A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| Protopanaxatriol | Botanical Source: Group: Biochemicals. Alternative Names: (20R)-Protopanaxatriol. Grades: Plant Grade. CAS No. 1453-93-6. Pack Sizes: 10mg. US Biological Life Sciences. |  Worldwide |
| Protopanaxatriol | 20S-Protopanaxatriol (g-PPT), a dammarane-type tetracyclic terpene sapogenin, may be used to study its binding to and modulation of cell function via glucocortoid (GR) and oestrogen (ER) receptors. Protopanaxatriol can be used in health products. Synonyms: 20(S)-APPT; g-PPT. Grade: >98%. CAS No. 34080-08-5. Molecular formula: C30H52O4. Mole weight: 476.73. |  |
| Protopanaxatriol, 20S- | Protopanaxatriol, 20S-. Group: Biochemicals. CAS No. 34080-08-5. Pack Sizes: 5mg. US Biological Life Sciences. | Worldwide |
| Protopine | Protopine is a Ca2+ channel blocker and antiplatelet agent. Immunomodulator. Group: Biochemicals. Alternative Names: 4,6,7,14-Tetrahydro-5-methyl-. Grades: Highly Purified. CAS No. 130-86-9. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| Protopine | Protopine (Corydinine), an isoquinoline alkaloid, is a specific reversible and competitive inhibitor of acetylcholinesterase. Protopine exhibits anti-inflammation, anti-microbial, anti-angiogenic and anti-tumour activity[1][2]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Corydinine. CAS No. 130-86-9. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-N0793. |  |
| Protopine | Protopine is an alkaloid isolated from the tubers of Corydalis yanhusuo W.T.Wang. It shows weak spasmolytic, smooth muscle stimulant activities. Uses: Bactericidal; sedative; antihypertensive. Synonyms: 7-Methyl-6,8,9,16-tetrahydrodi[1,3]benzodioxolo[4,5-c:5,6-g]azecin-15(7H)-one; Biflorine. Grade: 98%. CAS No. 130-86-9. Molecular formula: C20H19NO5. Mole weight: 353.4. | |
| protopine 6-monooxygenase | A heme-thiolate protein (P-450) involved in benzophenanthridine alkaloid synthesis in higher plants. Group: Enzymes. Synonyms: protopine 6-hydroxylase. Enzyme Commission Number: EC 1.14.13.55. CAS No. 128561-60-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0862; protopine 6-monooxygenase; EC 1.14.13.55; 128561-60-4; protopine 6-hydroxylase. Cat No: EXWM-0862. |  |
| Protoporphyrinato zinc | Protoporphyrinato zinc. Alternative Names: PROTOPORPHYRINATO ZINC;dihydrogen [3,8,13,17-tetramethyl-7,12-divinyl-21H,23H-porphine-2,18-dipropionato(4-)-N21,N22,N23,N24]zincate(4-);Zinc protoporphyrin trihydrate;Zinc protoporphyrin trihydrate, 95+%. CAS No. 15442-64-5. Molecular formula: C34H32N4O4Zn. Mole weight: 626g/mol. IUPAC Name: zinc;3-[18-(2-carboxyethyl)-8,13-bis(ethenyl)-3,7,12,17-tetramethylporphyrin-21,23-diid-2-yl]propanoic acid. SMILES: CC1=C(C2=CC3=NC(=CC4=C(C(=C([N-]4)C=C5C(=C(C(=N5)C=C1[N-]2)C)C=C)C)C=C)C(=C3CCC(=O)O)C)CCC(=O)O.[Zn+2]. InChI: InChI=1S/C34H34N4O4.Zn/c1-7-21-17(3)25-13-26-19(5)23(9-11-33(39)40)31(37-26)16-32-24(10-12-34(41)42)20(6)28(38-32)15-30-22(8-2)18(4)27(36-30)14-29(21)35-25;/h7-8,13-16H,1-2,9-12H2,3-6H3,(H4,35,36,37,38,39,40,41,42);/q;+2/p-2. |  |
| protoporphyrin ferrochelatase | The enzyme catalyses the terminal step in the heme biosynthesis pathways of eukaryotes and Gram-negative bacteria. Group: Enzymes. Synonyms: ferro-protoporphyrin chelatase; iron chelatase (ambiguous); heme synthetase (ambiguous); heme synthase (ambiguous); protoheme ferro-lyase; ferrochelatase (ambiguous). Enzyme Commission Number: EC 4.99.1.1. CAS No. 9012-93-5. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5358; protoporphyrin ferrochelatase; EC 4.99.1.1; 9012-93-5; ferro-protoporphyrin chelatase; iron chelatase (ambiguous); heme synthetase (ambiguous); heme synthase (ambiguous); protoheme ferro-lyase; ferrochelatase (ambiguous). Cat No: EXWM-5358. | |
| Protoporphyrin IX | Protoporphyrin IX is an important precursor to biologically essential prosthetic groups such as heme, cytochrome c, and chlorophylls. As a result, a number of organisms are able to synthesize this tetrapyrrole from basic precursors such as glycine and succinyl CoA, or glutamate. Despite the wide range of organisms that synthesize protoporphyrin IX the process is largely conserved from bacteria to mammals with a few distinct exceptions in higher plants.[1][2][3]. Group: Biochemicals. Alternative Names: 3,18-Divinyl-2,7,13,17-tetramethylporphine-8, 12-dipropionic acid. Grades: Reagent Grade. CAS No. 553-12-8. Pack Sizes: 100mg, 250mg, 1g, 5g. US Biological Life Sciences. | Worldwide |
| Protoporphyrin IX | Protoporphyrin IX is a final intermediate in the heme biosynthetic pathway, which acts as a radiation sensitizer enhancing ROS generation even in a hypoxic state and inducing DNA damage. Protoporphyrin IX also acts as a photo sensitizer undergoing photobleaching that occurs through direct degradation by light irradiation. Protoporphyrin IX is formed and accumulated following 5-aminolevulinic acid (5-ALA) (HY-W000450) administration in the tumor cells of rats. Protoporphyrin IX causes selective improvement of basal cell carcinoma when activated red fluorescence of a peak wavelength at 405 nm. Protoporphyrin IX is promising for research of sonodynamic and photodynamic agents for a wide range of cancers, such as bladder cancer and nodular basal cell carcinoma[1][2][3][4][5]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: PPIX. CAS No. 553-12-8. Pack Sizes: 100 mg; 250 mg. Product ID: HY-B1247. | |
| Protoporphyrin IX cobalt chloride | Protoporphyrin IX cobalt chloride. Alternative Names: Protoporphyrin IX cobalt chloride;102601-60-5;Co(iII) protoporphyrin ix chloride. CAS No. 102601-60-5. Product ID: ACM102601605. Molecular formula: C34H32ClCoN4O4. Mole weight: 655.037g/mol. IUPAC Name: 3-[18-(2-carboxyethyl)-7,12-bis(ethenyl)-3,8,13,17-tetramethylporphyrin-21,23-diid-2-yl]propanoic acid;chlorocobalt(2+). Alfa Chemistry - ISO 9001:32057 Certified. |  |
| Protoporphyrin IX-d6 | Protoporphyrin IX-d6 is the labeled version of Protoporphyrin IX (CAS: 553-12-8). Protoporphyrin IX (PPIX) is ubiquitously present in all living cells in small amounts as a precursor of heme and PPIX-based strategies have been used for cancer diagnosis and treatment. It can be used in biological study for role of protoporphyrin IX in skin photosensitivity, biliary stones, hepatobiliary damage, liver failure and cancer diagnosis and treatment in human. Group: Biochemicals. Alternative Names: Protoporphyrin IX di-Me Ester-d6; 3,7,12,17-Tetramethyl-8,13-divinyldimethyl Ester 2,18-Porphinedipropionic Acid-d6. Grades: Highly Purified. CAS No. 553-12-8 Unlabeled. Pack Sizes: 500ug, 2.5mg. Molecular Formula: C??H??D?N?O?, Molecular Weight: 596.75. US Biological Life Sciences. | Worldwide |
| Protoporphyrin IX dimethyl ester | Protoporphyrin IX dimethyl ester. Alternative Names: Dimethyl 3,3'-(3,8,13,17-Tetramethyl-7,12-divinylporphyrin-2,18-diyl)dipropionate. CAS No. 5522-66-7. Purity: >95.0%. Product ID: FFC-AR-5522667. Molecular formula: C36H38N4O4. Mole weight: 590.71. IUPAC Name: methyl 3-[8,13-bis(ethenyl)-18-(3-methoxy-3-oxopropyl)-3,7,12,17-tetramethyl-22,23-dihydroporphyrin-2-yl]propanoate. Alfa Chemistry - ISO 9001:32057 Certified. | |
| Protoporphyrin IX (Standard) | Protoporphyrin IX (Standard) is the analytical standard of Protoporphyrin IX. This product is intended for research and analytical applications. Protoporphyrin IX is a final intermediate in the heme biosynthetic pathway, which acts as a radiation sensitizer enhancing ROS generation even in a hypoxic state and inducing DNA damage. Protoporphyrin IX also acts as a photo sensitizer undergoing photobleaching that occurs through direct degradation by light irradiation. Protoporphyrin IX is formed and accumulated following 5-aminolevulinic acid (5-ALA) (HY-W000450) administration in the tumor cells of rats. Protoporphyrin IX causes selective improvement of basal cell carcinoma when activated red fluorescence of a peak wavelength at 405 nm. Protoporphyrin IX is promising for research of sonodynamic and photodynamic agents for a wide range of cancers, such as bladder cancer and nodular basal cell carcinoma[1][2][3][4][5]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: PPIX (Standard). CAS No. 553-12-8. Pack Sizes: 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-B1247R. | |
| protoporphyrinogen IX dehydrogenase (menaquinone) | This enzyme enables Escherichia coli to synthesize heme in both aerobic and anaerobic environments. Group: Enzymes. Synonyms: HemG. Enzyme Commission Number: EC 1.3.5.3. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1387; protoporphyrinogen IX dehydrogenase (menaquinone); EC 1.3.5.3; HemG. Cat No: EXWM-1387. | |
| protoporphyrinogen oxidase | This is the last common enzyme in the biosynthesis of chlorophylls and heme. Two isoenzymes exist in plants: one in plastids and the other in mitochondria. This is the target enzyme of phthalimide-type and diphenylether-type herbicides. The enzyme from oxygen-dependent species contains FAD. Also slowly oxidizes mesoporphyrinogen IX. Group: Enzymes. Synonyms: protoporphyrinogen IX oxidase; protoporphyrinogenase; PPO; Protox; HemG; HemY. Enzyme Commission Number: EC 1.3.3.4. CAS No. 53986-32-6. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1378; protoporphyrinogen oxidase; EC 1.3.3.4; 53986-32-6; protoporphyrinogen IX oxidase; protoporphyrinogenase; PPO; Protox; HemG; HemY. Cat No: EXWM-1378. | |
| PROTO_PROSY Protonectin | PROTO_PROSY Protonectin is an antimicrobial peptide found in Protonectarina sylveirae (Brazilian wasp), and has antibacterial activity against both gram-positive and gram-negative bacteria. It shows potent histamine releasing activities on rat peritoneal mast cells. Synonyms: Ile-Leu-Gly-Thr-Ile-Leu-Gly-Leu-Leu-Lys-Gly-Leu; Protonectin. Grade: ≥96%. Molecular formula: C58H107N13O14. Mole weight: 1210.57. | |
| Protopseudohypericin | Protopseudohypericin. Group: Biochemicals. Grades: Plant Grade. CAS No. 54328-09-5. Pack Sizes: 10mg. Molecular Formula: C30H18O9, Molecular Weight: 522.46. US Biological Life Sciences. | Worldwide |
| Protosappanin B | Protosappanin B. Group: Biochemicals. Grades: Plant Grade. CAS No. 102036-29-3. Pack Sizes: 20mg. Molecular Formula: C16H16O6, Molecular Weight: 304.3. US Biological Life Sciences. | Worldwide |
| Protosappanin B | Protosappanin B is a natural compound found in the heart wood of Caesalpinia sappan L. Protosappanin B exhibits antitumor and anti-oxidant activity that can inhibit the oxidation of linoleic acid. Uses: Antitumor, anti-oxidant. Synonyms: (-)-Protosappanin B; 6H-Dibenz[b,d]oxocin-3,7,10,11-tetrol, 7,8-dihydro-7-(hydroxymethyl)-, (7S,12aS)-. Grade: >95%. CAS No. 102036-29-3. Molecular formula: C16H16O6. Mole weight: 304.30. | |
| protostadienol synthase | (17Z)-Protosta-17(20),24-dien-3β-ol is a precursor of the steroidal antibiotic helvolic acid. Group: Enzymes. Synonyms: PdsA; (S)-2,3-epoxysqualene mutase [cyclizing, (17Z)-protosta-17(20),24-dien-3β-ol-forming]. Enzyme Commission Number: EC 5.4.99.32. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5573; protostadienol synthase; EC 5.4.99.32; PdsA; (S)-2,3-epoxysqualene mutase [cyclizing, (17Z)-protosta-17(20),24-dien-3β-ol-forming]. Cat No: EXWM-5573. | |
| Protostemonine | Botanical Source: Group: Biochemicals. Grades: Plant Grade. CAS No. 27495-40-5. Pack Sizes: 10mg, 20mg. US Biological Life Sciences. | Worldwide |
| Protostemotinine | Formula: Group: Biochemicals. Grades: Plant Grade. CAS No. 169534-85-4. Pack Sizes: 5mg, 10mg. US Biological Life Sciences. | Worldwide |
| Protriptyline-d3 Hydrochloride | Protriptyline-d3 Hydrochloride. Group: Biochemicals. Alternative Names: N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propanamine-d3 Hydrochloride; N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propanamine-d3 Hydrochloride; N-Methyl-5H-Dibenzo[a, d]cycloheptene-5-propylamine-d3 Hydrochloride; Concordin-d3; MK-240-d3; Maximed-d3; Maximet-d3; N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propylamine-d3 Hydrochloride; Normethyl EX4442-d3; Protriptyline-d3 Hydrochloride; Protryptyline-d3 Hydrochloride; Triptil-d3 Hydrochloride; Vivactil-d3 Hydrochloride. Grades: Highly Purified. CAS No. 1435934-21-6. Pack Sizes: 1mg. Molecular Formula: C19H19D3ClN, Molecular Weight: 302.86. US Biological Life Sciences. | Worldwide |
| Protriptyline hydrochloride | Protriptyline hydrochloride is a potent tricyclic antidepressant (TCA). Protriptyline hydrochloride inhibits AChE activity with an IC50 value of 0.06 mM and inhibits Aβ self-assembly. Protriptyline hydrochloride can be used for the study of depression and Alzheimers disease[1][2][3]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1225-55-4. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 250 mg. Product ID: HY-B0949. | |
| Protriptyline Hydrochloride | Protriptyline hydrochloride is a secondary amine tricyclic antidepressant with activating properties, unlike the sedating effects of other TCAs. It is one of the least sedating agents in its class. The drug has a long half-life and is typically dosed once or twice daily. Applications: Protriptyline is indicated for major depressive disorder, particularly in patients with psychomotor retardation, apathy, or anergy. it is also used off-label for narcolepsy (to reduce cataplexy and excessive daytime sleepiness) and for attention-deficit/hyperactivity disorder (adhd) in children. Category: Active pharmaceutical ingredients. Synonyms: Protriptyline HCl; Concordin; Maximed; Triptil hydrochloride; MK-240; NSC-169912; DTXSID8046951. CAS No. 1225-55-4. Product ID: API0231626. Molecular formula: C19H22ClN. Mole weight: 299.8. EINECS: 214-956-3. InChIKey: OGQDIIKRQRZXJH-UHFFFAOYSA-N. Appearance: White to off-white powder. |  |
| Protriptyline Hydrochloride | Protriptyline Hydrochloride. Group: Biochemicals. Alternative Names: N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propanamine Hydrochloride; N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propanamine Hydrochloride; N-Methyl-5H-Dibenzo[a, d]cycloheptene-5-propylamine Hydrochloride; Concordin; MK-240; Maximed; Maximet; N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propylamine Hydrochloride; Normethyl EX4442; Protriptyline hydrochloride; Protryptyline Hydrochloride; Triptil Hydrochloride; Vivactil Hydrochloride. Grades: Highly Purified. CAS No. 1225-55-4. Pack Sizes: 50mg. Molecular Formula: C19H22ClN, Molecular Weight: 299.839999999999. US Biological Life Sciences. | Worldwide |
| Pro-Trp-OH | Pro-Trp-OH. Synonyms: L-Prolyl-L-tryptophan; Pro Trp OH. Grade: ≥ 99% (TLC). CAS No. 35310-39-5. Molecular formula: C16H19N3O3. Mole weight: 301.35. | |
| Pro-Trp-OH | Pro-Trp-OH. Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 100mg, 250mg. US Biological Life Sciences. | Worldwide |
| ProTx I | ProTx I. Group: Biochemicals. Grades: Purified. CAS No. 484598-35-8. Pack Sizes: 100ug. US Biological Life Sciences. | Worldwide |
| ProTx I | ProTx I, a toxin that was originally isolated from the venom of Thrixopelma pruriens (Peruvian green velvet tarantula), blocks native mouse CaV3.1 channel and recombinant human CaV3.1 channel currents similarly, and blocks to a lesser extent CaV3.2 and CaV3.3 channel currents. Synonyms: ProTxI; ProTx-I; H-Glu-Cys(1)-Arg-Tyr-Trp-Leu-Gly-Gly-Cys(2)-Ser-Ala-Gly-Gln-Thr-Cys(3)-Cys(1)-Lys-His-Leu-Val-Cys(2)-Ser-Arg-Arg-His-Gly-Trp-Cys(3)-Val-Trp-Asp-Gly-Thr-Phe-Ser-OH; L-alpha-glutamyl-L-cysteinyl-L-arginyl-L-tyrosyl-L-tryptophyl-L-leucyl-glycyl-glycyl-L-cysteinyl-L-seryl-L-alanyl-glycyl-L-glutaminyl-L-threonyl-L-cysteinyl-L-cysteinyl-L-lysyl-L-histidyl-L-leucyl-L-valyl-L-cysteinyl-L-seryl-L-arginyl-L-arginyl-L-histidyl-glycyl-L-tryptophyl-L-cysteinyl-L-valyl-L-tryptophyl-L-alpha-aspartyl-glycyl-L-threonyl-L-phenylalanyl-L-serine (2->16),(9->21),(15->28)-tris(disulfide). Grade: >98%. CAS No. 484598-35-8. Molecular formula: C171H245N53O47S6. Mole weight: 3987.51. | |
| ProTx-I | ProTx-I is a toxin derived from Thrixopelma pruriens and a peptide inhibitor targeting TTX-resistant sodium channels. ProTx-I interacts with voltage sensors of multiple domains such as NaV1.7, reduces neuronal excitability through allosteric modulation of channel gating and alteration of voltage dependence. The IC50 values of ProTx-I against human NaV1.7, NaV1.2, NaV1.6, and NaV1.5 are 95 nM, 104 nM, 21 nM, and 358 nM, respectively; ProTx-I also potently inhibits Ba2+ currents of hCav3.1, while its inhibitory potency against hCav3.2 is approximately 160-fold lower. ProTx-I is applicable to the research of chronic pain[1][2][3]. Uses: Scientific research. Category: Signaling pathways. CAS No. 484598-35-8. Pack Sizes: 100 μg; 500 μg; 1 mg; 5 mg. Product ID: HY-P1073. | |
| ProTx II | ProTx II. Group: Biochemicals. Grades: Purified. CAS No. 484598-36-9. Pack Sizes: 100ug. US Biological Life Sciences. | Worldwide |
| ProTx II | ProTx II is a selective NaV1.7 channel blocker with 100-fold selectivity over other sodium channel subtypes. Synonyms: YCQKWMWTCDSERKCCEGMVCRLWCKKKLW. Grade: >98%. CAS No. 484598-36-9. Molecular formula: C168H250N46O41S8. Mole weight: 3826.59. | |
| ProTx III | ProTx III, isolated from the venom of the Peruvian green-velvet tarantula Thrixopelma pruriens, is a potent Nav1.7 blocker (IC50 = 2.5 nM) and also inhibits Nav1.1, Nav1.2, Nav1.3 and Nav1.6 in the nanomolar range. Synonyms: DCLKFGWKCNPRNDKCCSGLKCGSNHNWCKLHI. Grade: >98%. Molecular formula: C162H246N52O43S6. Mole weight: 3802.41. | |
| Pro-Tyr-OH | Pro-Tyr-OH. Synonyms: L-Prolyl-L-tyrosine; Pro Tyr OH. Grade: ≥ 99% (Assay). CAS No. 19786-36-8. Molecular formula: C14H18N2O4. Mole weight: 278.31. | |
| Pro-Tyr-OH | Pro-Tyr-OH. Group: Biochemicals. Alternative Names: L-Prolyl-L-tyrosine. Grades: Highly Purified. CAS No. 19786-36-8. Pack Sizes: 100mg. US Biological Life Sciences. | Worldwide |
| Pro-Urokinase from Human, recombinant | Urokinase or Urokinase-type plasminogen activator (uPA) is a serine protease (EC 3.4.21.73). It is secreted as a single-chain zymogen, pro-Urokinase, possessing little or no intrinsic enzymatic activity. The single chain zymogen is converted into the active two chain enzyme (tcuPA) by cleavage of the bond between Lys157 and Ile158. After activation, Urokinase specifically cleaves the proenzyme plasminogen to form the active enzyme plasmin. The active plasmin then catalyzes the breakdown of fibrin polymers of blood clots. Urokinase is involved in a number of biological functions including fibrinolysis, embryogenesis, cell migration, tissue remodeling, ovulation, and wound healing. Additionally, it is a potent marker of invasion and metastasis in a variety of human cancers associated with breast, stomach, colon, bladder, ovary, brain and endometrium. Group: Enzymes. Synonyms: Single chain Urokinase-type plasminogen activator; s. Purity: > 90% by SDS-PAGE. Pro-Urokinase. Mole weight: 49.3 kDa. Activity: >1200 mU/mg. Storage: Stable at -80°C for at least 1 year as supplied. Store reconstituted aliquots at -80°C. Avoid repeated freeze and thaw cycles. Form: Lyophilized powder. Source: E. coli. Species: Human. Single chain Urokinase-type plasminogen activator; scuPA; Urokinase-type Plasminogen Activator uPA; PLAU; Pro-Urokinase. Cat No: NATE-1689. | |
| Provean impurity 1 | Provean impurity 1. Uses: For analytical and research use. CAS No. 1932478-97-1. Molecular formula: C9H15NO2. Mole weight: 169.22. Catalog: APB1932478971. |  |
| Provean impurity 10 | Provean impurity 10. Uses: For analytical and research use. Molecular formula: C7H14ClN3O2. Mole weight: 207.66. Catalog: APB09234. | |
| Provean impurity 11 | Provean impurity 11. Uses: For analytical and research use. Molecular formula: C12H20N3O4-. Mole weight: 270.31. Catalog: APB09235. | |
| Provean impurity 12 | Provean impurity 12. Uses: For analytical and research use. CAS No. 2889532-79-8. Molecular formula: C7H14ClN3O2. Mole weight: 207.66. Catalog: APB2889532798. | |
| Provean impurity 2 | Provean impurity 2. Uses: For analytical and research use. CAS No. 1932411-98-7. Molecular formula: C9H15NO2. Mole weight: 169.22. Catalog: APB1932411987. | |
| Provean impurity 3 | Provean impurity 3. Uses: For analytical and research use. Molecular formula: C23H32F3N5O4. Mole weight: 499.54. Catalog: APB09229. | |
| Provean impurity 4 | Provean impurity 4. Uses: For analytical and research use. CAS No. 2755812-41-8. Molecular formula: C23H32F3N5O4. Mole weight: 499.54. Catalog: APB2755812418. | |
| Provean impurity 5 | Provean impurity 5. Uses: For analytical and research use. CAS No. 2628280-47-5. Molecular formula: C7H13N3O2. Mole weight: 171.2. Catalog: APB2628280475. | |
| Provean impurity 6 | Provean impurity 6. Uses: For analytical and research use. Molecular formula: C7H13N3O2. Mole weight: 171.2. Catalog: APB09230. | |
| Provean impurity 7 | Provean impurity 7. Uses: For analytical and research use. Molecular formula: C7H13N3O2. Mole weight: 171.2. Catalog: APB09232. | |
| Provean impurity 8 | Provean impurity 8. Uses: For analytical and research use. Molecular formula: C15H22N2O6S. Mole weight: 358.41. Catalog: APB09231. | |
| Provean impurity 9 | Provean impurity 9. Uses: For analytical and research use. Molecular formula: C7H12N2O3. Mole weight: 172.18. Catalog: APB09233. | |
| Provichem 0216 | Provichem 0216. | |
| Provichem 1102 | Provichem 1102. | |
| Provigil | Provigil. CAS No: 68693-11-8 |  Sarchem Laboratories New Jersey NJ |
| Proviplast 17820 | Proviplast 17820. | |
| Proviplast 1784 | Proviplast 1784. | |
| Pro Vitamin A 10% (Beta Carotene 10%) | Pro Vitamin A 10% (Beta Carotene 10%) - Agriculture Chemicals. SUPPLIERS TO BUSINESS CUSTOMERS ONLY. |  North America & APAC |
| Pro-X dipeptidase | Transferred to EC 3.4.13.18. Group: Enzymes. Enzyme Commission Number: EC 3.4.13.8. CAS No. 9025-33-6. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4041; Pro-X dipeptidase; EC 3.4.13.8; 9025-33-6. Cat No: EXWM-4041. | |
| Proxyfan oxalate | Proxyfan oxalate. Group: Biochemicals. Grades: Purified. CAS No. 177708-09-7. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| Pro-xylane | Hydroxypropyl tetrahydropyrantriol has been used in trials studying the basic science of Aging. Category: Cosmetic ingredients and additives. Synonyms: Hydroxypropyl tetrahydropyrantriol. Mexoryl SBB. Pro-xylane (pharmaceutical). CAS No. 439685-79-7. Product ID: CIA439685797. Molecular formula: C8H16O5. Mole weight: 192.21. SMILES: CC(CC1C(C(C(CO1)O)O)O)O. Appearance: White to off-white powder. Standard: In-house. | |
| Proxylphylline | Proxylphylline. Group: Biochemicals. Grades: Highly Purified. CAS No. 603-00-9. Pack Sizes: 25g, 50g, 100g. US Biological Life Sciences. | Worldwide |
| Proxymetacaine hydrochloride | Proxymetacaine hydrochloride. CAS No. 5857-6-9. Product ID: ACM1445426. Alfa Chemistry - ISO 9001:32057 Certified. | |
| PrP 106-126 (human) | Prion Protein 106-126 (human), a peptide fragment of the cellular prion protein PrP, is used as a model to investigate neurodegeneration in prion diseases. It exhibits neurotoxicity caused by amplification of PrPC-associated signaling responses and induces NF-κB-mediated apoptosis in the mouse neuroblastoma cell line N2a. Synonyms: Prion Protein Fragment 106-126 Human; Prion Protein 106-126 (human); Lys-Thr-Asn-Met-Lys-His-Met-Ala-Gly-Ala-Ala-Ala-Ala-Gly-Ala-Val-Val-Gly-Gly-Leu-Gly; L-lysyl-L-threonyl-L-asparagyl-L-methionyl-L-lysyl-L-histidyl-L-methionyl-L-alanyl-glycyl-L-alanyl-L-alanyl-L-alanyl-L-alanyl-glycyl-L-alanyl-L-valyl-L-valyl-glycyl-glycyl-L-leucyl-glycine. Grade: ≥95%. CAS No. 148439-49-0. Molecular formula: C80H138N26O24S2. Mole weight: 1912.24. | |
| PRRSV/CD163-IN-1 | PRRSV/CD163-IN-1 is a PRRSV/CD163 inhibitor. PRRSV/CD163-IN-1 can inhibit the interaction between the PRRSV glycoprotein (GP2a or GP4) and the CD163-SRCR5 domain. PRRSV/CD163-IN-1 can be used for the research of porcine reproductive and respiratory syndrome (PRRS) [1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 560995-89-3. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-147089. | |
| PRT-060318 | PRT-060318 (PRT318) s a potent, selective and orally active tyrosine kinase Syk inhibitor with an IC50 of 3 nM. PRT-060318 suppresses chronic lymphocytic leukemia (CLL) B cell activation and migration, and induces apoptosis. PRT-060318 prevents Heparin (HY-17567)-induced thrombocytopenia and thrombosis in a transgenic mouse model. PRT-060318 dihydrochloride can be used for CLL and thrombus research[1][2]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: PRT318. CAS No. 1194961-19-7. Pack Sizes: 10 mM * 1 mL in Water; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-12974. | |
| PRT062607 | PRT062607 (P505-15; PRT-2607) is an orally active ATP-competitive Syk inhibitor with an IC50 value of 1 nM, and exhibits at least 80-fold selectivity over other kinases. PRT062607 blocks B cell antigen receptor-mediated activation, Fcε receptor 1-mediated basophil degranulation and microglial phagocytosis, and induces caspase-dependent apoptosis and microglial death. PRT062607 inhibits tumor growth and peripheral nerve injury-induced mechanical allodynia, and prevents neuronal loss. PRT062607 can be used in research related to rheumatoid arthritis, chronic lymphocytic leukemia, non-Hodgkin's lymphoma, neurodegenerative diseases and neuropathic pain[1][2][3][4]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: P505-15; PRT-2607; BIIB-057. CAS No. 1370261-96-3. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15322. | |
| PRT062607 Hydrochloride | PRT062607 (P505-15) Hydrochloride is an orally available Syk inhibitor (IC50: 1 nM) that inhibits inflammation and induction Apoptosis. PRT062607 Hydrochloride exerts potent antitumor activity in tumor xenograft mouse models[1][2]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: P505-15 Hydrochloride. CAS No. 1370261-97-4. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15323. | |
| PRT3789 | PRT3789 is a selective SMARCA2 PROTAC degrader (DC50 in HeLa cell: 0.72 nM for SMARCA2, 14 nM for SMARCA4). PRT3789 forms a stable ternary complex with Von Hippel-Lindau (VHL) E3 ligase, induces polyubiquitination at SMARCA2-specific lysine residues, and drives proteasome-dependent SMARCA2 degradation. PRT3789 disrupts SWI/SNF chromatin remodeling complex integrity, induces dissociation of specific subunits, suppresses oncogenic gene expression, reduces chromatin accessibility, and upregulates antigen processing/presentation-related gene expression. PRT3789 induces synthetic lethality, inhibits proliferation and colony formation, and drives tumor growth inhibition and regression in SMARCA4-deficient contexts. PRT3789 can be used for the research of SMARCA4-mutated solid tumors, non-small cell lung cancer, endometrial cancer, colorectal cancer, bladder cancer, esophageal cancer, ovarian cancer, and gastric cancer[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2755761-78-3. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-159607. | |
| PRT4165 | PRT4165 is a potent inhibitor of polycomb-repressive complex 1 (PRC1)-mediated H2A ubiquitylation. Uses: Scientific research. Category: Signaling pathways. Alternative Names: NSC600157. CAS No. 31083-55-3. Pack Sizes: 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-19817. | |
| PRT 4165 | PRT 4165. Group: Biochemicals. Grades: Purified. CAS No. 31083-55-3. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
Our database is helping our users find suppliers everyday.
