMINO-PHTHALAZINE;PHTHALAZIN-5-AMINE;Quinoxalin-5-ylamine. CAS No. 102072-84-4. Purity: 96%. Product ID: ACM102072844. Molecular formula: C8H7N3. Mole weight: 145.16. IUPAC Name: phthalazin-5-amine. Alfa Chemistry - ISO 9001:32057 Certified. | |
| Phthalazine | 25g Pack Size. Group: Building Blocks, Organics, Research Organics & Inorganics. Formula: C8H6N2. CAS No. 253-52-1. Prepack ID 90030981-25g. Molecular Weight 130.15. See USA prepack pricing. | |
| Phthalazine | Phthalazine. Group: Biochemicals. Alternative Names: 2,3-Benzodiazine; 4,5-Benzopyridazine; [3,4-2]phthalazine. Grades: Highly Purified. CAS No. 253-52-1. Pack Sizes: 2g, 5g, 10g, 25g, 50g. Molecular Formula: C8H6N2. US Biological Life Sciences. | Worldwide |
| Phthalazine-2-oxide | Phthalazine-2-oxide. CAS No. 18636-89-0. Product ID: ACM18636890. Alfa Chemistry - ISO 9001:32057 Certified. | |
| Phthalazone - Suppliers needed. | PhthalazoneCategoryheterocyclic compound, pharmaceutical intermediate | Suppliers Needed |
| Phthaldialdehyde | Yellowish crystals, 97%. Synonym: Benzene-1,2-dicarboxakdehyde. CAS No. 643-79-8. Pack Sizes: Typically in stock: 10g, 50g. Mole weight: 134.13. MP/BP: M.P. 55-58. Order No: FR-2076. | Frinton Laboratories |
| Phthaldialdehyde | O-Phthaldialdehyde is a biochemical used in precolumn derivatization of amino acids for HPLC separation. Alternative Names: phthalaldehyde. CAS No. 643-79-8. Molecular formula: C8H6O2. Mole weight: 134.13. | |
| Phthalein purple | Phthalein purple. Group: Biochemicals. Alternative Names: o-Cresolphthalein complexone; Metalphthalein; Xyl enyl phthaleinbisi minodiacetic acid. Grades: Highly Purified. CAS No. 2411-89-4. Pack Sizes: 25g, 50g, 100g, 250g. US Biological Life Sciences. | Worldwide |
| Phthalein purple ACS | Phthalein purple ACS. Group: Biochemicals. Grades: ACS Grade. Pack Sizes: 25g, 100g, 250g. US Biological Life Sciences. | Worldwide |
| Phthalhydrazide | Phthalhydrazide. Group: Biochemicals. Grades: Highly Purified. CAS No. 1445-69-8. Pack Sizes: 100g, 250g, 500g, 1kg. US Biological Life Sciences. | Worldwide |
| Phthalic acid | 1kg Pack Size. Group: Building Blocks, Organics. Formula: C8H6O4. CAS No. 88-99-3. Prepack ID 38157787-1kg. Molecular Weight 166.13. See USA prepack pricing. | |
| Phthalic acid | Phthalic acid. Alternative Names: Benzene-1,2-dicarboxylic Acid. CAS No. 88-99-3. Purity: >99.0%. Product ID: FFC-AR-88993. Molecular formula: C8H6O4. Mole weight: 166.13. IUPAC Name: phthalic acid. Alfa Chemistry - ISO 9001:32057 Certified. | |
| Phthalic acid | Phthalic acid (CAS# 88-99-3) is a useful research chemical. Uses: Used as an analytical and laboratory reagent and to make medicines, dyes, phenolphthalein, phthalimide, anthranilic acid, and synthetic perfumes. Alternative Names: phthalic acid. Grades: 95 %. CAS No. 88-99-3. Molecular formula: C8H6O4. Mole weight: 166.13. | |
| Phthalic Acid | Organic reagent used to synthesize phthalates. Group: Biochemicals. Alternative Names: 1,2-Benzenedicarboxylic Acid; M 2; NSC 5348; Sunftal 20; o-Benzenedicarboxylic Acid; o-Carboxybenzoic Acid; o-Dicarboxybenzene. Grades: Highly Purified. CAS No. 88-99-3. Pack Sizes: 10g. US Biological Life Sciences. | Worldwide |
| Phthalic Acid | Phthalic Acid. CAS No. 88-99-3. Molecular Formula C6H4(COOH)2. Chemical Reagents | Cater Chemicals Corp. Illinois IL |
| Phthalic Acid | Phthalic acid is an aromatic dicarboxylic acid, with formula C6H4(CO2H)2. It is an isomer of isophthalic acid and terephthalic acid. Although phthalic acid is of modest commercial importance, the closely related derivative phthalic anhydride is a commodity chemical produced on a large scale. Alternative Names: 1,2-Benzenedicarboxylic acid. CAS No. 88-99-3. Molecular formula: C8H6O4. Mole weight: 166.13. Purity: 99%. IUPAC Name: Phthalic acid. SMILES: C1=CC=C(C(=C1)C(=O)O)C(=O)O. InChI: InChI=1S/C8H6O4/c9-7(10)5-3-1-2-4-6(5)8(11)12/h1-4H,(H,9,10)(H,11,12). | |
| Phthalic acid 100 μg/mL in MTBE | Phthalic acid 100 μg/mL in MTBE. Uses: For analytical and research use. CAS No. 88-99-3. Molecular formula: C8H6O4. Mole weight: 166.13. Purity: 98%. Catalog: APB88993-1. | |
| Phthalic Acid 1-(1,2-dimethylpropyl) Ester | Phthalic Acid 1-(1,2-dimethylpropyl) Ester, is used as an industrial plasticizer,that induces peroxisome proliferation. It is also shown to activate the nuclear receptors PPARs and induce differentiation of F9 cells. Group: Biochemicals. Grades: Highly Purified. CAS No. 198284-10-5. Pack Sizes: 250mg, 2.5g. Molecular Formula: C13H16O4, Molecular Weight: 236.26. US Biological Life Sciences. | Worldwide |
Our database is helping our users find suppliers everyday.
