American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
Apatamide impurity 19 Apatamide impurity 19. Uses: For analytical and research use. Group: Impurity standards. Molecular Formula: C16H8F6N6O. Mole Weight: 414.27. Catalog: APB11877. Alfa Chemistry Analytical Products 3
Apatamide impurity 2 Apatamide impurity 2. Uses: For analytical and research use. Group: Impurity standards. Molecular Formula: C27H18F4N6O3S2. Mole Weight: 614.59. Catalog: APB11870. Alfa Chemistry Analytical Products 3
Apatamide Impurity 21 Apatamide Impurity 21. Uses: For analytical and research use. Group: Impurity standards. CAS No. 2894796-76-8. Molecular Formula: C29H21F5N6O3S. Mole Weight: 628.57. Catalog: APB2894796768. Alfa Chemistry Analytical Products 2
Apatamide impurity 36 Apatamide impurity 36. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: 2-fluoro-4-hydroxy-N-methylbenzamide. CAS No. 1243392-80-4. Molecular Formula: C8H8FNO2. Mole Weight: 169.15. Catalog: APB1243392804. Alfa Chemistry Analytical Products
Apatamide impurity 6 Apatamide impurity 6. Uses: For analytical and research use. Group: Impurity standards. CAS No. 2894796-77-9. Molecular Formula: C40H27F8N9O4S. Mole Weight: 881.76. Catalog: APB2894796779. Alfa Chemistry Analytical Products 2
Apatamide impurity 7 Apatamide impurity 7. Uses: For analytical and research use. Group: Impurity standards. Molecular Formula: C8H5F3N4S. Mole Weight: 246.21. Catalog: APB11878. Alfa Chemistry Analytical Products 3
Apatamide impurity 8 Apatamide impurity 8. Uses: For analytical and research use. Group: Impurity standards. CAS No. 1415552-04-3. Molecular Formula: C9H6F3N3S. Mole Weight: 245.22. Catalog: APB1415552043. Alfa Chemistry Analytical Products
Apatamide impurity 9 Apatamide impurity 9. Uses: For analytical and research use. Group: Impurity standards. CAS No. 1513077-71-8. Molecular Formula: C10H16N2O3. Mole Weight: 212.25. Catalog: APB1513077718. Alfa Chemistry Analytical Products
Apatinib-d8 free base Apatinib-d 8 (free base) is the deuterium labeled Apatinib free base[1]. Apatinib free base (YN968D1 free base) is an orally bioavailable tyrosine kinase inhibitor, which selectively targets VEGFR-2 (IC50=1 nM). Apatinib free base (YN968D1 free base) is an anti-angiogenic drug for the research of advanced or metastatic gastric cancer. Apatinib free base (YN968D1 free base) potently inhibits Ret, c-Kit and c-Src with IC50s of 13, 429 and 530 nM, respectively. It also inhibits cellular phosphorylation of VEGFR-2, c-kit and PDGFRβ[2][3][4]. Uses: Scientific research. Group: Isotope-labeled compounds. Alternative Names: YN968D1-d8 free base. CAS No. 2468771-43-7. Pack Sizes: 1 mg. Product ID: HY-13342AS. MedChemExpress MCE
Apatinib-d8 hydrochloride Apatinib-d 8 (hydrochloride) is the deuterium labeled Apatinib hydrochloride[1]. Uses: Scientific research. Group: Isotope-labeled compounds. CAS No. 2468771-44-8. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-13342S. MedChemExpress MCE
Apatinib impurity 1 Apatinib impurity 1. Uses: For analytical and research use. Group: Impurity standards. Molecular Formula: C24H22N6O2. Mole Weight: 426.48. Catalog: APB12230. Alfa Chemistry Analytical Products 3
Apatinib mesylate Apatinib mesylate is an orally bioavailable, small-molecule receptor tyrosine kinase inhibitor with potential antiangiogenic and antineoplastic activities. Apatinib selectively binds to and inhibits vascular endothelial growth factor receptor 2, which may inhibit VEGF-stimulated endothelial cell migration and proliferation and decrease tumor microvessel density. In addition, this agent mildly inhibits c-Kit and c-SRC tyrosine kinases. Uses: Antineoplastic agents. Synonyms: YN968D1. Grades: >98%. CAS No. 1218779-75-9. Molecular formula: C25H27N5O4S. Mole weight: 493.58. BOC Sciences
Apaziquone Apaziquone. Group: Biochemicals. Alternative Names: 5-(1-Aziridinyl)-3-(hydroxymethyl)-2-[(1E)-3-hydroxy-1-propen-1-yl]-1-methyl-1H-indole-4,7-dione; Apaziquone; EO 9; EO 9 (pharmaceutical); NSC 382456; NSC 382459; (E)-5-(1-Aziridinyl)-3-(hydroxymethyl)-2-(3-hydroxy-1-propenyl)-1-methyl-1H-Indole-4,7-dione. Grades: Highly Purified. CAS No. 114560-48-4. Pack Sizes: 2.5mg. Molecular Formula: C15H16N2O4, Molecular Weight: 288.3. US Biological Life Sciences. USBiological 3
Worldwide
APC-100 APC-100 is an orally available, vitamin E derivative and androgen receptor (AR) antagonist with potential anti-oxidant, chemopreventative and antineoplastic activity. APC-100 binds to ARs in target tissues thereby inhibiting androgen-induced receptor activation and facilitating the formation of inactive complexes that cannot be translocated to the nucleus. APC-100 may ultimately lead to an inhibition of growth in both AR-dependent and AR-independent prostate tumor cells. Uses: Antioxidants. Synonyms: 2,2,5,7,8-Pentamethyl-6-chromanol; Chromanol; 6-Hydroxy-2,2,5,7,8-pentamethylchroman; APC100; 3,4-Dihydro-2,2,5,7,8-pentamethyl-2H-1-Benzopyran-6-ol. Grades: 98%. CAS No. 950-99-2. Molecular formula: C14H20O2. Mole weight: 220.312. BOC Sciences 2
APC 366 APC 366, an inhibitor of tryptase, has been found to reduce airway inflammation and block postchallenge airway hyperresponsiveness in vivo. Synonyms: N-(1-Hydroxy-2-naphthoyl)-L-arginyl-L-prolinamide. Grades: >98%. CAS No. 158921-85-8. Molecular formula: C22H28N6O4. Mole weight: 440.5. BOC Sciences
APC 366 APC 366 is a selective inhibitor of mast cell tryptase ( K i =7.1 μM). APC 366 inhibits antigen-induced early asthmatic response (EAR), late asthmatic response (LAR), and bronchial hyperresponsiveness (BHR) in a sheep model of allergic asthma [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 158921-85-8. Pack Sizes: 5 mg. Product ID: HY-105999. MedChemExpress MCE
APC 366 APC 366. Group: Biochemicals. Grades: Purified. CAS No. 158921-85-8. Pack Sizes: 5mg. US Biological Life Sciences. USBiological 5
Worldwide
APC-366 hydrochloride APC-366, an amino acid derivative, has been found to be a mast cell tryptase inhibitor and was once studied against asthma by Celera Genomics Group. Ki: 7.1 μM. Synonyms: APC 366; APC 366; APC 366; AC1L42OR; N-(1-Hydroxy-2-naphthoyl)-L-arginine-L-prolinamide; 158921-85-8. Grades: 98%. CAS No. 178925-65-0. Molecular formula: C22H29ClN6O4. Mole weight: 477. BOC Sciences
APC 366 trifluoroacetate salt APC 366 is a mast cell tryptase inhibitor with Ki of 7.1 μM for human recombinant enzyme. It is a selective inhibitor of mast cell tryptase, which has been shown to inhibit antigen-induced early asthmatic response (EAR), late asthmatic response (LAR), and bronchial hyperresponsiveness (BHR) in a sheep model of allergic asthma. APC 366 can reduce maximum contractile response to histamine in isolated bronchial tissue from ovalbumin-sensitized guinea pigs. It can also reduce airway resistance and increases dynamic lung compliance in A. suum antigen-challenged pigs. Grades: ≥95%. Molecular formula: C22H28N6O4·xCF3COOH. Mole weight: 440.50. BOC Sciences
AP C5 AP C5 is a potent and selective protein kinase G type II (PKG2) inhibitor with pIC50 of 7.2, which displays >20-fold selectivity for PKG2 over PKG1 and PKA. Synonyms: 4-[4-(1H-Imidazol-1-yl)phenyl]-N-2-propyn-1-yl-2-pyrimidinamine; AP-C5; APC5. Grades: ≥98%. CAS No. 2234272-10-5. Molecular formula: C16H13N5. Mole weight: 275.31. BOC Sciences
APC-6336 APC-6336 is a Hepatitis C virus NS3 protein inhibitor. Synonyms: (2R)-2-[[2-[(6-carbamoyl-1H-benzimidazol-2-yl)methyl]-3-methylbenzimidazole-5-carbonyl]amino]-3-phosphonopropanoic acid; APC-6336; APC 6336; APC6336; UNII-4124YUO44Z; CRA-6336; 4124YUO44Z. Grades: >98%. CAS No. 263870-19-5. Molecular formula: C21H21N6O7P. Mole weight: 500.4. BOC Sciences 2
a-(p-Chlorophenyl)cinnamonitrile White crystals. CAS No. 3695-93-0. Pack Sizes: 10g, 50g. Product ID: FR-0877. M.P. 114-116. Mole weight: 239.7. Frinton Laboratories Inc
Frinton Laboratories
Apcin Apcin is an inhibitor of the E3 ligase activity of the mitotic anaphase-promoting complex/cyclosome (APC/C), which is a large multimeric complex. It functions as a ubiquitin ligase, initiating the metaphase-anaphase transition and regulating ordered transitions through the cell cycle by controlling the ubiquitin-mediated proteolysis of cell cycle proteins. It competitively binds to the D-box binding site of Cdc20 and prevents substrate recognition and ubiquitylation required for continuation of mitosis. It synergistically increases apoptosis in multiple myeloma cells in combination with proTAME (prodrug of TAME). It also prolongs mitotic duration in RPE1 cells in combination with proTAME in vitro. It blocks mitotic exit and being synergistically amplified by co-addition of Ts-Arg-OMe. Synonyms: 3-(2-Methyl-5-nitro-imidazol-1-yl)-N-(2,2,2-trichloro-1-phenylamino-ethyl)-propionamide; 2-(2-Methyl-5-nitroimidazol-1-yl)ethyl N-[2,2,2-trichloro-1-(pyrimidin-2-ylamino)ethyl]carbamate; [2,2,2-trichloro-1-(2-pyrimidinylamino)ethyl]-carbamic acid, 2-(2-methyl-5-nitro-1H-imidazol-1-yl)ethyl ester. Grades: ≥98% by HPLC. CAS No. 300815-04-7. Molecular formula: C13H14Cl3N7O4. Mole weight: 438.65. BOC Sciences 2
Apcin-A Apcin-A is an anaphase-promoting complex (APC) inhibitor. Apcin-A interacts strongly with Cdc20, and inhibits the ubiquitination of Cdc20 substrates. Synonyms: Apcin-A; 1683617-62-0; 3-Aminopropyl (2,2,2-trichloro-1-(pyrimidin-2-ylamino)ethyl)carbamate; starbld0000888; SCHEMBL22567019; EX-A5236; AKOS030257613; MS-25252; HY-130841; CS-0114386. CAS No. 1683617-62-0. Molecular formula: C10H14Cl3N5O2. Mole weight: 342.61. BOC Sciences 2
APcK110 KIT inhibitor; inhibits phosphorylation of KIT, STAT3, STAT5 and Akt. Suppresses proliferation of OCI/AML3 cells (IC50 = 175 nM). Caspase-dependant apoptosis inducer. Synonyms: APcK 110; APcK-110; 6-(3,5-Dimethoxyphenyl)-3-(4-fluorophenyl)-1H-pyrazolo[3,4-b]pyridine. Grades: >98%. CAS No. 1001083-74-4. Molecular formula: C34H49N5O6. Mole weight: 349.36. BOC Sciences 2
APcK 110 APcK 110. Group: Biochemicals. Grades: Purified. CAS No. 1001083-74-4. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
APCP-363 APCP-363 a bio-active chemical. Uses: Apcp-363 a bio-active chemical. Synonyms: CP-363; CP 363; CP363; APCP-363; APO-363; APCP 363; APO 363; APCP363; APO363; UNII-N1969I6FAP. 3-hydroxy-2-(1-methoxyethyl)-1,6-dimethylpyridin-4-one. Grades: ≥98%. CAS No. 340023-40-7. Molecular formula: C10H15NO3. Mole weight: 197.23. BOC Sciences
ApCpp ApCpp is a highly intriguing and intricate biochemical compound with multifaceted role as a substrate for diverse enzymes. It has promising applications in research of ailments such as cancer, neurodegenerative disorders and metabolic syndromes of varied etiologies. Synonyms: (AMPCPP); Adenosine-5'-[(α,β)-methyleno]triphosphate, Sodium salt; α,β-Methyleneadenosine-5'-triphosphate. Grades: ≥ 98% by HPLC. CAS No. 7292-42-4. Molecular formula: C11H18N5O12P3 (free acid). Mole weight: 505.21 (free acid). BOC Sciences
ApCpp (Nic) ApCpp (Nic) is a cutting-edge biomedical compound fostering a pivotal role in bolstering cellular energy compoundion. apCpp (Nic) is acutely augments mitochondrial function. Synonyms: P1-(5'-Adenosyl) P3-[5'-(1-β D-ribofuranosyl-nicotinamide)] [(α,β)-methyleno]triphosphate, Sodium salt. Grades: ≥ 95% by HPLC. Molecular formula: C22H30N7O16P3 (free acid). Mole weight: 741.43 (free acid). BOC Sciences
APD334 This active moleclar is a Sphingosine 1 Phosphate Receptor antagonists for treatment of multiple sclerosis (MS) and other autoimmune diseases originated by Arena Pharmaceuticals. APD334 was efficacious in a mouse EAE (experimental autoimmune encephalomyelitis ) model of MS and a rat CIA (collagen induced arthritis) model. It was found to have appreciable central exposure. In Sep 2015, Arena Pharmaceuticals planed a phase II extension trial for Ulcerative colitis in USA was on-going. In Mar 2016, Arena Pharmaceuticals had patent protection for APD 334 in USA, Japan, China, Australia and Russia. Uses: Multiple sclerosis (ms) and other autoimmune diseases. Synonyms: APD334; APD 334; APD-334; Etrasimod; UNII-6WH8495MMH; 6WH8495MMH; CHEMBL3358920;2-[(3R)-7-[[4-cyclopentyl-3-(trifluoromethyl)phenyl]methoxy]-1,2,3,4-tetrahydrocyclopenta[b]indol-3-yl]acetic acid. Grades: 98%. CAS No. 1206123-37-6. Molecular formula: C26H26F3NO3. Mole weight: 457.49. BOC Sciences
APD597 (JNJ-38431055) APD597, also known as JNJ-38431055, is a potent and selective GPR119 agonist, which is potential useful for the treatment of type 2 diabetes. GPR119 agonists mediate a unique nutrient-dependent dual elevation of both insulin and glucagon like peptide 1/glucose-dependent insulinotropic peptide levels in vivo. Synonyms: APD597; APD-597; APD 597; JNJ-38431055; JNJ 38431055; JNJ38431055. Grades: 98%. CAS No. 897732-93-3. Molecular formula: C21H29N5O6S. Mole weight: 479.55. BOC Sciences 2
APD668 APD668 is a potent GPR119 agonist with EC50 of 2.7 nM and 33 nM for hGPR119 and ratGPR119 respectively. Synonyms: APD668; APD-668; APD 668; JNJ28630368; JNJ-28630368; JNJ 28630368. Grades: 0.99. CAS No. 832714-46-2. Molecular formula: C21H24FN5O5S. Mole weight: 477.511. BOC Sciences 2
AP-dC-CE Phosphoramidite AP-dC-CE Phosphoramidite is an invaluable reagent utilized within the fascinating realm of medicinal chemistry for synthesizing oligonucleotide prodrugs with great precision. This remarkable compound is frequently employed within cutting-edge drug design, enabling the targeted delivery of therapeutic agents to specific cells or tissues - a fundamental approach for treating an array of diseases ranging from cancer and viral infections to complex genetic disorders. Synonyms: 1-[5'-O-(4,4'-Dimethoxytrityl)-β-D-2'-deoxyribofuranosyl]-9-(2-trifluoroacetamidoethoxy)-1,3-diaza-2-oxophenoxazine, 3'-[(2-cyanoethyl)-(N,N-diisopropyl)]phosphoramidite. Molecular formula: C49H54F3N6O10P. Mole weight: 974.97. BOC Sciences
APDC-DTPA APDC-DTPA. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 3,4-Bis(4-(diphenylamino)phenyl) acenaphtho[1,2-b]pyrazine-8,9-dicarbonitrile. Product Category: Organic Light Emitting Diode (OLED). CAS No. 2102527-13-7. Molecular formula: C52H32N6. Mole weight: 740.85 g/mol. Product ID: ACM2102527137. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 2
APD-I APD-I is an ester peptide antibiotic produced by Bacillus subtilis C-756. It can inhibit the activity of cyclic-AMP phosphodiesterase. CAS No. 87098-49-5. Molecular formula: C51H89N7O13. Mole weight: 1008.29. BOC Sciences
APD-II APD-II is an ester peptide antibiotic produced by Bacillus subtilis C-756. It can inhibit the activity of cyclic-AMP phosphodiesterase. CAS No. 87099-78-3. Molecular formula: C52H91N7O13. Mole weight: 1022.32. BOC Sciences
APD-III APD-III is an ester peptide antibiotic produced by Bacillus subtilis C-756. It can inhibit the activity of cyclic-AMP phosphodiesterase. CAS No. 87098-48-4. Molecular formula: C53H93N7O13. Mole weight: 1036.34. BOC Sciences
APE1 Inhibitor III APE1 Inhibitor III is a selective and competitive inhibitor of apurinic/apyrimidinic (AP) endonuclease 1 (APE1) with 2.0 micromolar activity against the purified APE1 enzyme. Synonyms: N-[3-(1,3-Benzothiazol-2-yl)-6-isopropyl-4,5,6,7-tetrahydrothieno[2,3-c]pyridin-2-yl]acetamide. Grades: 99%. CAS No. 524708-03-0. Molecular formula: C19H21N3OS2. Mole weight: 371.52. BOC Sciences
APE1 Inhibitor III (Apurinic Endonuclease 1 Inhibitor III) (Apurinic/Apyrimidinic Endonuclease 1 Inhibitor III)(N-(3-(1,3-Benzo[d]thiazol-2-yl)-6-isopropyl-4,5,6,7-tetrahydrothieno[2,3-c]pyridin-2-yl)acetamide) A cell-permeable benzothiazolyltetra hydrothienopyridine compound that acts as a potent, competitive, and active site targeting inhibitor of APE1 (IC50=2.0uM in a fluorescence based HTS assay; and 12uM in a radiotracer incision assay). Shown to block APE1 activity in HEK293T and HeLa cells extract (IC50=600nM) and increase genomic AP site accumulation. Potentiates the cytotoxicity of DNA-damaging alkylating agents in HeLa cells by ~3-fold. Exhibits favorable pharmacokinetic properties and desirable ADME attributes. Due to its lipophilic nature, it crosses the blood-brain barrier rather easily and shows desirable stability (t1/2=80min). Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 4
Worldwide
Apelin-12 Apelin-12 is one of the most potent C-terminal fragments of the polypeptide that possesses a high affinity to orphan receptor APJ receptor. Apelin-12 is involved in the regulation of body fluid homeostasis and in the central control of feeding. Apelin-12 blocks HIV-1 entry through APJ receptor. Apelin-12 exerts neuroprotective effect [1] [2] [3]. Uses: Scientific research. Group: Peptides. CAS No. 229961-08-4. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P2537. MedChemExpress MCE
Apelin-12 acetate Apelin-12 induces calcium mobilization in APJ-Gαq16 cells expressing human APJ and inhibits HIV-1 and HIV-2 infection in NP-2/CD4/APJ cells. Apelin-12 inhibits the JNK and p38 MAPK signaling pathway of the apoptosis-related MAPKs family, thus offering protection to neurons. Synonyms: Preproapelin (66-77) (human, bovine, mouse, rat) acetate; (Des-Gln1)-Apelin-13 (human, bovine, mouse, rat) acetate; Apelin Precursor (66-77) (human, bovine, mouse, rat) acetate. Molecular formula: C66H107N21O16S. Mole weight: 1482.77. BOC Sciences 2
Apelin-13 Apelin-13, an endogenous neuropeptide, is the ligand for the G-protein-coupled receptor APJ, an alternative coreceptor with CD4 for HIV-1 infection. Apelin-13 is generated from apelin-36, which is a putative receptor protein related to the angiotensin receptor (AT1). Apelin-13 exerted an acidification-rate-promoting activity in the CHO cells expressing the APJ receptor with EC50 value of 0.37 nM. Apelin-13 is a 13 amino acid polypeptide encoded by the apelin gene which yields a pre-proprotein that is processed to generate bioactive peptides. Apelin-13 is also involved in the learning and memory process. Synonyms: Apelin-13 (human, bovine, mouse, rat); H-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH; L-glutaminyl-L-arginyl-L-prolyl-L-arginyl-L-leucyl-L-seryl-L-histidyl-L-lysyl-glycyl-L-prolyl-L-methionyl-L-prolyl-L-phenylalanine. Grades: ≥95%. CAS No. 217082-58-1. Molecular formula: C69H111N23O16S. Mole weight: 1550.85. BOC Sciences
Apelin-13 trifluoroacetate salt Apelin-13 trifluoroacetate salt is the endogenous ligand of the APJ receptor, activating this G protein-coupled receptor with an EC50 value of 0.37 nM. Synonyms: Apelin-13 triTFA. Molecular formula: C75H114F9N23O22S. Mole weight: 1892.89. BOC Sciences 2
Apelin-17 (human, bovine) Apelin-17 (human, bovine). Group: Biochemicals. Grades: Purified. CAS No. 217082-57-0. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 5
Worldwide
Apelin-17 (Human, Bovine) Apelin-17 (human, bovine) is an endogenous ligand of the G protein-coupled APJ receptor with EC50 value of 2.5 nM that is secreted by adipocytes. It potently inhibits forskolin-stimulated cAMP production in vitro. Synonyms: [Phe17]-Apelin 17. Grades: 98.86%. CAS No. 217082-57-0. Molecular formula: C96H156N34O20S. Mole weight: 2138.56. BOC Sciences
Apelin-17 (human, bovine) acetate Apelin-17 (human, bovine) acetate, secreted by adipocytes, is an endogenous ligand of the G protein-coupled APJ receptor with an EC50 of 2.5 nM. It is an endogenous apelin receptor agonist that potently inhibits forskolin-stimulated cAMP production in vitro. Synonyms: H-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH.CH3CO2H; L-lysyl-L-phenylalanyl-L-arginyl-L-arginyl-L-glutaminyl-L-arginyl-L-prolyl-L-arginyl-L-leucyl-L-seryl-L-histidyl-L-lysyl-glycyl-L-prolyl-L-methionyl-L-prolyl-L-phenylalanine acetic acid. Grades: ≥95%. Molecular formula: C98H160N34O22S. Mole weight: 2198.63. BOC Sciences 2
Apelin-36 (human) Endogenous APJ receptor agonist (EC50 = 20 nM) that is secreted by adipocytes. Binds with high affinity to human APJ receptors expressed in HEK 293 cells (pIC50= 8.61). Involved in regulation of cardiovascular function, fluid homeostasis and feeding. Blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ. Group: Biochemicals. Grades: Highly Purified. CAS No. 252642-12-9. Pack Sizes: 1mg. Molecular Formula: C184H297N69O43S, Mass Spectrum: Consistent with structure. US Biological Life Sciences. USBiological 5
Worldwide
Apelin-36 (human) Apelin-36 (human) is an endogenous ligand of the G protein-coupled APJ receptor with EC50 value of 20 nM that is secreted by adipocytes. It is the full-length mature peptide produced from the translated 77 amino acid prepropeptide. It acts primarily in the central nervous and peripheral system. It is important in regulating fluid homeostasis, cardiovascular function, insulin and hypertension sensitivity. It potently blocks HIV-1 and HIV-2 strains entry into cells expressing APJ and CD4 and limits HIV infection. It endogenously binds with high affinity to human APJ receptors expressed in HEK 293 cells. Synonyms: H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH; L-leucyl-L-valyl-L-glutaminyl-L-prolyl-L-arginyl-glycyl-L-seryl-L-arginyl-L-asparagyl-glycyl-L-prolyl-glycyl-L-prolyl-L-tryptophyl-L-glutaminyl-glycyl-glycyl-L-arginyl-L-arginyl-L-lysyl-L-phenylalanyl-L-arginyl-L-arginyl-L-glutaminyl-L-arginyl-L-prolyl-L-arginyl-L-leucyl-L-seryl-L-histidyl-L-lysyl-glycyl-L-prolyl-L-methionyl-L-prolyl-L-phenylalanine. Grades: ≥95% by HPLC. CAS No. 252642-12-9. Molecular formula: C184H297N69O43S. Mole weight: 4195.87. BOC Sciences
Apelin-36(human) Apelin-36(human) is an endogenous orphan G protein-coupled receptor APJ agonist, with an EC50 of 20 nM. Apelin-36(human) shows high affinity to human APJ receptors expressed in HEK 293 cells (pIC50=8.61). Apelin-36 has been linked to two major types of biological activities: cardiovascular and metabolic. Apelin-36(human) inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ. Uses: Designed for use in research and industrial production. Additional or Alternative Names: LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF;H-LEU-VAL-GLN-PRO-ARG-GLY-SER-ARG-ASN-GLY-PRO-GLY-PRO-TRP-GLN-GLY-GLY-ARG-ARG-LYS-PHE-ARG-ARG-GLN-ARG-PRO-ARG-LEU-SER-HIS-LYS-GLY-PRO-MET-PRO-PHE-OH;LEU-VAL-GLN-PRO-ARG-GLY-SER-ARG-ASN-GLY-PRO-GLY-PRO-TRP-GLN-GLY-GLY-. Product Category: Inhibitors. CAS No. 252642-12-9. Molecular formula: C184H297N69O43S. Purity: 0.9811. Product ID: ACM252642129. Alfa Chemistry — ISO 9001:2015 Certified. Categories: Apelin-36 (human). Alfa Chemistry.
Apelin-36(human) Apelin-36(human) is an endogenous orphan G protein-coupled receptor APJ agonist, with an EC 50 of 20 nM. Apelin-36(human) shows high affinity to human APJ receptors expressed in HEK 293 cells (pIC 50 =8.61). Apelin-36 has been linked to two major types of biological activities: cardiovascular and metabolic. Apelin-36(human) inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ [1] [2] [3] [4]. Uses: Scientific research. Group: Peptides. CAS No. 252642-12-9. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P1064. MedChemExpress MCE
Apelin-36 (rat, mouse) Apelin-36 (rat, mouse). Group: Biochemicals. Grades: Purified. CAS No. 230299-95-3. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 5
Worldwide
Apelin-36 (rat, mouse) Apelin-36 (rat, mouse) is an endogenous ligand of the G protein-coupled APJ receptor with EC50 value of 5.4 nM that is secreted by adipocytes. It potently inhibits cAMP production in vitro. It is important in regulating fluid homeostasis, cardiovascular function and feeding. It potently blocks HIV-1 and HIV-2 strains entry into cells expressing APJ and CD4 and limits HIV infection. Synonyms: Apelin-36 (rat, mouse); Apelin 36 (rat, mouse); Apelin36 (rat, mouse). Grades: 95%. CAS No. 230299-95-3. Molecular formula: C185H304N68O43S. Mole weight: 4200.93. BOC Sciences
a-Pentylcinnamaldehyde diethyl acetal a-Pentylcinnamaldehyde diethyl acetal. Group: Biochemicals. Grades: Highly Purified. CAS No. 60763-41-9. Pack Sizes: 100mg, 250mg, 500mg. Molecular Formula: C18H28O2. US Biological Life Sciences. USBiological 6
Worldwide
APETx2 APETx2. Group: Biochemicals. Grades: Purified. CAS No. 713544-47-9. Pack Sizes: 100ug. US Biological Life Sciences. USBiological 5
Worldwide
APETx2 APETx2, an ion channel 3 (ASIC3) channel blocker, has been found to exhibit analgesic properties against acid-induced and inflammatory pain. Synonyms: APETx2; 713544-47-9; AKOS024458355; H-Gly-DL-xiThr-DL-Ala-DL-Cys(1)-DL-Ser-DL-Cys(2)-Gly-DL-Asn-DL-Ser-DL-Lys-Gly-DL-xiIle-DL-Tyr-DL-Trp-DL-Phe-DL-Tyr-DL-Arg-DL-Pro-DL-Ser-DL-Cys(3)-DL-Pro-DL-xiThr-DL-Asp-DL-Arg-Gly-DL-Tyr-DL-xiThr-Gly-DL-Ser-DL-Cys(2)-DL-Arg-DL-Tyr-DL-Phe-DL-Leu-Gly-DL-xiThr-DL-Cys(1)-DL-Cys(3)-DL-xiThr-DL-Pro-DL-Ala-DL-Asp-OH. Grades: >98%. CAS No. 713544-47-9. Molecular formula: C196H280N54O61S6. Mole weight: 4561.06. BOC Sciences
APF APF is a fluorescence probe that can selectively, and dose dependently detect certain species among ROS and that are highly resistant to autoxidation. APF can be used in enzymatic and cellular systems [1]. Uses: Scientific research. Group: Fluorescent dye. CAS No. 359010-70-1. Pack Sizes: 500 μg (11.81 mM * 100 μL in Methyl acetate). Product ID: HY-119977. MedChemExpress MCE
APF Sialoglycopeptide ammonium salt APF Sialoglycopeptide ammonium salt is a cutting-edge biomedical compound, demonstrating remarkable capabilities in research of dental caries. Proven to possess potent antimicrobial properties against the notorious Streptococcus mutans, this compound also exhibits an extraordinary affinity for hydroxyapatite, amplifying the process of tooth remineralization. Synonyms: O-(Acetamido-3,5-dideoxy-D-glycero-a-D-galacto-2-nonulopyranosylonic acid)-(2?3)-O-b-D- galactopyranosyl-(1?3)-O-a-2-acetamido-2-deoxy-D-galactopyranosyl-(1 ?O)- Thr-Val-Pro-Ala-Ala-Val-Val-Val-Ala NeuNAc-a(2?3)-Gal-b(1?3)-GalNAc-a-Thr-Val-Pro-Ala-Ala-Val-Val-Val-Ala. Molecular formula: C63H107N11O29. Mole weight: 1482.58. BOC Sciences
ApG ApG is a scientifically advanced compound, specifically designed to study inflammatory skin disorders as well as combat skin infections. It comprises a potent blend of bioactive drugs exhibiting exceptional antimicrobial and anti-inflammatory attributes. Grades: ≥ 95% by HPLC. Molecular formula: C20H25N10O11P (free acid). Mole weight: 612.14 (free acid). BOC Sciences
APG-2449 APG-2449 is an orally active ALK/ROS1/FAK inhibitor. APG-2449 shows antitumor activity in mouse models of non-small cell lung cancer (NSCLC) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2196186-84-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-155163. MedChemExpress MCE
APHA Compound 8 APHA Compound 8 is a synthetic HDAC (histone deacetylase) inhibitor, which is in the same structural class as SAHA. The IC50 for mouse HDAC1 is 0.5 μM. It induces histone hyperacetylation, growth inhibition, and terminal cell differentiation. Synonyms: MC-1353; MC1353; MC 1353; APHA-8; APHA Compound 8; Aroyl pyrrole hydroxy amide #8; APHA 8; APHA8. Grades: ≥98%. CAS No. 676599-90-9. Molecular formula: C16H16N2O3. Mole weight: 284.3. BOC Sciences 2
APHE-2 APHE-2 is a pyrazoloisoquinolinone antibiotic produced by Streptoverticillium griseocarneum. It has weak anti-Gram-positive bacteria activity. Synonyms: 1H-Indole, 3-(2-propyl-5-oxazolyl)-; WS-30581A. CAS No. 93773-64-9. Molecular formula: C14H14N2O. Mole weight: 226.27. BOC Sciences
APHE-3 APHE-3 is a pyrazoloisoquinolinone antibiotic produced by Streptoverticillium griseocarneum. It has weak anti-Gram-positive bacteria activity. APHE-3 can also inhibit lymphocyte proliferation in the presence of Phytohemagglutinin, with IC50 of about 0.1 mmol/L. Synonyms: Pimprinine; WS 30581C. Grades: >95% by HPLC. CAS No. 13640-26-1. Molecular formula: C12H10N2O. Mole weight: 198.22. BOC Sciences
APHE-4 APHE-4 is a pyrazoloisoquinolinone antibiotic produced by Streptoverticillium griseocarneum. It has weak anti-Gram-positive bacteria activity. Synonyms: WS 30581B. CAS No. 93773-63-8. Molecular formula: C15H16N2O. Mole weight: 240.30. BOC Sciences
a-Phenyl-a-(2-pyridyl)acetonitrile a-Phenyl-a-(2-pyridyl)acetonitrile. Group: Biochemicals. Alternative Names: a-Phenyl-2-pyridineacetonitrile; 2-Pyridyl phenyl acetonitri le; NSC 16276. Grades: Highly Purified. CAS No. 5005-36-7. Pack Sizes: 500mg, 1g, 2g, 5g, 10g. Molecular Formula: C13H10N2. US Biological Life Sciences. USBiological 8
Worldwide
a-Phenyllactic acid 99+% a-Phenyllactic acid 99+%. Group: Biochemicals. Grades: Reagent Grade. CAS No. 515-30-0. Pack Sizes: 1g, 5g, 25g. US Biological Life Sciences. USBiological 4
Worldwide
a-Phenylpiperidine-2-acetamide ≥97% (HPLC) a-Phenylpiperidine-2-acetamide ≥97% (HPLC). Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 1g, 5g, 25g. US Biological Life Sciences. USBiological 4
Worldwide
a-Phenyl-trans-cinnamamide Crystalline. CAS No. 20432-29-5. Pack Sizes: 1g. Product ID: FR-0594. M.P. 127. Mole weight: 223.28. Frinton Laboratories Inc
Frinton Laboratories
a-Phenyl-trans-cinnamic acid White powder, 98%. Synonyms: trans-2,3-Diphenylpropionic acid. CAS No. 91-48-5. Pack Sizes: 25g, 100g. Product ID: FR-0253. M.P. 170-171. Mole weight: 224.26. Frinton Laboratories Inc
Frinton Laboratories
Aphermate Aphermate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: alpha,3,3-trimethyl-cyclohexanemethanoformate;Cyclohexanemethanol. alpha.-3,3-trimethyl-,formate;APHERMATE;CYCLOHEXANE-1-METHANOL, ALPHA, 3,3-TRIMETHYL:FORMATE;alpha,3,3-trimethylcyclohexylmethyl formate;l-Cyclocitronelleneformate;alpha,3,3-Trimethylcycl. Product Category: Heterocyclic Organic Compound. CAS No. 25225-08-5. Molecular formula: C11H20O2. Mole weight: 184.28. Purity: 0.96. IUPACName: 1-(3,3-dimethylcyclohexyl)ethyl formate. Canonical SMILES: CC(C1CCCC(C1)(C)C)OC=O. Density: 0.918g/cm³. ECNumber: 246-735-2. Product ID: ACM25225085. Alfa Chemistry — ISO 9001:2015 Certified. Categories: Aphera tessellata. Alfa Chemistry. 3
aphidicolan-16β-ol synthase This is a bifunctional enzyme which also has EC 5.5.1.14 syn-copalyl diphosphate synthase activity. Aphidicolan-16β-ol is a precursor of aphidicolin, a specific inhibitor of DNA polymerase α (EC 2.7.7.7). Group: Enzymes. Synonyms: PbACS. Enzyme Commission Number: EC 4.2.3.42. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5201; aphidicolan-16β-ol synthase; EC 4.2.3.42; PbACS. Cat No: EXWM-5201. Creative Enzymes

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products