A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| p53 and MDM2 proteins-interaction-inhibitor (chiral) | p53 and MDM2 proteins-interaction-inhibitor (chiral) (Compound 32) is an inhibitor of the interaction between p53 and MDM2 proteins. Uses: Scientific research. Category: Signaling pathways. CAS No. 939981-37-0. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-70027. |  |
| p53 Antibody [F16A10] | p53,p53 (pantropic),TP53. Group: Antibodies. Alternative Names: p53,TP53. Pack Sizes: 20uL. Product ID: F0020. Storage Conditions: -20°C (avoid freeze-thaw cycles), 2 years. |  United States; Europe |
| P53R3 | P53R3 is a potent p53 reactivator and restores sequence-specific DNA binding of p53 hot spot mutants, including p53R175H, p53R248W and p53R273H. P53R3 induces p53-dependent antiproliferative effects with much higher specificity than PRIMA-1. P53R3 enhances the recruitment of wild-type p53 and p53M237I to several target gene promoters. P53R3 strongly enhances the mRNA, total protein and cell surface expression of the death receptor death receptor 5 (DR5). P53R3 is used for cancer research[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 922150-12-7. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-122578. | |
| P57 | P57. CAS No. 384329-61-7. Molecular formula: C47H74O15. Mole weight: 879.08. |  |
| p5 Ligand for Dnak and DnaJ | It is a high affinity ligand for DnaK and DnaJ and corresponds to the main binding site of the 23 residues part of the prosequence of mitochondrial aspartate aminotransferase. Alternative Names: Peptide p5; H-Cys-Leu-Leu-Leu-Ser-Ala-Pro-Arg-Arg-OH; L-cysteinyl-L-leucyl-L-leucyl-L-leucyl-L-seryl-L-alanyl-L-prolyl-L-arginyl-L-arginine; 2-[(2S)-2-({[(2S)-1-{N-[(2S,5S,8S,11S,14R)-14-Amino-1,4,7,10,13-pentahydroxy-2-(hydroxymethyl)-5,8,11-triisobutyl-15-sulfanyl-3,6,9,12-tetraazapentadeca-3,6,9,12-tetraen-1-ylidene]-L-alanyl}-2-pyrrolidinyl](hydroxy)methylene}amino)-5-carbamimidamido-1-hydroxypentylidene]-L-arginine. Grades: ≥95%. CAS No. 209518-24-1. Molecular formula: C44H81N15O11S. Mole weight: 1028.27. | |
| p5 Ligand for Dnak and DnaJ acetate | p5 Ligand for Dnak and DnaJ acetate is a high-affinity ligand for DnaK (E. coli Hsp70) and DnaJ (E. coli Hsp40) and corresponds to the main binding site of the 23 residues part of the prosequence of mitochondrial aspartate aminotransferase. Alternative Names: H-Cys-Leu-Leu-Leu-Ser-Ala-Pro-Arg-Arg-OH.CH3CO2H; L-Cysteinyl-L-leucyl-L-leucyl-L-leucyl-L-seryl-L-alanyl-L-prolyl-L-arginyl-L-arginine acetate salt; L-cysteinyl-L-leucyl-L-leucyl-L-leucyl-L-seryl-L-alanyl-L-prolyl-L-arginyl-L-arginine acetic acid. Grades: ≥95%. CAS No. 2803415-96-3. Molecular formula: C44H81N15O11S.C2H4O2. Mole weight: 1088.33. | |
| P5(PEG24)-VC-PAB-Exatecan | P5 (PEG24)-VC-PAB-Exatecan is a TOP1 inhibitor payload with antibody-conjugation-dependent activity. Conjugation of P5 (PEG24)-VC-PAB-Exatecan with Trastuzumab (HY-P9907) generates a DAR8 antibody-drug conjugate (ADCs) with antibody-like pharmacokinetic properties. P5 (PEG24)-VC-PAB-Exatecan induces S-phase and G2-M-phase cell cycle arrest, DNA damage and apoptosis in target-positive tumor cells, and releases damage-associated molecular patterns (DAMP) related to immunogenic cell death (ICD). The ADCs prepared from it exert bystander killing effects on non-target tumor cells. ADCs based on P5 (PEG24)-VC-PAB-Exatecan exhibit linker stability in vitro and in vivo, show in vivo efficacy, and can be used in research related to HER2-positive cancers[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2928571-43-9. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-163099. | |
| P62-mediated mitophagy inducer | P62-mediated mitophagy inducer (PMI) is a P62-mediated mitophagy activator. P62-mediated mitophagy inducer activates mitochondrial autophagy without recruitment of Parkin or collapse of the mitochondrial membrane potential and remains active in cells lacking a fully functional PINK1/Parkin pathway. P62-mediated mitophagy inducer serves as a pharmacological tool to study the molecular mechanisms of mitosis, avoiding toxicity and some of the non-specific effects associated with the sudden dissipation of mitochondria lacking membrane potential[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1809031-84-2. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-115576. | |
| P62-RNF168 agonist-1 | P62-RNF168 agonist-1 (compound 5a) is a low cytotoxicity P62-RNF168 agonist that enhances the interaction between P62 and RNF168. P62-RNF168 agonist-1 induces a reduction in H2A ubiquitination mediated by RNF168 and impairs homologous recombination-mediated DNA repair. P62-RNF168 agonist-1 also inhibits the growth of xenograft tumors in mice in a dose-dependent manner[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2765180-17-2. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-151799. | |
| p70 S6 Kinase Antibody [D7E4] | p70 S6 Kinase,p70 S6 kinase α,p70 S6 kinase/S6K1,S6K1. Group: Antibodies. Alternative Names: p70 S6 Kinase,p70 S6 kinase α,p70 S6 kinase/S6K1,S6K1. Pack Sizes: 20uL. Product ID: F0011. Storage Conditions: -20°C (avoid freeze-thaw cycles), 2 years. | United States; Europe |
| P-725C | P-725C is a prostaglandin synthetase inhibitor produced by Penicillum thomii. Alternative Names: 6-Hydroxy-2-methyl-5-(1-oxopropyl)-2H-1,4-oxazine-3-carboxylic acid. CAS No. 87979-96-2. Molecular formula: C9H11NO5. Mole weight: 213.19. | |
| P7C3 | P7C3 is a proneurogenic and neuroprotective agent that activates NAMPT. P7C3 protects neurons from apoptosis and promotes neurogenesis in mice. It also improves cognitive function and memory in aged mice. Alternative Names: 1-Anilino-3-(3,6-dibromocarbazol-9-yl)propan-2-ol; 1-(3,6-Dibromo-carbazol-9-yl)-3-phenylamino-propan-2-ol; 1-(3,6-dibromo-9H-carbazol-9-yl)-3-(phenylamino)propan-2-ol; 1-(3,6-dibromocarbazol-9-yl)-3-(phenylamino)propan-2-ol. Grades: >98%. CAS No. 301353-96-8. Molecular formula: C21H18Br2N2O. Mole weight: 474.196. | |
| P7C3 | P7C3. Group: Biochemicals. Grades: Purified. CAS No. 301353-96-8. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. |  Worldwide |
| P7C3-A20 | P7C3-A20. Group: Biochemicals. Alternative Names: N-(3-(3,6-Dibromo-9H-carbazol-9-yl)-2-fluoropropyl)-3-methoxyaniline. Grades: Highly Purified. CAS No. 1235481-90-9. Pack Sizes: 100mg, 250mg, 500mg, 1g. US Biological Life Sciences. | Worldwide |
| P7C3-A20 | P7C3-A20, an analogue of P7C3, is a neuroprotective compound which inhibits mature neuronal cell death while also increasing the net magnitude of postnatal neurogenesis in models of neurodegeneration and acute injury. Alternative Names: N-(3-(3,6-dibromo-9H-carbazol-9-yl)-2-fluoropropyl)-3-methoxyaniline; P7C-3A20; P7C3A20; P7C 3A20. CAS No. 1235481-90-9. Molecular formula: C22H19Br2FN2O. Mole weight: 506.21. | |
| P7C3-A20 | P7C3-A20 is a derivative of P7C3 with potent proneurogenic and neuroprotective activity. P7C3-A20 exerts an antidepressant-like effect. P7C3-A20 can cross the blood-brain barrier and therefore has the potential for brain injury treatment[1][2][3]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1235481-90-9. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15978. | |
| P9 | P9 is an antimicrobial peptide found in Cervus elaphus (New Zealand red deer), and has antibacterial activity. Grades: >98%. | |
| PA-1329-E1 | PA-1329-E1 is a nucleoside antibiotic produced by Micromonospora sp. PA-1329. It exhibits activity against Candida albicans. Alternative Names: Antibiotic PA-1329-E1. CAS No. 80860-79-3. Molecular formula: C15H23N7O5. Mole weight: 381.39. | |
| PA22-2 | PA22-2 (IKVAV sequence; Laminin A-chain fragment) is a biological active peptide. (This peptide is derived from mouse laminin a1. Cell matrix substrate constituted with this peptide can promote neurite outgrowth.). Uses: Scientific research. Category: Peptides. Alternative Names: IKVAV sequence; Laminin A-chain fragment. CAS No. 131435-36-4. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P5353. | |
| PA (224-233), Influenza | PA (224-233), Influenza, a 10-aa peptide, is a fragment of polymerase 2 protein in influenza A virus. Alternative Names: Ser-Ser-Leu-Glu-Asn-Phe-Arg-Ala-Tyr-Val; L-seryl-L-seryl-L-leucyl-L-alpha-glutamyl-L-asparagyl-L-phenylalanyl-L-arginyl-L-alanyl-L-tyrosyl-L-valine. Grades: ≥95%. CAS No. 271573-27-4. Molecular formula: C53H80N14O17. Mole weight: 1185.29. | |
| PA-31088-II | PA-31088-II is a carbapenem antibiotic produced by Streptomyces tokunonensis PA-31088 and Str. argenteolus PA-39504. Molecular formula: C13H16N2O6S. Mole weight: 328.34. | |
| PA-32413-I | PA-32413-I is a beta-lactam antibiotic produced by Streptomyces clavuigerus PA-32413. It is active against gram-positive and gram-negative bacteria. Alternative Names: PA-32413 I; PA 32413 I. Molecular formula: C18H25N5O10S. Mole weight: 503.48. | |
| PA452 | PA452, retinoic X receptor (RXR) specific antagonist, inhibits the effect of Retinoic acid (RA) on Th1/Th2 development[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 457657-34-0. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-108522. | |
| PA 452 | PA 452 is a RXR antagonist. It can attenuate cell proliferation and induce apoptosis in MCF-7 breast cancer cells. Alternative Names: PA-452; PA 452; PA452; 2-[[3-(Hexyloxy)-5,6,7,8-tetrahydro-5,5,8,8-tetramethyl-2-naphthalenyl]methylamino]-5-pyrimidinecarboxylic acid. Grades: ≥98% by HPLC. CAS No. 457657-34-0. Molecular formula: C26H37N3O3. Mole weight: 439.59. | |
| PA 452 | PA 452. Group: Biochemicals. Grades: Purified. CAS No. 457657-34-0. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| PA-46101 A | PA-46101 A is a macrolide antibiotic isolated from the culture broth of Streptomyces sp. PA-46101. It is active in vitro against anaerobic Gram-positive and Gram-negative bacteria and also against a limited number of aerobic Gram-positive bacteria. Alternative Names: PA 46101 A. CAS No. 130743-11-2. Molecular formula: C52H70O18. Mole weight: 983.1. | |
| PA-46101 B | PA-46101 B is a macrolide antibiotic isolated from the culture broth of Streptomyces sp. PA-46101. It is active in vitro against anaerobic Gram-positive and Gram-negative bacteria and also against a limited number of aerobic Gram-positive bacteria. Alternative Names: PA 46101 B. CAS No. 130812-34-9. Molecular formula: C61H86O22. Mole weight: 1171.3. | |
| PA-8 | PA-8 is a potent, selective and orally active PACAP type I (PAC1) receptor antagonist. PA-8 inhibits the phosphorylation of CREB induced by PACAP in PAC1-, but not VPAC1- or VPAC2-receptor. PA-8 also inhibits PACAP-induced cAMP elevation with an IC50 of 2 nM[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 878437-15-1. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-133529. | |
| PA-824 | PA-824, a bioreductive drug. PA-824 has potent in vitro activity against Mycobacterium tuberculosis. PA-824 was tested in vitro against a broad panel of multidrug-resistant clinical isolates and was found to be highly active against all isolates (MIC<1 microg/ml). PA-824 showed significant activity at 2, 10, and 50 microg/ml, similar to that of metronidazole, in a dose-dependent manner. Alternative Names: PA824; PA-824; PA 824; Pretomanid. Grades:>98%. CAS No. 187235-37-6. Molecular formula: C14H12F3N3O5. Mole weight: 359.26. | |
| PA-915 | PA-915 (PAC1R antagonist 1) is a potent and orally active antagonist of PAC1 receptor. PA-915 inhibits pituitary adenylate cyclase-activating polypeptide (PACAP)-induced CREB phosphorylation. PA-915 can inhibit PACAP- and nerve injury-induced allodynia. PA-915 can be used for the research of neuropathic pain[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: PAC1R antagonist 1. CAS No. 2305204-24-2. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-147557. | |
| Pa-AMP2 | Pa-AMP2 is an antimicrobial peptide found in pokeweed seeds, Phytolacca americana, and has anti-gram-positive bacteria and fungal activity. Alternative Names: Phytolacca americana antimicrobial peptide 2. Grades: >98%. | |
| PAβN dihydrochloride | PAβN dihydrochloride (MC-207110 dihydrochloride) is an efflux pump inhibitor. Uses: Scientific research. Category: Signaling pathways. Alternative Names: MC-207,110 dihydrochloride; Phe-Arg-β-naphthylamide dihydrochloride. CAS No. 100929-99-5. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 250 mg. Product ID: HY-101444A. | |
| PAβN dihydrochloride | PAβN dihydrochloride is an efflux pump inhibitor and a substrate for dipeptidyl aminopeptidase I (cathepsin C). Alternative Names: H-Phe-Arg-βNA.2HCl; Phe-Arg β-naphthylamide dihydrochloride. Grades: ≥ 99% (TLC). CAS No. 100929-99-5. Molecular formula: C25H32Cl2N6O2. Mole weight: 519.47. | |
| Pabinafusp alfa | Pabinafusp alfa (JR-141) is a transferrin receptor-targeting antibody consisting of Iduronate 2-sulfatase (HY-P76399) and an anti-human transferrin receptor antibody. Pabinafusp alfa is blood-brain permeable and prevents heparan sulfate (HS) deposition in the central nervous system of mucopolysaccharidosis II (MPS II) mice. Pabinafusp alfa improves learning and prevents central nervous system neuronal damage in mice[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: JR-141. CAS No. 2140211-48-7. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P99797. | |
| PAC 1 | PAC 1. Group: Biochemicals. Grades: Purified. CAS No. 315183-21-2. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| PAC-1 | PAC-1. Group: Biochemicals. Alternative Names: 4-(Phenylmethyl)-1-piperazineacetic Acid (2E) -2- [ [2-Hydroxy-3- (2-propen-1-yl) phenyl] methylene] hydrazide. Grades: Highly Purified. CAS No. 1044929-62-5. Pack Sizes: 10mg, 25mg, 50mg, 100mg, 250mg. Molecular Formula: C23H28N4O2. US Biological Life Sciences. | Worldwide |
| PAC-1 | PAC-1 is a procaspase-3 activator that induces apoptosis in cancer cells with an EC50 of 2.08 μM. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Procaspase activating compound 1. CAS No. 315183-21-2. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 500 mg. Product ID: HY-13523. | |
| PAC-113 | PAC-113 an anti-fungal, for the treatment of oral candidiasis infections. Molecular formula: C71H109N27O14. Mole weight: 1564.82. | |
| Pac-2-Amino-dA-CE Phosphoramidite | Pac-2-Amino-dA-CE Phosphoramidite, a necessary component of DNA synthesis, plays a vital role in the modification of oligonucleotides. Its indispensability lies in acting as a critical mediator in the development of DNA analogs, oligos and probes employed in manifold biomedical research. These investigations focus on understanding pathogenic conditions such as cancer, genetic disorders and infectious diseases, and Pac-2-Amino-dA-CE Phosphoramidite brings cutting-edge insights to these fields. Alternative Names: 5'-Dimethoxytrityl-N2-phenoxyacetyl-N6-di-n-butylaminomethylidene-2,6-diamino-2'-deoxypurine riboside-3'-[(2-cyanoethyl)-(N,N-diisopropyl)]-phosphoramidite. Molecular formula: C57H72N9O8P. Mole weight: 1042.21. | |
| Pacanalotamab | Pacanalotamab (AMG 420; BI-836909) is a bispecific T-cell engager (BiTE) targeting to BCMA and CD3E. BCMA refers to B cell maturation antigen, as Pacanalotamab redirecting T cells to BCMA expressing cells on the cell surface. Pacanalotamab conducts T-cell redirected lysis of human multiple myeloma (MM) cell lines[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: AMG 420; BI-836909. CAS No. 2251756-52-0. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P99798. | |
| PACAP (1-27), human, ovine, rat | Pituitary adenylate cyclase activating polypeptide (PACAP 1-27) is an endogenous neuropeptide showing considerable homology with vasoactive intestinal peptide (VIP). It is a potent PACAP receptor agonist. Alternative Names: PACAP 1-27; Pituitary Adenylate Cyclase Activating Polypeptide1-27; H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucinamide. Grades: ≥98% by HPLC. CAS No. 127317-03-7. Molecular formula: C142H224N40O39S. Mole weight: 3147.60. | |
| PACAP (1-27), human, ovine, rat | PACAP (1-27), human, ovine, rat (PACAP 1-27) is the N-terminal fragment of PACAP-38, and is a potent PACAP receptor agonist with IC50s of 3 nM, 2 nM and 5 nM for rat PAC1, rat VPAC1 and human VPAC2, respectively[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: PACAP 1-27. CAS No. 127317-03-7. Pack Sizes: 500 μg; 1 mg; 5 mg; 10 mg. Product ID: HY-P0176. | |
| PACAP (1-27), human, ovine, rat acetate | PACAP (1-27), human, ovine, rat acetate is a neuropeptide originally isolated from the bovine hypothalamus, also found in humans and rats. It is a potent PACAP receptor agonist. Alternative Names: H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2.CH3CO2H; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucinamide acetic acid; Pituitary adenylate cyclase-activating peptide-27 (sheep) acetate. Grades: ≥95%. Molecular formula: C144H228N40O41S. Mole weight: 3207.71. | |
| PACAP (1-38) free acid | PACAP (1-38) free acid is a desamido-PACAP (1-38), human, ovine, rat (HY-P0221). PACAP (1-38) free acid can activate the human PAC1 receptor. PACAP (1-38) free acid induces cyclic AMP (cAMP) generation in both NS-1 neuroendocrine cells and non-neuroendocrine HEK293 cells[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 129405-61-4. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P0221C. | |
| PACAP (1-38), human, ovine, rat | PACAP 1-38, an endogenous neuropeptide, is a highly potent PACAP receptor agonist (Kd = 100 pM). It stimulates adenylate cyclase and phagocytosis. It is reported to serve as a neuronal survival factor. Alternative Names: PACAP 1-38; Pituitary Adenylate Cyclase-Activating Polypeptide 1-38; His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥99%. CAS No. 137061-48-4. Molecular formula: C203H331N63O53S. Mole weight: 4534.26. | |
| PACAP (1-38), human, ovine, rat | PACAP (1-38), human, ovine, rat is a PAC1 receptor agonist. PACAP (1-38), human, ovine, rat binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively. PACAP (1-38), human, ovine, rat increases the α-secretase activity. PACAP (1-38), human, ovine, rat elevates cytosolic Ca2+, increases proliferation and increases phosphorylation of extracellular regulates kinase (ERK) and the epidermal growth factor receptor (EGFR). PACAP (1-38), human, ovine, rat demonstrates potent, efficacious, and sustained stimulatory effects on sympathetic neuronal NPY and catecholamine production. PACAP (1-38), human, ovine, rat can be used for neurotrophic and neuroprotective research[1][2][3][4][5][6][7]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Pituitary Adenylate Cyclase Activating Polypeptide 38. CAS No. 137061-48-4. Pack Sizes: 500 μg; 1 mg; 5 mg. Product ID: HY-P0221. | |
| PACAP (1-38), human, ovine, rat TFA | PACAP (1-38), human, ovine, rat TFA, an endogenous neuropeptide, is a highly potent PACAP receptor agonist. It stimulates adenylate cyclase and phagocytosis. It is reported to serve as a neuronal survival factor. Alternative Names: Pituitary Adenylate Cyclase Activating Polypeptide 1-38 (TFA); His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2.TFA; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide trifluoroacetic acid. Grades: >98%. Molecular formula: C203H331N63O53S.C2HF3O2. Mole weight: 4648.28. | |
| PACAP-38 (16-38) (human, chicken, mouse, ovine, porcine, rat) | It has a strong, effective and sustained stimulating effect on the production of sympathetic NPY and catecholamines. PACAP is an effective activator of cAMP formation. Alternative Names: Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; Pituitary Adenylate Cyclase Activating Polypeptide-38 (16-38); PACAP-38 (16-38), human, mouse, rat; L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥95% by HPLC. CAS No. 144025-82-1. Molecular formula: C123H215N39O28S. Mole weight: 2720.33. | |
| PACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat) | PACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat) is distinguished as a bioactive peptide fragment. By binding and subsequently activating PAC1 receptors, it aids in the research of an array of ailments spanning neurodegenerative disorders to cardiovascular conditions. Alternative Names: H-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide; L-Lysinamide, glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparaginyl-. Grades: 95%. CAS No. 160489-86-1. Molecular formula: C61H110N24O14. Mole weight: 1403.68. | |
| PACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) | An activator of cAMP formation. It stimulates sympathetic neuronal NPY and catecholamine production. Alternative Names: PACAP-38 (31-38), human, mouse, rat; PACAP (31-38); Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥98%. CAS No. 138764-85-9. Molecular formula: C47H83N17O11. Mole weight: 1062.27. | |
| PACAP-38 (human, mouse, ovine, porcine, rat) | PACAP-38 (human, mouse, ovine, porcine, rat) is a multifunctional neuropeptide that interacts with PACAP receptors and vasoactive intestinal peptide receptors to enhance intracellular cyclic AMP levels and exert systemic effects. It is a PAC1 agonist that strongly increases α-secretase activity. Upregulation of the APP-degrading enzyme promotes non-amyloidogenic processing of APP by reducing Aβ40/42 production, and thus may contribute to the prevention of Alzheimer's disease. Intranasal application of PACAP-38 in APP[V717I]-transgenic mice promotes the production of Aβ-degrading enzyme neprilysin by inducing somatostatin. Alternative Names: Pituitary Adenylate Cyclase Activating Polypeptide-38 (human, mouse, ovine, porcine, rat); H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: 95%. CAS No. 124123-15-5. Molecular formula: C203H331N63O53S. Mole weight: 4534.32. | |
| PACAP (6-27) | PACAP 6-27 is a potent PACAP receptor antagonist. It induces insulin secretion by pancreatic beta cells. Alternative Names: H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2; L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucinamide; Pituitary Adenylate Cyclase-activating Peptide (6-27). Grades: ≥95%. CAS No. 136134-68-4. Molecular formula: C121H193N33O31S. Mole weight: 2638.09. | |
| PACAP (6-27) (human, ovine, rat) | PACAP (6-27) (human, ovine, rat) is a PACAP receptor antagonist that blocks the canine adrenal catecholamine response to exogenous vasoactive intestinal peptide (VIP). PACAP (6-27) (human, ovine, rat) has the potential to study cardiovascular and neurological diseases[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Pituitary adenylate cyclase-activating peptide (6-27). CAS No. 136134-68-4. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-P3117. | |
| PACAP 6-38 | PACAP 6-38. Group: Biochemicals. Grades: Purified. CAS No. 143748-18-9. Pack Sizes: 100ug. US Biological Life Sciences. | Worldwide |
| PACAP (6-38), human, ovine, rat | PACAP (6-38), human, ovine, rat is a potent PACAP receptor antagonist with IC50s of 30, 600, and 40 nM for PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2, respectively. Uses: Scientific research. Category: Signaling pathways. CAS No. 143748-18-9. Pack Sizes: 500 μg; 1 mg; 5 mg. Product ID: HY-P0220. | |
| PACAP (6-38), human, ovine, rat | PACAP 6-38 is a PACAP (pituitary adenylate cyclase-activating polypeptide) non-stimulating competitive antagonist (IC50 = 2 nM), with antitumor activity in vivo. And it inhibits PACAP(1-27)-induced stimulation of adenylate cyclase (Ki = 1.5 nM). Alternative Names: H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK; L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥99%. CAS No. 143748-18-9. Molecular formula: C182H300N56O45S. Mole weight: 4024.74. | |
| PACAP (6-38), human, ovine, rat TFA | It is a PACAP (pituitary adenylate cyclase-activating polypeptide) non-stimulating competitive antagonist with antitumor activity in vivo. It inhibits PACAP(1-27)-induced stimulation of adenylate cyclase. Alternative Names: Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2.TFA; L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide trifluoroacetic acid. Grades: >98%. Molecular formula: C182H300N56O45S.C2HF3O2. Mole weight: 4138.76. | |
| PACAP Related Peptide (1-29) (rat) | PACAP Related Peptide (1-29) (rat) entails an invaluable compound, effectively deployed to study an array of prevalent ailments. Its profound efficacy lies in its remarkable prowess to intricately govern the release of vital neurotransmitters, while simultaneously rendering indispensable neuroprotective attributes and studying inflammatory processes. Alternative Names: H-Asp-Val-Ala-His-Glu-Ile-Leu-Asn-Glu-Ala-Tyr-Arg-Lys-Val-Leu-Asp-Gln-Leu-Ser-Ala-Arg-Lys-Tyr-Leu-Gln-Ser-Met-Val-Ala-OH; L-alpha-aspartyl-L-valyl-L-alanyl-L-histidyl-L-alpha-glutamyl-L-isoleucyl-L-leucyl-L-asparagyl-L-alpha-glutamyl-L-alanyl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alpha-aspartyl-L-glutaminyl-L-leucyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-tyrosyl-L-leucyl-L-glutaminyl-L-seryl-L-methionyl-L-valyl-L-alanine. Grades: 95%. CAS No. 132769-35-8. Molecular formula: C148H242N42O45S. Mole weight: 3361.82. | |
| PACAP-Related Peptide (PRP), human | It is a 29 amino-acid region of the PACAP precursor protein. Alternative Names: Asp-Val-Ala-His-Gly-Ile-Leu-Asn-Glu-Ala-Tyr-Arg-Lys-Val-Leu-Asp-Gln-Leu-Ser-Ala-Gly-Lys-His-Leu-Gln-Ser-Leu-Val-Ala. Grades: ≥95%. Molecular formula: C139H229N41O42. Mole weight: 3146.55. | |
| Pac-dA-Me Phosphoramidite | Pac-dA-Me Phosphoramidite is an indispensable constituent in the field of medicinal chemistry, which has emerged as a universal building block to instill methylation patterns on adenine bases in oligonucleotides. The modified nucleotide resulting from this chemical makeup has contributed extensively to current attempts to develop antiviral agents, as well as gene-based treatment strategies directed against life-threatening diseases like cancer and genetic malformations. Alternative Names: 5'-Dimethoxytrityl-N-phenoxyacetyl-2'-deoxyAdenosine, 3'-[methyl-(N,N-diisopropyl)]-phosphoramidite. Molecular formula: C46H53N6O8P. Mole weight: 848.93. | |
| p-Acetoxybenzaldehyde | liquid, d20 1.17, purity 95%. Synonym: p-Formylphenyl Acetate. CAS No. 878-00-2. Pack Sizes: Typically in stock: 25g, 100g. Mole weight: 164.16. MP/BP: B.P. 170-172/35 mm. Order No: FR-1090. |  Frinton Laboratories |
| Pachyaximine A | Pachyaximine A, isolated from the herbs of Pachysandra axillaris, possesses significant antibacterial activity against Escherichia coli, Staphylococcus aureus, Corynebacterium diphtheriae and Corynebacterium pyrogenes. Uses: Antibacterial; antimicrobial. Alternative Names: Alkaloid-C; (-)-Pachyaximine A; Pregn-5-en-20-amine,3-Methoxy-N,N-diMethyl-, (3b,20S)- (9CI); (3β,20S)-3-Methoxy-N,N-dimethylpregn-5-en-20-amine. Grades: > 95%. CAS No. 128255-08-3. Molecular formula: C24H41NO. Mole weight: 359.6. | |
| Pachybasin | Pachybasin is an anthraquinone fungal metabolite isolated from Trichoderma harzianum. It regulates the increase in the number of Trichoderma mycoparasitic coils via cAMP signaling. It inhibits the growth of E. coli, S. aureus, B. subtilis, M. luteus bacteria, C. albicans, S. cerevisiae, A. niger, A. flavus and F. oxysporum fungi. Alternative Names: 1-Hydroxy-3-methylanthraquinone; 1-Hydroxy-3-methyl-9,10-anthracenedione. Grades: ≥70%. CAS No. 2549-78-2. Molecular formula: C15H10O3. Mole weight: 238.24. | |
| Pachymic acid | Pachymic acid is a lanostrane-type triterpenoid from P. cocos. Pachymic acid inhibits Akt and ERK signaling pathways. Uses: Scientific research. Category: Signaling pathways. Alternative Names: 3-O-Acetyltumulosic acid. CAS No. 29070-92-6. Pack Sizes: 1 mg; 5 mg; 10 mg; 50 mg. Product ID: HY-N0371. | |
| Pacibekitug | Pacibekitug (PF-04236921; TOUR-006) is a fully humanized IgG2 monoclonal antibody targeting IL-6. Pacibekitug binds to and neutralizes IL-6 signaling, thereby inhibiting the pathophysiological role of this pro-inflammatory cytokine in autoimmune diseases (such as rheumatoid arthritis, Crohn's disease, and systemic lupus erythematosus)[1][2]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: PF-04236921; TOUR-006. CAS No. 2948444-06-0. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg. Product ID: HY-P990937. | |
| Pacidamycin 1 | It is produced by the strain of Str. coeruleorubidus AB 1183F-64. It has inhibitory effect on Pseudomonas aeruginosa. It also has effect on a few strains of bacteria such as suppurative staphylococcus and Escherichia coli. Serum can reduce its antibacterial activity, pH also affects its antibacterial activity. pH 6.5, The antibacterial activity of Pacidamycin 1 can be enhanced twice. In vivo test of mice infected with pseudomonas aeruginosa (100 mg/kg·d) showed no protective effect. Alternative Names: Butanamide, N-[[[(1S)-1-carboxy-2-(1H-indol-3-yl)ethyl]amino]carbonyl]-L-alanyl-N3-(L-alanyl-3-hydroxy-L-phenylalanyl)-2-amino-N-[(Z)-[(4R,5R)-5-(3,4-dihydro-2,4-dioxo-1(2H)-pyrimidinyl)dihydro-4-hydroxy-2(3H)-furanylidene]methyl]-3-(methylamino)-, (2S,3S)-. CAS No. 121264-05-9. Molecular formula: C41H50N10O12. Mole weight: 874.90. | |
| Pacidamycin 2 | It is produced by the strain of Str. coeruleorubidus AB 1183F-64. It has inhibitory effect on Pseudomonas aeruginosa. It also has effect on a few strains of bacteria such as suppurative staphylococcus and Escherichia coli. Serum can reduce its antibacterial activity, pH also affects its antibacterial activity. Alternative Names: Butanamide, N-[[[(1S)-1-carboxy-2-phenylethyl]amino]carbonyl]-L-alanyl-N3-(L-alanyl-3-hydroxy-L-phenylalanyl)-2-amino-N-[(Z)-[(4R,5R)-5-(3,4-dihydro-2,4-dioxo-1(2H)-pyrimidinyl)dihydro-4-hydroxy-2(3H)-furanylidene]methyl]-3-(methylamino)-, (2S,3S)-. CAS No. 121264-06-0. Molecular formula: C39H49N9O12. Mole weight: 835.86. | |
| Pacidamycin 3 | It is produced by the strain of Str. coeruleorubidus AB 1183F-64. It has inhibitory effect on Pseudomonas aeruginosa. It also has effect on a few strains of bacteria such as suppurative staphylococcus and Escherichia coli. Serum can reduce its antibacterial activity, pH also affects its antibacterial activity. CAS No. 121280-49-7. Molecular formula: C39H49N9O13. Mole weight: 851.86. | |
| Pacidamycin 4N | It is produced by the strain of Streptomyces coeruleorubidus NRRL 18370. It's a Pacidamycin antibiotic. It has the activity against pseudomonas aeruginosa with MIC of 4-16 μg/mL. it has no effect on other gram-negative bacteria and gram-positive bacteria, and no effect on drug-resistant pseudomonas aeruginosa. Molecular formula: C39H45N9O11. Mole weight: 815.83. | |
| Pacidamycin 5 | It is produced by the strain of Str. coeruleorubidus AB 1183F-64. It has inhibitory effect on Pseudomonas aeruginosa. It also has effect on a few strains of bacteria such as suppurative staphylococcus and Escherichia coli. Serum can reduce its antibacterial activity, pH also affects its antibacterial activity. Alternative Names: 3,5,8,11-Tetraazatetradecanoicacid,13-amino-9-[[[(Z)-[(4R,5R)-5-(3,4-dihydro-2,4-dioxo-1(2H)-pyrimidinyl)dihydro-4-hydroxy-2(3H)-furanylidene]methyl]amino]carbonyl]-14-(3-hydroxyphenyl)-6,10,11-trimethyl-4,7,12-trioxo-2-(phenylmethyl)-, (2S,6S,9S,10S,13S)-. CAS No. 122855-43-0. Molecular formula: C36H44N8O11. Mole weight: 764.78. | |
Our database is helping our users find suppliers everyday.
