A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| GSK-A1 | GSK-A1 is a selective type III phosphatidylinositol 4-kinase PI4KA (PI4KIIIα) inhibitor with a pIC50 of 8.5-9.8. GSK-A1 inhibits PtdIns(4,5)P2 resynthesis with an IC50 of about 3 nM. GSK-A1 potently decreases the levels of PtdIns(4)P with a negligible effect on PtdIns(4,5)P2. GSK-A1 has the potential for anti-hepatitis C virus (HCV) research[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1416334-69-4. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-125118. |  |
| GSK J1 | GSK-J1 is a highly potent H3K27 histone demethylase inhibitor with IC50 of 28 nM and 53 nM in cell-free assays for JMJD3 (KDM6B) and UTX (KDM6A), respectively, >10-fold selectivity over other tested demethylases. Alternative Names: GSKJ1; GSKJ 1; GSKJ-1. Grades: 98%. CAS No. 1373422-53-7. Molecular formula: C22H23N5O2. Mole weight: 389.45. |  |
| GSK-J1 | GSK-J1, a chemical probe, is a potent inhibitor of H3K27me3/me2-demethylases JMJD3/KDM6B and UTX/KDM6A, with IC50 of 60 nM towards KDM6B. Uses: Scientific research. Category: Signaling pathways. CAS No. 1373422-53-7. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15648. | |
| GSK-J1 Sodium Salt | GSK-J1 Sodium Salt. Group: Biochemicals. Alternative Names: 3-((6-(4,5-Dihydro-1H-benzo[d]azepin-3(2H)-yl)-2-(pyridin-2-yl)pyrimidin-4-yl)amino)propanoate Monosodium Salt. Grades: Highly Purified. Pack Sizes: 5mg. Molecular Formula: C22H22N5NaO2, Molecular Weight: 411.43. US Biological Life Sciences. |  Worldwide |
| GSK-J4 | GSK-J4 is a potent dual inhibitor of H3K27me3/me2-demethylases JMJD3/KDM6B and UTX/KDM6A with IC50s of 8.6 and 6.6 μM, respectively. GSK-J4 inhibits LPS-induced TNF-α production in human primary macrophages with an IC50 of 9 μM. GSK J4 is a cell permeable proagent of GSK-J1[1][2][3]. GSK-J4 induces endoplasmic reticulum stress-related apoptosis[4]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1373423-53-0. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-15648B. | |
| GSK-J4 | GSK-J4 Inhibitor. Uses: Scientific use. Product Category: T3100. CAS No. 1373423-53-0. |  |
| GSK-J4 hydrochloride | GSK-J4 hydrochloride is a potent dual inhibitor of H3K27me3/me2-demethylases JMJD3/KDM6B and UTX/KDM6A with IC50s of 8.6 and 6.6 μM, respectively. GSK-J4 hydrochloride inhibits LPS-induced TNF-α production in human primary macrophages with an IC50 of 9 μM. GSK-J4 hydrochloride is a cell permeable proagent of GSK-J1[1][2][3]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1797983-09-5. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15648F. | |
| GSK-J4 Hydrochloride | GSK-J4 Hydrochloride. Group: Biochemicals. Alternative Names: Ethyl 3-((6-(4,5-Dihydro-1H-benzo[d]azepin-3(2H)-yl)-2-(pyridin-2-yl)pyrimidin-4-yl)amino)propanoate Monohydrochloride. Grades: Highly Purified. Pack Sizes: 5mg. Molecular Formula: C24H28ClN5O2, Molecular Weight: 453.96. US Biological Life Sciences. | Worldwide |
| GSK-J4 Hydrochloride | GSK J4 HCl is a cell permeable prodrug of GSK J1, which is the first selective inhibitor of the H3K27 histone demethylase JMJD3 and UTX with IC50 of 60 nM in a cell-free assay and inactive against a panel of demethylases of the JMJ family. Group: Inhibitors. CAS No. 1797983-09-5. Pack Sizes: 10mg. Product ID: S7070. Formula: C24H27N5O2.HCl. Smiles: CCOC(=O)CCNC1=CC(=NC(=N1)C2=CC=CC=N2)N3CCC4=CC=CC=C4CC3.Cl. Storage Conditions: 2 years -80 in solvent. |  United States; Europe |
| GSK-J5 | GSK-J5 is a potent inhibitor of Schistosome and worm. GSK-J5 increases schistosomula mortality and adult worm motility and mortality, as well as egg oviposition, in a dose- and time-dependent manner[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1394854-51-3. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15648C. | |
| GSK-J5 Hydrochloride | GSK-J5 Hydrochloride is a selective jumonji H3K27 demethylase inhibitor that modulates the proinflammatory macrophage response. The histone H3 lysine 27 (H3K27) demethylase JMJD3 plays important roles in the transcriptional regulation of cell differentiation, development, the inflammatory response, and cancer.1,2 GSK-J4 (Item No. 12073) is a cell-permeable prodrug which is modified by intracellular esterases to give GSK-J1 (Item No. 12054), an inhibitor of JMJD3. GSK-J5 is a pyridine regio-isomer of GSK-J4. Like GSK-J4, this isomer is cell-permeable and hydrolyzed to a free base.3 However, the free base is a weak inhibitor of JMJD3 (IC50 > 100 μM), making it an ideal inactive control molecule for elucidating the functional role of JMJD3 inhibition.3. Group: Biochemicals. Alternative Names: N-[2-(3-Pyridinyl)-6-(1,2,4,5-tetrahydro-3H-3-benzazepin-3-yl)-4-pyrimidinyl]- β-alanineEthyl Ester Hydochloride. Grades: Highly Purified. CAS No. 1394854-51-3. Pack Sizes: 5mg. US Biological Life Sciences. | Worldwide |
| GSK-LSD1 2HCl | GSK-LSD1 2HCl is an irreversible, and selective LSD1 inhibitor with IC50 of 16 nM, > 1000 fold selective over other closely related FAD utilizing enzymes (i.e. LSD2, MAO-A, MAO-B). Alternative Names: GSK LSD1 2HCl; GSK-LSD1 Dihydrochloride. Grades: >98%. CAS No. 1431368-48-7. Molecular formula: C14H22Cl2N2. Mole weight: 289.24. | |
| GSK-LSD1 dihydrochloride | GSK-LSD1 dihydrochloride is a potent, selective and irreversible lysine specific demethylase 1 (LSD1) inhibitor with an IC50 of 16 nM. Uses: Scientific research. Category: Signaling pathways. CAS No. 2102933-95-7. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-100546A. | |
| GSK_WRN4 | GSK_WRN4 is an orally active WRN helicase inhibitor (pIC50=7.6). GSK_WRN4 induces DNA damage markers (p21, p-γH2AX, p-KAP1). GSK_WRN4 selectively inhibits microsatellite-unstable tumor growth in vitro and in vivo by inducing DNA double-strand breaks, particularly at expanded TA repeats and regions of DNA damage[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2923008-66-4. Pack Sizes: 1 mg; 5 mg. Product ID: HY-163942. | |
| GsMTx4 | GsMTx4 (Grammostola spatulata mechanotoxin 4, M-theraphotoxin-Gr1a, M-TRTX-Gr1a) is a spider venom peptide that inhibits cationic mechanosensitive channels (MSCs) belonging to the Piezo and TRP channel families. Group: Peptides. CAS No. 1209500-46-8. Pack Sizes: 1mg. Product ID: P1205. Formula: C185H273N49O45S6. Storage Conditions: 3 years-20°C powder. | United States; Europe |
| GsMTx4 | GsMTx4 is a spider venom peptide that selectively inhibits cationic-permeable mechanosensitive channels (MSCs) belonging to the Piezo and TRP channel families. GsMTx4 also blocks cation-selective stretch-activated channels (SACs) , attenuates lysophosphatidylcholine (LPC)-induced astrocyte toxicity and microglial reactivity. GsMTx4 is an important pharmacological tool for identifying the role of these excitatory MSCs in normal physiology and pathology[1][2][4]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1209500-46-8. Pack Sizes: 500 μg; 1 mg; 5 mg. Product ID: HY-P1410. | |
| GsMTx4 | GsMTx4 is a mechanosensitive and stretch-activated ion channel inhibitor. It is used as a tool for identifying the role of these excitatory MSCs in normal physiology and pathology. Grades: >98%. CAS No. 1209500-46-8. Molecular formula: C185H273N49O45S6. Mole weight: 4095.86. | |
| GsMTx4 TFA | GsMTx4 is a TRPC1 and TRPC6 blocker, and also blocks stretch-activated cation channels in astrocytes, cardiac cells, and skeletal muscle cells. Alternative Names: H-Gly-Cys-Leu-Glu-Phe-Trp-Trp-Lys-Cys-Asn-Pro-Asn-Asp-Asp-Lys-Cys-Cys-Arg-Pro-Lys-Leu-Lys-Cys-Ser-Lys-Leu-Phe-Lys-Leu-Cys-Asn-Phe-Ser-Phe-OH.TFA; glycyl-L-cysteinyl-L-leucyl-L-alpha-glutamyl-L-phenylalanyl-L-tryptophyl-L-tryptophyl-L-lysyl-L-cysteinyl-L-asparagyl-L-prolyl-L-asparagyl-L-alpha-aspartyl-L-alpha-aspartyl-L-lysyl-L-cysteinyl-L-cysteinyl-L-arginyl-L-prolyl-L-lysyl-L-leucyl-L-lysyl-L-cysteinyl-L-seryl-L-lysyl-L-leucyl-L-phenylalanyl-L-lysyl-L-leucyl-L-cysteinyl-L-asparagyl-L-phenylalanyl-L-seryl-L-phenylalanine trifluoroacetic acid. Molecular formula: C185H278N48O46S6. Mole weight: 4103. | |
| GsMTx4 TFA | GsMTx4 TFA Inhibitor. Uses: Scientific use. Product Category: TP1300. CAS No.: | |
| GSTO1-IN-1 | GSTO1-IN-1 is a potent glutathione S-transferase omega 1 (GSTO1) inhibitor with an IC50 of 31 nM. Uses: Scientific research. Category: Signaling pathways. CAS No. 568544-03-6. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-111530. | |
| GT-02216 | GT-02216 can bind to GCase allosterically and enhance its activity. GT-02216 enhances the activity of GCase in primary human fibroblasts dose-dependently reduces the accumulation of its substrate, hexosylsphingosine (HexCer). GT-02216 reduces the Tau accumulation in mutant GBA1 fibroblasts. GT-02216 can be used for the study of Parkinsons disease[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2648407-76-3. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-174311. | |
| GT19630 | PROTAC c-Myc degrader-1 (Compound A153) is a multiple target protein degrader (PROTAC). PROTAC c-Myc degrader-1 effective degrades c-MYC, CK1α, GSPT1 and IKZF1/2/3 proteins in a variety of tumor cells. PROTAC c-Myc degrader-1 can be used for c-Myc high expression related disease research, such as cancer, cardiovascular and cerebrovascular diseases, and viral infection (Pink: c-Myc ligand (HY-168685); Blue: E3 ligase ligand (HY-W093472); Black: linker (HY-W015808))[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2883535-99-5. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-148837. | |
| GT1a-Oligosaccharide | GT1a-Oligosaccharide is an advanced oligosaccharide, finding applications in studying intricate neurological afflictions. Its specialized affinity towards toxins and pathogens endows it with unparalleled efficiency in studying viral invasions. Alternative Names: Neu5Aca2-8Neu5Aca2-3Galb1-3GalNAcb1-4 (Neu5Aca2-3)Galb1-4Glc. Molecular formula: C59H93N4O45Na3. Mole weight: 1647.34. | |
| GT1b-Ganglioside | GT1b-Ganglioside is demonstrated to protect mouse brain cells against L-cysteine-induced damage of mitochondrial DNA and increased lipid peroxidation, suggested to operate through scavenging of OH radicals promoted by L-cysteine. GT1b-Ganglioside is also demonstrated to suppress seizures, damage to mitochondrial DNA and lipid peroxidation induced by kainic acid. Alternative Names: Trisialoganglioside-GT1b (porcine brain); Ganglioside GT1b; Ganglioside G1; GT1b. Grades: >99%. CAS No. 59247-13-1. Molecular formula: C95H174N8O47. Mole weight: 2180.42. | |
| GT1b-Oligosaccharide | GT1b-Oligosaccharide is an extraordinary compound, manifesting promising applications in studying the complexities of neurological disorders and autoimmune diseases. CAS No. 75663-36-4. Molecular formula: C59H96N4O45. Mole weight: 1581.39. | |
| GT1c-Oligosaccharide | GT1c-Oligosaccharide is a remarkable compound widely utilized in studying intricate cellular mechanisms in a spectrum of ailments, such as debilitating cancers and complex neurodegenerative disorders. Alternative Names: Galb1-3GalNAcb1-4(Neu5Aca2-8Neu5Aca2-8Neu5Aca2-3)Galb1-4Glc. Molecular formula: C59H93N4O45Na3. Mole weight: 1647.34. | |
| GT 2016 | GT 2016. Group: Biochemicals. Grades: Purified. CAS No. 152241-24-2. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| GT2-Oligosaccharide | GT2-Oligosaccharide is a multifaceted biomedical marvel, effectively aiding in the formidable research of cardiovascular diseases, cancer, and diabetes. Acting as a prowess-inducing inhibitor of α-glucosidases, this spellbinding remedy boasts unprecedented potential in orchestrating the delicate symphony of blood glucose regulation. Alternative Names: GalNAcb1-4(Neu5Aca2-8Neu5Aca2-8Neu5Aca2-3)Galb1-4Glc. Molecular formula: C53H83N4O40Na3. Mole weight: 1485.20. | |
| GT3-Oligosaccharide | GT3-Oligosaccharide is an extraordinary biomedical compound emanating from pristine natural sources, acting as a potent antioxidant. It is anti-inflammatory and immunomodulatory crusader, finding applications in studying cancer, cardiovascular ailments and neurodegenerative ravages. Alternative Names: Neu5Aca2-8Neu5Aca2-8Neu5Aca2-3Galb1-4Glc. Molecular formula: C45H70N3O35Na3. Mole weight: 1282.01. | |
| GT-653 | GT-653 is a PROTAC degrader for lysine-specific demethylase 5B (KDM5B). GT-653 degrades 68.35% KDM5B at 10 μM in a ubiquitin proteasome-dependent manner, upregulates H3K4me3 levels, and activates the type-I interferon signaling pathway in prostate cancer cells 22RV1. (Pink: KDM5B ligand (HY-158433); Black: Linker (HY-W004896); Blue: E3 ligase ligand (HY-103596))[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 3057627-63-8. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-158432. | |
| GT 949 | GT 949 is a selective excitatory amino acid transporter-2 (EAAT2) positive allosteric modulator with an EC50 of 0.26 nM[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 460330-27-2. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-114381. | |
| GTA182 | GTA182 (compound 107) is an orally active PRMT5 inhibitor and can be used for study of cancer[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: PRMT5-IN-39. CAS No. 3030464-01-5. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-163588. | |
| GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | It is a derivative of Exendin-4 peptide. Alternative Names: Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser. Grades: ≥95%. Molecular formula: C170H262N44O56S. Mole weight: 3850.28. | |
| G-TOM-CE Phosphoramidite | The synthesis of RNA using monomers containing the 2'-O-Triisopropylsilyloxymethyl (TOM) group (TOM-Protecting-Group) has very high coupling efficiency along with fast, simple deprotection. Alternative Names: 5'-Dimethoxytrityl-N-acetyl-Guanosine, 2'-O-triisopropylsilyloxymethyl-3'-[(2-cyanoethyl)-(N,N-diisopropyl)]-phosphoramidite; N2-acetyl-5'-O-(4,4'-dimethoxytrityl)-2'-O-triisopropylsilyloxymethyl-guanosine-Phosphoramidite; N-Acetyl-2'-O-[(triisopropylsilyloxy)methyl]-3'-O-[diisopropylamino(2-cyanoethoxy)phosphino]-5'-O-(4,4'-dimethoxytrityl)guanosine; Guanosine, N-acetyl-5'-O-[bis(4-methoxyphenyl)phenylmethyl]-2'-O-[[[tris(1-methylethyl)silyl]oxy]methyl]-, 3'-[2-cyanoethyl N,N-bis(1-methylethyl)phosphoramidite]; 5'-O-DMTr-2'-O-TOM-G(Ac) Phosphoramidite; DMTr-2'-O-TOM-G(Ac) 3'-CE'-Phosphoramidite; G(Ac)-TOM-CE Phosphoramidite. Grades: ≥98% by HPLC. CAS No. 253586-14-0. Molecular formula: C52H72N7O10PSi. Mole weight: 1014.24. | |
| GTP, 100mM Sodium Solution | Guanosine triphosphate (GTP) is a guanine nucleotide containing three phosphate groups esterified to the sugar moiety. GTP functions as a carrier of phosphates and pyrophosphates involved in channeling chemical energy into specific biosynthetic pathways. GTP activates the signal transducing G proteins which are involved in various cellular processes including proliferation, differentiation, and activation of several intracellular kinase cascades. Proliferation and apoptosis are regulated in part by the hydrolysis of GTP by small GTPases Ras and Rho. Another type of small GTPase, Rab, plays a role in the docking and fusion of vesicles and may also be involved in vesicle formation. In addition to its role in signal transduction, GTP also serves as an energy-rich precursor of mononucleotide units in the enzymatic biosynthesis of DNA and RNA. Alternative Names: D-Guanosine 5'-triphosphate; Guanosine triphosphate; Guanosine 5'-triphosphoric acid; pppG; guanosine 5'-O-(triphosphate); [[(2R,3S,4R,5R)-5-(2-amino-6-oxo-1H-purin-9-yl)-3,4-dihydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl] phosphono hydrogen phosphate. Molecular formula: C10H16N5O14P3 (free acid). Mole weight: 523.18 (free acid). | |
| GTP 14564 | GTP 14564. Group: Biochemicals. Grades: Purified. CAS No. 34823-86-4. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| GTP 3',8-cyclase | The enzyme catalyses an early step in the biosynthesis of the molybdenum cofactor (MoCo). In bacteria and plants the reaction is catalysed by MoaA and Cnx2, respectively. In mammals it is catalysed by the MOCS1A domain of the bifunctional MOCS1 protein, which also catalyses EC 4.6.1.17, cyclic pyranopterin monophosphate synthase. The enzyme belongs to the superfamily of radical S-adenosyl-L-methionine (radical SAM) enzymes, and contains two oxygen-sensitive FeS clusters. Group: Enzymes. Synonyms: MOCS1A (gene name); moaA (gene name); cnx2 (gene name). Enzyme Commission Number: EC 4.1.99.22. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4935; GTP 3',8-cyclase; EC 4.1.99.22; MOCS1A (gene name); moaA (gene name); cnx2 (gene name). Cat No: EXWM-4935. |  |
| GTPαS (Sp isomer) | GTPαS (Sp isomer) is a non-hydrolyzable analog of GTP. It contains a sulfur atom replacing one of the non-bridging oxygen atoms in the triphosphate chain. The Sp isomer specifically refers to the stereoisomer where the sulfur atom occupies a particular spatial orientation. This compound is widely used in biochemical research to study G-protein signaling pathways, as it can activate G-proteins but is resistant to hydrolysis, thereby providing sustained signaling. Alternative Names: Guanosine 5'-O-(1-thiotriphosphate), Sp-isomer; SP-GTP-αS; Guanosine, 5'→P''-ester with [P''(S)]-thiotriphosphoric acid ((HO)2P(O)OP(O)(OH)OP(O)(OH)(SH)); Guanosine, 5'→P''-ester with thiotriphosphoric acid ((HO)2P(O)OP(O)(OH)OP(S)(OH)2), (S)-. Grades: ≥95% by HPLC. CAS No. 81570-51-6. Molecular formula: C10H16N5O13P3S. Mole weight: 539.24. | |
| GTPase KRas (7-15) | GTPase KRas (7-15) is a 9-aa peptide. The K-Ras protein is a GTPase, which means it converts a molecule called GTP into another molecule called GDP. In this way the K-Ras protein acts like a switch that is turned on and off by the GTP and GDP molecules. Alternative Names: K-Ras 2 (7-15). | |
| GTPase NRas (55-64) | GTPase NRas (55-64) is a bioactive peptide of GTPase NRas. Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Alternative Names: Transforming protein N-Ras (55-64). | |
| GTP cyclohydrolase I | The reaction involves hydrolysis of two C-N bonds and isomerization of the pentose unit; the recyclization may be non-enzymic. This enzyme is involved in the de novo synthesis of tetrahydrobiopterin from GTP, with the other enzymes involved being EC 1.1.1.153 (sepiapterin reductase) and EC 4.2.3.12 (6-pyruvoyltetrahydropterin synthase). Group: Enzymes. Synonyms: GTP cyclohydrolase; guanosine triphosphate cyclohydrolase; guanosine triphosphate 8-deformylase; dihydroneopterin triphosphate synthase; GTP 8-formylhydrolase. Enzyme Commission Number: EC 3.5.4.16. CAS No. 37289-19-3. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4542; GTP cyclohydrolase I; EC 3.5.4.16; 37289-19-3; GTP cyclohydrolase; guanosine triphosphate cyclohydrolase; guanosine triphosphate 8-deformylase; dihydroneopterin triphosphate synthase; GTP 8-formylhydrolase. Cat No: EXWM-4542. | |
| GTP cyclohydrolase II | Two C-N bonds are hydrolysed, releasing formate, with simultaneous removal of the terminal diphosphate. Group: Enzymes. Synonyms: guanosine triphosphate cyclohydrolase II; GTP-8-formylhydrolase. Enzyme Commission Number: EC 3.5.4.25. CAS No. 56214-35-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4552; GTP cyclohydrolase II; EC 3.5.4.25; 56214-35-8; guanosine triphosphate cyclohydrolase II; GTP-8-formylhydrolase. Cat No: EXWM-4552. | |
| GTP cyclohydrolase IIa | Requires Mg2+. This enzyme catalyses the hydrolysis of the imidazole ring of guanosine 5'-triphosphate, N7-methylguanosine 5'-triphosphate or inosine 5'-triphosphate. Xanthosine 5'-triphosphate and ATP are not substrates. It also catalyses the hydrolysis of diphosphate to form two equivalents of phosphate. Unlike GTP cyclohydrolase II (EC 3.5.4.25), this enzyme does not release formate, but does hydrolyse the diphosphate from GTP to phosphate. Group: Enzymes. Enzyme Commission Number: EC 3.5.4.29. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4556; GTP cyclohydrolase IIa; EC 3.5.4.29. Cat No: EXWM-4556. | |
| GTP cyclohydrolase IV | Requires Fe2+. A zinc protein. The enzyme is involved in methanopterin biosynthesis in methanogenic archaea. cf. GTP cyclohydrolase I (EC 3.5.4.16), GTP cyclohydrolase II (EC 3.5.4.25) and GTP cyclohydrolase IIa (EC 3.5.4.29). Group: Enzymes. Synonyms: MptA; GTP cyclohydrolase MptA. Enzyme Commission Number: EC 3.5.4.39. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4567; GTP cyclohydrolase IV; EC 3.5.4.39; MptA; GTP cyclohydrolase MptA. Cat No: EXWM-4567. | |
| GTP diphosphokinase | GDP can also act as acceptor. Group: Enzymes. Synonyms: stringent factor; guanosine 3',5'-polyphosphate synthase; GTP pyrophosphokinase; ATP-GTP 3'-diphosphotransferase; guanosine 5',3'-polyphosphate synthetase; (p)ppGpp synthetase I; (p)ppGpp synthetase II; guanosine pentaphosphate synthetase; GPSI; GPSII. Enzyme Commission Number: EC 2.7.6.5. CAS No. 63690-89-1. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3224; GTP diphosphokinase; EC 2.7.6.5; 63690-89-1; stringent factor; guanosine 3',5'-polyphosphate synthase; GTP pyrophosphokinase; ATP-GTP 3'-diphosphotransferase; guanosine 5',3'-polyphosphate synthetase; (p)ppGpp synthetase I; (p)ppGpp synthetase II; guanosine pentaphosphate synthetase; GPSI; GPSII. Cat No: EXWM-3224. | |
| GTP-γ-AmNS | GTP-γ-AmNS is a fluorescent analogue of GTP used for the determination of enzymes specialized to cleave α/β-phosphodiester bonds. Alternative Names: Guanosine- 5'- O- triphosphoro- γ- 1- (5- sulfonic acid)naphthylamidate, sodium salt. Grades: ≥ 95% by HPLC. CAS No. 76724-84-0. Molecular formula: C20H23N6O16P3S (free acid). Mole weight: 728.4 (free acid). | |
| GTP-γ-S | GTP-γ-S. Alternative Names: Guanosine-5'-O-(3-thiotriphosphate). tetrasodium salt. CAS No. 37589-80-3. Purity: 95%. Product ID: ACM37589803. Molecular formula: C10H16N5O13P3S. Mole weight: 539.3 (free acid). Alfa Chemistry - ISO 9001:32057 Certified. |  |
| GTPγS | GTPγS is a stable G-protein-activating (GTP) analog. The physiological actions of GTPgammaS includestimulation of guanine nucleotide-binding proteins, phosphoinositide hydrolysis, cyclic AMP accumulation, and activation of specific proto-oncogenes. Alternative Names: Guanosine-5'-(γ-thio)-triphosphate, Tetralithium salt; Guanosine-5'-(3-thio)-triphosphate; Guanosine-5'-(3-thiotriphosphate). Grades: ≥ 90 % by HPLC, contains < 10 % GDP. CAS No. 94825-44-2. Molecular formula: C10H16N5O13P3S (free acid). Mole weight: 539.24 (free acid). | |
| GTP-GAMMA-S SODIUM SALT | GTP-GAMMA-S SODIUM SALT. Alternative Names: guanosine5'-o-(3-thiotriphosphate; guanosine-5'-o-(3-thiotriphosphate),(gtp-g-s),sodiumsalt; GTP-GAMMA-S; GTP-GAMMA-S, NA; GTP-GAMMA-S SODIUM SALT; GUANOSINE-5'-(GAMMA-THIO)-TRIPHOSPHATE, SODIUM SALT; GUANOSINE-5'-[GAMMA-THIO]TRIPHOSPHATE TETRASODIUM SALT; GUAN. CAS No. 37589-80-3. Molecular formula: C10H12N5Na4O13P3S. Mole weight: 627.17. | |
| GTPγS tetralithium | GTPγS (Guanosine 5'-[γ-thio]triphosphate) tetralithium is a G-protein activator that protects proteins from proteolytic degradation, stimulates GLUT4 translocation in a tyrosine kinase-dependent manner, stimulate phospholipases and induce actin polymerization. GTPγS tetralithium to couple with G- protein α, to study its effect on kinase activity. GTPγS tetralithium acts as a component of lysis buffer[1][2][3][4]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Guanosine 5'-[γ-thio]triphosphate tetralithium. CAS No. 94825-44-2. Pack Sizes: 1 mg; 5 mg. Product ID: HY-137677B. | |
| G-TPP | G-TPP is a mitochondria-targeted Hsp90 inhibitor that increases cell death in HeLa and MCF7 cells, consistently inhibits cell death induced by oxidative stress and mitochondrial dysfunction induced by PINK1 mutation in mouse embryonic fibroblast cells and DA cell models such as SH-SY5Y and SN4741 cells. Additionally, G-TPP also suppresses the defective locomotive activity and DA neuron loss in Drosophila PINK1 null mutants. Alternative Names: G-TPP; G TPP. Grades: >98%. CAS No. 1131626-46-4. Molecular formula: C52H65N3O8P. Mole weight: 890.85. | |
| GTP trisodium salt, 100 mM Solution, PCR Grade | GTP trisodium salt, 100 mM Solution, PCR Grade (Guanosine triphosphate trisodium salt, 100 mM Solution, PCR Grade) is a solution prepared from GTP at a concentration of 100 mM, free of DNase, RNase and phosphatase contamination, and suitable for molecular biology research[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Guanosine triphosphate trisodium salt, 100 mM Solution, PCR Grade. CAS No. 36051-31-7. Pack Sizes: 1 mL. Product ID: HY-113225H. | |
| GTRI-02 | GTRI-02 is produced by the strain of Micromonospora sp. SA246. Its IC50 of inhibiting lipid peroxidation was 1.89 μg/mL, which was half of that of vitamin E. Alternative Names: 7-acetyl-3,6-dihydroxy-8-methyl-tetralone. Molecular formula: C13H14O4. Mole weight: 234.25. | |
| GTRI-BB | GTRI-BB is from Micromonospora sp. SA-246 with anti-gram-positive bacteria activity and cytotoxicity. The GI50 (μg/mL) of PC-3 (prostate), A549 (lung) and K562 (leukemia) cells were 0.21, 0.25 and 0.21 respectively. Molecular formula: C33H26O13. Mole weight: 630.55. | |
| gTS-21 | gTS-21. Group: Biochemicals. Grades: Highly Purified. CAS No. 148372-04-7. Pack Sizes: 1mg, 2mg, 5mg, 10mg, 25mg. US Biological Life Sciences. | Worldwide |
| GTS-21 dihydrochloride | GTS-21 dihydrochloride is a selective alpha7 nicotinic acetylcholine receptor (α7-nAChR) agonist with anti inflammatory and cognition enhancing activities. GTS-21 dihydrochloride is also a α4β2 (Ki=20 nM for humanα4β2) and 5-HT3A receptor (IC50=3.1 μM) antagonist[1][2]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: DMXB-A; DMBX-anabaseine. CAS No. 156223-05-1. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-14564A. | |
| GTS-21 dihydrochloride | GTS-21, also known as DMBX-A, is a derivative of the natural product anabaseine that acts as a partial agonist at neural nicotinic acetylcholine receptors. It binds to both the α4β2 and α7 subtypes, but activates only the α7 to any significant extent. Alternative Names: GTS-21; GTS 21; GTS21; DMBX-A. Grades: 98%. CAS No. 156223-05-1. Molecular formula: C19H20N2O2.2HCl. Mole weight: 381.30. | |
| GTx-027 | GTx-027 is an orally active and non-steroidal selective androgen receptor modulator (SARM). GTx-027 shows androgen receptor (AR) transactivation effects with the EC50 of 1.8 nM. GTx-027 acts selectively increase muscle weight (anabolic) without affecting secondary sexual organs (androgenic). GTx-027 has the protential for the study of breast cancer and stress urinary incontinence (SUI)[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 928122-40-1. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-171048. | |
| Guacetisal | Guacetisal is obtained from the esterification of acetylsalicylic acid with guaiacol which has the potential for chronic bronchitis treatment extracted from patent CN 106866420 A. Uses: Scientific research. Category: Signaling pathways. CAS No. 55482-89-8. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-17477. | |
| Guadecitabine sodium | Guadecitabine sodium (SGI-110 sodium) is a second-generation DNA methyltransferases (DNMT) inhibitor for research of acute myeloid leukemia (AML) and myelodysplastic syndromes (MDS)[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: SGI-110 sodium; S-110 sodium. CAS No. 929904-85-8. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15229. | |
| GUAI-1(5)-EN-11-OL:ACETATE | GUAI-1(5)-EN-11-OL:ACETATE. Alternative Names: [3s-(3alpha,5alpha,8alpha)]-etat; 1-(3,8-Dimethyl-1,2,3,4,5,6,7,8-octahydro-5-azulenyl)-1-methylethyl acetate; 1,2,3,4,5,6,7,8-octahydro-.alpha.. alpha.-3,8-tetramethyl-,acetate,[3S-(3.alpha.,5.alpha.,8.alpha5-Azulenemethanol; 1,2,3,4,5,6,7,8-octahydro-alph. CAS No. 134-28-1. Molecular formula: C17H28O2. Mole weight: 264.4. | |
| Guaiac gum | Gum guaiac is a tree resin and crude source of 2,5-di-(4-hydroxy-3-methoxyphenyl)-3,4-dimethylfuran (α-guaiaconic acid).[3] The phenolic α-guaiaconic acid acts as a colorimetric peroxidase substrate.[1][2][4] When reacted with an organic or inorganic oxidizing agent, the α-guaiaconic acid is oxidized to a blue-colored quinone. The guaiac reaction has been used to detect trace amounts of heme from hemoglobin in the presence of peroxide. The Nobles test can be performed using 67% (w/v) gum guaiac diluted in 96% ethanol to analyze the level of extracellular oxidase production [5]. Group: Biochemicals. Grades: Highly Purified. CAS No. 9000-29-7. Pack Sizes: 25g, 50g, 100g, 250g, 500g. US Biological Life Sciences. | Worldwide |
| Guaiacin | Guaiacin is a lignan isolated from the leaves of Guaiacum officinale. Guaiacin inhibits COX-1 and COX-2 leading to the reduction of inflammations. Alternative Names: (6R,7S,8S)-8-(4-hydroxy-3-methoxyphenyl)-3-methoxy-6,7-dimethyl-5,6,7,8-tetrahydronaphthalen-2-ol. Grades: >98%. CAS No. 36531-08-5. Molecular formula: C20H24O4. Mole weight: 328.408. | |
| Guaiacin | Guaiacin. Group: Biochemicals. Grades: Plant Grade. CAS No. 36531-08-5. Pack Sizes: 5mg. Molecular Formula: C20H24O4, Molecular Weight: 328.41. US Biological Life Sciences. | Worldwide |
| Guaiacol | Guaiacol, a phenolic compound, inhibits LPS-stimulated COX-2 expression and NF-κB activation[1]. Anti-inflammatory activity[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: 2-Methoxyphenol. CAS No. 90-05-1. Pack Sizes: 10 mM * 1 mL in DMSO; 5 g; 10 g; 25 g; 50 g; 100 g. Product ID: HY-N1380. | |
| Guaiacol | Guaiacol. CAS No. 90-05-1. Cenik is your partner of choice for specialised chemicals. We don't just provide products - we supply solutions to your technical and regulatory specifications. |  |
| Guaiacol | Guaiacol is a phenolic natural product first isolated from Guaiac resin, as well as the oxidation of lignin. Guaiacol is an agent that is believed to have disinfecting properties and is used as an expectorant. Alternative Names: o-Methoxyphenol; 2-Hydroxyanisole; Phenol, 2-methoxy-; Pyroguaiac acid; Pyrocatechol monomethyl ether; 1-Hydroxy-2-methoxybenzene. CAS No. 90-05-1. Molecular formula: C7H8O2. Mole weight: 124.14. | |
| Guaiacol (2-Methoxyphenol) | 1kg Pack Size. Group: Aroma Chemicals, Biochemicals, Building Blocks, Flavours and Fragrance Materials, Phenols. Formula: C7H8O2. CAS No. 90-05-1. Prepack ID 22444940-1kg. Molecular Weight 124.14. See USA prepack pricing. |  |
| Guaiacol 98% | Guaiacol 98%. CAS No. 90-05-1. FEMA No. 2532. Kosher: Y. VIGON Item # 502649. Categories: Speciality Ingrdients Suppliers, Flavors, Fragrances, Perfumers. |  America & Internationally |
| Guaiacol-b-D-glucopyranoside | Guaiacol-beta-D-glucopyranoside, is a Guaiacol Conjugate, that has shown to present in fermentation of grapes that had been exposed to bushfire smoke and can potentially yield unpalatable, smoke-affected wine. Alternative Names: o-Methoxyphenyl β-D-glucopyranoside; 2-Methoxyphenyl β-D-glucopyranoside. CAS No. 6092-24-6. Molecular formula: C13H18O7. Mole weight: 286.28. | |
Our database is helping our users find suppliers everyday.
