A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| P7C3-A20 | P7C3-A20. Group: Biochemicals. Alternative Names: N-(3-(3,6-Dibromo-9H-carbazol-9-yl)-2-fluoropropyl)-3-methoxyaniline. Grades: Highly Purified. CAS No. 1235481-90-9. Pack Sizes: 100mg, 250mg, 500mg, 1g. US Biological Life Sciences. |  Worldwide |
| P7C3-A20 | P7C3-A20 is a derivative of P7C3 with potent proneurogenic and neuroprotective activity. P7C3-A20 exerts an antidepressant-like effect. P7C3-A20 can cross the blood-brain barrier and therefore has the potential for brain injury treatment[1][2][3]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1235481-90-9. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15978. |  |
| P9 | P9 is an antimicrobial peptide found in Cervus elaphus (New Zealand red deer), and has antibacterial activity. Grade: >98%. |  |
| PA-1329-E1 | PA-1329-E1 is a nucleoside antibiotic produced by Micromonospora sp. PA-1329. It exhibits activity against Candida albicans. Synonyms: Antibiotic PA-1329-E1. CAS No. 80860-79-3. Molecular formula: C15H23N7O5. Mole weight: 381.39. | |
| PA22-2 | PA22-2 (IKVAV sequence; Laminin A-chain fragment) is a biological active peptide. (This peptide is derived from mouse laminin a1. Cell matrix substrate constituted with this peptide can promote neurite outgrowth.). Uses: Scientific research. Category: Peptides. Alternative Names: IKVAV sequence; Laminin A-chain fragment. CAS No. 131435-36-4. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P5353. | |
| PA (224-233), Influenza | PA (224-233), Influenza, a 10-aa peptide, is a fragment of polymerase 2 protein in influenza A virus. Synonyms: Ser-Ser-Leu-Glu-Asn-Phe-Arg-Ala-Tyr-Val; L-seryl-L-seryl-L-leucyl-L-alpha-glutamyl-L-asparagyl-L-phenylalanyl-L-arginyl-L-alanyl-L-tyrosyl-L-valine. Grade: ≥95%. CAS No. 271573-27-4. Molecular formula: C53H80N14O17. Mole weight: 1185.29. | |
| PA-31088-II | PA-31088-II is a carbapenem antibiotic produced by Streptomyces tokunonensis PA-31088 and Str. argenteolus PA-39504. Molecular formula: C13H16N2O6S. Mole weight: 328.34. | |
| PA-32413-I | PA-32413-I is a beta-lactam antibiotic produced by Streptomyces clavuigerus PA-32413. It is active against gram-positive and gram-negative bacteria. Synonyms: PA-32413 I; PA 32413 I. Molecular formula: C18H25N5O10S. Mole weight: 503.48. | |
| PA452 | PA452, retinoic X receptor (RXR) specific antagonist, inhibits the effect of Retinoic acid (RA) on Th1/Th2 development[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 457657-34-0. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-108522. | |
| PA 452 | PA 452. Group: Biochemicals. Grades: Purified. CAS No. 457657-34-0. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| PA-46101 A | PA-46101 A is a macrolide antibiotic isolated from the culture broth of Streptomyces sp. PA-46101. It is active in vitro against anaerobic Gram-positive and Gram-negative bacteria and also against a limited number of aerobic Gram-positive bacteria. Synonyms: PA 46101 A. CAS No. 130743-11-2. Molecular formula: C52H70O18. Mole weight: 983.1. | |
| PA-46101 B | PA-46101 B is a macrolide antibiotic isolated from the culture broth of Streptomyces sp. PA-46101. It is active in vitro against anaerobic Gram-positive and Gram-negative bacteria and also against a limited number of aerobic Gram-positive bacteria. Synonyms: PA 46101 B. CAS No. 130812-34-9. Molecular formula: C61H86O22. Mole weight: 1171.3. | |
| PA-8 | PA-8 is a potent, selective and orally active PACAP type I (PAC1) receptor antagonist. PA-8 inhibits the phosphorylation of CREB induced by PACAP in PAC1-, but not VPAC1- or VPAC2-receptor. PA-8 also inhibits PACAP-induced cAMP elevation with an IC50 of 2 nM[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 878437-15-1. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-133529. | |
| PA-915 | PA-915 (PAC1R antagonist 1) is a potent and orally active antagonist of PAC1 receptor. PA-915 inhibits pituitary adenylate cyclase-activating polypeptide (PACAP)-induced CREB phosphorylation. PA-915 can inhibit PACAP- and nerve injury-induced allodynia. PA-915 can be used for the research of neuropathic pain[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: PAC1R antagonist 1. CAS No. 2305204-24-2. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-147557. | |
| Pa-AMP2 | Pa-AMP2 is an antimicrobial peptide found in pokeweed seeds, Phytolacca americana, and has anti-gram-positive bacteria and fungal activity. Synonyms: Phytolacca americana antimicrobial peptide 2. Grade: >98%. | |
| PAβN dihydrochloride | PAβN dihydrochloride is an efflux pump inhibitor and a substrate for dipeptidyl aminopeptidase I (cathepsin C). Synonyms: H-Phe-Arg-βNA.2HCl; Phe-Arg β-naphthylamide dihydrochloride. Grade: ≥ 99% (TLC). CAS No. 100929-99-5. Molecular formula: C25H32Cl2N6O2. Mole weight: 519.47. | |
| PAβN dihydrochloride | PAβN dihydrochloride (MC-207110 dihydrochloride) is an efflux pump inhibitor. Uses: Scientific research. Category: Signaling pathways. Alternative Names: MC-207,110 dihydrochloride; Phe-Arg-β-naphthylamide dihydrochloride. CAS No. 100929-99-5. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 250 mg. Product ID: HY-101444A. | |
| Pabinafusp alfa | Pabinafusp alfa (JR-141) is a transferrin receptor-targeting antibody consisting of Iduronate 2-sulfatase (HY-P76399) and an anti-human transferrin receptor antibody. Pabinafusp alfa is blood-brain permeable and prevents heparan sulfate (HS) deposition in the central nervous system of mucopolysaccharidosis II (MPS II) mice. Pabinafusp alfa improves learning and prevents central nervous system neuronal damage in mice[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: JR-141. CAS No. 2140211-48-7. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P99797. | |
| PAC 1 | PAC 1. Group: Biochemicals. Grades: Purified. CAS No. 315183-21-2. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| PAC-1 | PAC-1. Group: Biochemicals. Alternative Names: 4-(Phenylmethyl)-1-piperazineacetic Acid (2E) -2- [ [2-Hydroxy-3- (2-propen-1-yl) phenyl] methylene] hydrazide. Grades: Highly Purified. CAS No. 1044929-62-5. Pack Sizes: 10mg, 25mg, 50mg, 100mg, 250mg. Molecular Formula: C23H28N4O2. US Biological Life Sciences. | Worldwide |
| PAC-1 | PAC-1 is a procaspase-3 activator that induces apoptosis in cancer cells with an EC50 of 2.08 μM. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Procaspase activating compound 1. CAS No. 315183-21-2. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 500 mg. Product ID: HY-13523. | |
| PAC-113 | PAC-113 an anti-fungal, for the treatment of oral candidiasis infections. Molecular formula: C71H109N27O14. Mole weight: 1564.82. | |
| Pacanalotamab | Pacanalotamab (AMG 420; BI-836909) is a bispecific T-cell engager (BiTE) targeting to BCMA and CD3E. BCMA refers to B cell maturation antigen, as Pacanalotamab redirecting T cells to BCMA expressing cells on the cell surface. Pacanalotamab conducts T-cell redirected lysis of human multiple myeloma (MM) cell lines[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: AMG 420; BI-836909. CAS No. 2251756-52-0. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P99798. | |
| PACAP (1-27), human, ovine, rat | PACAP (1-27), human, ovine, rat (PACAP 1-27) is the N-terminal fragment of PACAP-38, and is a potent PACAP receptor agonist with IC50s of 3 nM, 2 nM and 5 nM for rat PAC1, rat VPAC1 and human VPAC2, respectively[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: PACAP 1-27. CAS No. 127317-03-7. Pack Sizes: 500 μg; 1 mg; 5 mg; 10 mg. Product ID: HY-P0176. | |
| PACAP (1-27), human, ovine, rat | Pituitary adenylate cyclase activating polypeptide (PACAP 1-27) is an endogenous neuropeptide showing considerable homology with vasoactive intestinal peptide (VIP). It is a potent PACAP receptor agonist. Synonyms: PACAP 1-27; Pituitary Adenylate Cyclase Activating Polypeptide1-27; H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucinamide. Grade: ≥98% by HPLC. CAS No. 127317-03-7. Molecular formula: C142H224N40O39S. Mole weight: 3147.60. | |
| PACAP (1-27), human, ovine, rat acetate | PACAP (1-27), human, ovine, rat acetate is a neuropeptide originally isolated from the bovine hypothalamus, also found in humans and rats. It is a potent PACAP receptor agonist. Synonyms: H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2.CH3CO2H; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucinamide acetic acid; Pituitary adenylate cyclase-activating peptide-27 (sheep) acetate. Grade: ≥95%. Molecular formula: C144H228N40O41S. Mole weight: 3207.71. | |
| PACAP (1-38) free acid | PACAP (1-38) free acid is a desamido-PACAP (1-38), human, ovine, rat (HY-P0221). PACAP (1-38) free acid can activate the human PAC1 receptor. PACAP (1-38) free acid induces cyclic AMP (cAMP) generation in both NS-1 neuroendocrine cells and non-neuroendocrine HEK293 cells[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 129405-61-4. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P0221C. | |
| PACAP (1-38), human, ovine, rat | PACAP 1-38, an endogenous neuropeptide, is a highly potent PACAP receptor agonist (Kd = 100 pM). It stimulates adenylate cyclase and phagocytosis. It is reported to serve as a neuronal survival factor. Synonyms: PACAP 1-38; Pituitary Adenylate Cyclase-Activating Polypeptide 1-38; His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grade: ≥99%. CAS No. 137061-48-4. Molecular formula: C203H331N63O53S. Mole weight: 4534.26. | |
| PACAP (1-38), human, ovine, rat | PACAP (1-38), human, ovine, rat is a PAC1 receptor agonist. PACAP (1-38), human, ovine, rat binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively. PACAP (1-38), human, ovine, rat increases the α-secretase activity. PACAP (1-38), human, ovine, rat elevates cytosolic Ca2+, increases proliferation and increases phosphorylation of extracellular regulates kinase (ERK) and the epidermal growth factor receptor (EGFR). PACAP (1-38), human, ovine, rat demonstrates potent, efficacious, and sustained stimulatory effects on sympathetic neuronal NPY and catecholamine production. PACAP (1-38), human, ovine, rat can be used for neurotrophic and neuroprotective research[1][2][3][4][5][6][7]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Pituitary Adenylate Cyclase Activating Polypeptide 38. CAS No. 137061-48-4. Pack Sizes: 500 μg; 1 mg; 5 mg. Product ID: HY-P0221. | |
| PACAP (1-38), human, ovine, rat TFA | PACAP (1-38), human, ovine, rat TFA, an endogenous neuropeptide, is a highly potent PACAP receptor agonist. It stimulates adenylate cyclase and phagocytosis. It is reported to serve as a neuronal survival factor. Synonyms: Pituitary Adenylate Cyclase Activating Polypeptide 1-38 (TFA); His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2.TFA; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide trifluoroacetic acid. Grade: >98%. Molecular formula: C203H331N63O53S.C2HF3O2. Mole weight: 4648.28. | |
| PACAP-38 (16-38) (human, chicken, mouse, ovine, porcine, rat) | It has a strong, effective and sustained stimulating effect on the production of sympathetic NPY and catecholamines. PACAP is an effective activator of cAMP formation. Synonyms: Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; Pituitary Adenylate Cyclase Activating Polypeptide-38 (16-38); PACAP-38 (16-38), human, mouse, rat; L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grade: ≥95% by HPLC. CAS No. 144025-82-1. Molecular formula: C123H215N39O28S. Mole weight: 2720.33. | |
| PACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat) | PACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat) is distinguished as a bioactive peptide fragment. By binding and subsequently activating PAC1 receptors, it aids in the research of an array of ailments spanning neurodegenerative disorders to cardiovascular conditions. Synonyms: H-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide; L-Lysinamide, glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparaginyl-. Grade: 95%. CAS No. 160489-86-1. Molecular formula: C61H110N24O14. Mole weight: 1403.68. | |
| PACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) | An activator of cAMP formation. It stimulates sympathetic neuronal NPY and catecholamine production. Synonyms: PACAP-38 (31-38), human, mouse, rat; PACAP (31-38); Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grade: ≥98%. CAS No. 138764-85-9. Molecular formula: C47H83N17O11. Mole weight: 1062.27. | |
| PACAP-38 (human, mouse, ovine, porcine, rat) | PACAP-38 (human, mouse, ovine, porcine, rat) is a multifunctional neuropeptide that interacts with PACAP receptors and vasoactive intestinal peptide receptors to enhance intracellular cyclic AMP levels and exert systemic effects. It is a PAC1 agonist that strongly increases α-secretase activity. Upregulation of the APP-degrading enzyme promotes non-amyloidogenic processing of APP by reducing Aβ40/42 production, and thus may contribute to the prevention of Alzheimer's disease. Intranasal application of PACAP-38 in APP[V717I]-transgenic mice promotes the production of Aβ-degrading enzyme neprilysin by inducing somatostatin. Synonyms: Pituitary Adenylate Cyclase Activating Polypeptide-38 (human, mouse, ovine, porcine, rat); H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grade: 95%. CAS No. 124123-15-5. Molecular formula: C203H331N63O53S. Mole weight: 4534.32. | |
| PACAP (6-27) | PACAP 6-27 is a potent PACAP receptor antagonist. It induces insulin secretion by pancreatic beta cells. Synonyms: H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2; L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucinamide; Pituitary Adenylate Cyclase-activating Peptide (6-27). Grade: ≥95%. CAS No. 136134-68-4. Molecular formula: C121H193N33O31S. Mole weight: 2638.09. | |
| PACAP (6-27) (human, ovine, rat) | PACAP (6-27) (human, ovine, rat) is a PACAP receptor antagonist that blocks the canine adrenal catecholamine response to exogenous vasoactive intestinal peptide (VIP). PACAP (6-27) (human, ovine, rat) has the potential to study cardiovascular and neurological diseases[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Pituitary adenylate cyclase-activating peptide (6-27). CAS No. 136134-68-4. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-P3117. | |
| PACAP 6-38 | PACAP 6-38. Group: Biochemicals. Grades: Purified. CAS No. 143748-18-9. Pack Sizes: 100ug. US Biological Life Sciences. | Worldwide |
| PACAP (6-38), human, ovine, rat | PACAP 6-38 is a PACAP (pituitary adenylate cyclase-activating polypeptide) non-stimulating competitive antagonist (IC50 = 2 nM), with antitumor activity in vivo. And it inhibits PACAP(1-27)-induced stimulation of adenylate cyclase (Ki = 1.5 nM). Synonyms: H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK; L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grade: ≥99%. CAS No. 143748-18-9. Molecular formula: C182H300N56O45S. Mole weight: 4024.74. | |
| PACAP (6-38), human, ovine, rat | PACAP (6-38), human, ovine, rat is a potent PACAP receptor antagonist with IC50s of 30, 600, and 40 nM for PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2, respectively. Uses: Scientific research. Category: Signaling pathways. CAS No. 143748-18-9. Pack Sizes: 500 μg; 1 mg; 5 mg. Product ID: HY-P0220. | |
| PACAP (6-38), human, ovine, rat TFA | It is a PACAP (pituitary adenylate cyclase-activating polypeptide) non-stimulating competitive antagonist with antitumor activity in vivo. It inhibits PACAP(1-27)-induced stimulation of adenylate cyclase. Synonyms: Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2.TFA; L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide trifluoroacetic acid. Grade: >98%. Molecular formula: C182H300N56O45S.C2HF3O2. Mole weight: 4138.76. | |
| PACAP Related Peptide (1-29) (rat) | PACAP Related Peptide (1-29) (rat) entails an invaluable compound, effectively deployed to study an array of prevalent ailments. Its profound efficacy lies in its remarkable prowess to intricately govern the release of vital neurotransmitters, while simultaneously rendering indispensable neuroprotective attributes and studying inflammatory processes. Synonyms: H-Asp-Val-Ala-His-Glu-Ile-Leu-Asn-Glu-Ala-Tyr-Arg-Lys-Val-Leu-Asp-Gln-Leu-Ser-Ala-Arg-Lys-Tyr-Leu-Gln-Ser-Met-Val-Ala-OH; L-alpha-aspartyl-L-valyl-L-alanyl-L-histidyl-L-alpha-glutamyl-L-isoleucyl-L-leucyl-L-asparagyl-L-alpha-glutamyl-L-alanyl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alpha-aspartyl-L-glutaminyl-L-leucyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-tyrosyl-L-leucyl-L-glutaminyl-L-seryl-L-methionyl-L-valyl-L-alanine. Grade: 95%. CAS No. 132769-35-8. Molecular formula: C148H242N42O45S. Mole weight: 3361.82. | |
| PACAP-Related Peptide (PRP), human | It is a 29 amino-acid region of the PACAP precursor protein. Synonyms: Asp-Val-Ala-His-Gly-Ile-Leu-Asn-Glu-Ala-Tyr-Arg-Lys-Val-Leu-Asp-Gln-Leu-Ser-Ala-Gly-Lys-His-Leu-Gln-Ser-Leu-Val-Ala. Grade: ≥95%. Molecular formula: C139H229N41O42. Mole weight: 3146.55. | |
| p-Acetoxybenzaldehyde | liquid, d20 1.17, purity 95%. Synonym: p-Formylphenyl Acetate. CAS No. 878-00-2. Pack Sizes: Typically in stock: 25g, 100g. Mole weight: 164.16. MP/BP: B.P. 170-172/35 mm. Order No: FR-1090. |  Frinton Laboratories |
| Pachyaximine A | Pachyaximine A, isolated from the herbs of Pachysandra axillaris, possesses significant antibacterial activity against Escherichia coli, Staphylococcus aureus, Corynebacterium diphtheriae and Corynebacterium pyrogenes. Uses: Antibacterial; antimicrobial. Synonyms: Alkaloid-C; (-)-Pachyaximine A; Pregn-5-en-20-amine,3-Methoxy-N,N-diMethyl-, (3b,20S)- (9CI); (3β,20S)-3-Methoxy-N,N-dimethylpregn-5-en-20-amine. Grade: > 95%. CAS No. 128255-08-3. Molecular formula: C24H41NO. Mole weight: 359.6. | |
| Pachybasin | Pachybasin is an anthraquinone fungal metabolite isolated from Trichoderma harzianum. It regulates the increase in the number of Trichoderma mycoparasitic coils via cAMP signaling. It inhibits the growth of E. coli, S. aureus, B. subtilis, M. luteus bacteria, C. albicans, S. cerevisiae, A. niger, A. flavus and F. oxysporum fungi. Synonyms: 1-Hydroxy-3-methylanthraquinone; 1-Hydroxy-3-methyl-9,10-anthracenedione. Grade: ≥70%. CAS No. 2549-78-2. Molecular formula: C15H10O3. Mole weight: 238.24. | |
| Pachymic acid | Pachymic acid is a lanostrane-type triterpenoid from P. cocos. Pachymic acid inhibits Akt and ERK signaling pathways. Uses: Scientific research. Category: Signaling pathways. Alternative Names: 3-O-Acetyltumulosic acid. CAS No. 29070-92-6. Pack Sizes: 1 mg; 5 mg; 10 mg; 50 mg. Product ID: HY-N0371. | |
| Pacibekitug | Pacibekitug (PF-04236921; TOUR-006) is a fully humanized IgG2 monoclonal antibody targeting IL-6. Pacibekitug binds to and neutralizes IL-6 signaling, thereby inhibiting the pathophysiological role of this pro-inflammatory cytokine in autoimmune diseases (such as rheumatoid arthritis, Crohn's disease, and systemic lupus erythematosus)[1][2]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: PF-04236921; TOUR-006. CAS No. 2948444-06-0. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg. Product ID: HY-P990937. | |
| Pacidamycin 1 | It is produced by the strain of Str. coeruleorubidus AB 1183F-64. It has inhibitory effect on Pseudomonas aeruginosa. It also has effect on a few strains of bacteria such as suppurative staphylococcus and Escherichia coli. Serum can reduce its antibacterial activity, pH also affects its antibacterial activity. pH 6.5, The antibacterial activity of Pacidamycin 1 can be enhanced twice. In vivo test of mice infected with pseudomonas aeruginosa (100 mg/kg·d) showed no protective effect. Synonyms: Butanamide, N-[[[(1S)-1-carboxy-2-(1H-indol-3-yl)ethyl]amino]carbonyl]-L-alanyl-N3-(L-alanyl-3-hydroxy-L-phenylalanyl)-2-amino-N-[(Z)-[(4R,5R)-5-(3,4-dihydro-2,4-dioxo-1(2H)-pyrimidinyl)dihydro-4-hydroxy-2(3H)-furanylidene]methyl]-3-(methylamino)-, (2S,3S)-. CAS No. 121264-05-9. Molecular formula: C41H50N10O12. Mole weight: 874.90. | |
| Pacidamycin 2 | It is produced by the strain of Str. coeruleorubidus AB 1183F-64. It has inhibitory effect on Pseudomonas aeruginosa. It also has effect on a few strains of bacteria such as suppurative staphylococcus and Escherichia coli. Serum can reduce its antibacterial activity, pH also affects its antibacterial activity. Synonyms: Butanamide, N-[[[(1S)-1-carboxy-2-phenylethyl]amino]carbonyl]-L-alanyl-N3-(L-alanyl-3-hydroxy-L-phenylalanyl)-2-amino-N-[(Z)-[(4R,5R)-5-(3,4-dihydro-2,4-dioxo-1(2H)-pyrimidinyl)dihydro-4-hydroxy-2(3H)-furanylidene]methyl]-3-(methylamino)-, (2S,3S)-. CAS No. 121264-06-0. Molecular formula: C39H49N9O12. Mole weight: 835.86. | |
| Pacidamycin 3 | It is produced by the strain of Str. coeruleorubidus AB 1183F-64. It has inhibitory effect on Pseudomonas aeruginosa. It also has effect on a few strains of bacteria such as suppurative staphylococcus and Escherichia coli. Serum can reduce its antibacterial activity, pH also affects its antibacterial activity. CAS No. 121280-49-7. Molecular formula: C39H49N9O13. Mole weight: 851.86. | |
| Pacidamycin 4N | It is produced by the strain of Streptomyces coeruleorubidus NRRL 18370. It's a Pacidamycin antibiotic. It has the activity against pseudomonas aeruginosa with MIC of 4-16 μg/mL. it has no effect on other gram-negative bacteria and gram-positive bacteria, and no effect on drug-resistant pseudomonas aeruginosa. Molecular formula: C39H45N9O11. Mole weight: 815.83. | |
| Pacidamycin 5 | It is produced by the strain of Str. coeruleorubidus AB 1183F-64. It has inhibitory effect on Pseudomonas aeruginosa. It also has effect on a few strains of bacteria such as suppurative staphylococcus and Escherichia coli. Serum can reduce its antibacterial activity, pH also affects its antibacterial activity. Synonyms: 3,5,8,11-Tetraazatetradecanoicacid,13-amino-9-[[[(Z)-[(4R,5R)-5-(3,4-dihydro-2,4-dioxo-1(2H)-pyrimidinyl)dihydro-4-hydroxy-2(3H)-furanylidene]methyl]amino]carbonyl]-14-(3-hydroxyphenyl)-6,10,11-trimethyl-4,7,12-trioxo-2-(phenylmethyl)-, (2S,6S,9S,10S,13S)-. CAS No. 122855-43-0. Molecular formula: C36H44N8O11. Mole weight: 764.78. | |
| Pacidamycin 5T | It is produced by the strain of Streptomyces coeruleorubidus NRRL 18370. Molecular formula: C36H44N8O12. Mole weight: 780.78. | |
| Pacidamycin D | It is produced by the strain of Streptomyces coeruleorubidus NRRL 18370. It's a Pacidamycin antibiotic. It has the activity against pseudomonas aeruginosa with MIC of 4-16 μg/mL. it has no effect on other gram-negative bacteria and gram-positive bacteria, and no effect on drug-resistant pseudomonas aeruginosa. CAS No. 287107-95-3. Molecular formula: C32H41N9O10. Mole weight: 711.72. | |
| Packaging |  | |
| packaging bag | packaging bag. |  |
| Paclitaxel | Paclitaxel Inhibitor. Uses: Scientific use. Product Category: T0968. CAS No. 33069-62-4. |  |
| Paclitaxel | Paclitaxel. Alternative Names: Paclitaxel 7,11-Methano-5H-cyclodeca[3,4]benz[1,2-b]oxete benzenepropanoic acid deriv. CAS No. 33069-62-4. Purity: 95+%. Product ID: ACM33069624-2. Molecular formula: C47H51NO14. Mole weight: 853.91. IUPAC Name: [(1S,2S,3R,4S,7R,9S,10S,12R,15S)-4,12-diacetyloxy-15-[(2R,3S)-3-benzamido-2-hydroxy-3-phenylpropanoyl]oxy-1,9-dihydroxy-10,14,17,17-tetramethyl-11-oxo-6-oxatetracyclo[11.3.1.03,10.04,7]heptadec-13-en-2-yl] benzoate. Canonical SMILES: CC1=C2[C@H](C(=O)[C@@]3([C@H](C[C@@H]4[C@]([C@H]3[C@@H]([C@@](C2(C)C)(C[C@@H]1OC(=O)[C@@H]([C@H](C5=CC=CC=C5)NC(=O)C6=CC=CC=C6)O)O)OC(=O)C7=CC=CC=C7)(CO4)OC(=O)C)O)C)OC(=O)C. Alfa Chemistry - ISO 9001:32057 Certified. |  |
| Paclitaxel | 25mg Pack Size. Group: Bioactive Small Molecules, Research Organics & Inorganics. Formula: C47H51NO14. CAS No. 33069-62-4. Prepack ID 51350888-25mg. Molecular Weight 853.91. See USA prepack pricing. |  |
| Paclitaxel | 100mg Pack Size. Group: Bioactive Small Molecules, Research Organics & Inorganics. Formula: C47H51NO14. CAS No. 33069-62-4. Prepack ID 51350888-100mg. Molecular Weight 853.91. See USA prepack pricing. | |
| Paclitaxel | Paclitaxel is a microtubule polymer stabilizer with IC50 of 0.1 pM in human endothelial cells.Paclitaxel can cause both mitotic arrest and apoptotic cell death. Paclitaxel also induces autophagy. Group: Inhibitors. Alternative Names: NSC 125973, PTX. CAS No. 33069-62-4. Pack Sizes: 10mg. Product ID: S1150. Formula: C47H51NO14. Smiles: CC1=C2C(C(=O)C3(C(CC4C(C3C(C(C2(C)C)(CC1OC(=O)C(C(C5=CC=CC=C5)NC(=O)C6=CC=CC=C6)O)O)OC(=O)C7=CC=CC=C7)(CO4)OC(=O)C)O)C)OC(=O)C. Storage Conditions: 2 years -80 in solvent. |  United States; Europe |
| Paclitaxel | 1g Pack Size. Group: Bioactive Small Molecules, Research Organics & Inorganics. Formula: C47H51NO14. CAS No. 33069-62-4. Prepack ID 51350888-1g. Molecular Weight 853.91. See USA prepack pricing. | |
| Paclitaxel | Paclitaxel is a naturally occurring antineoplastic agent and stabilizes tubulin polymerization. Paclitaxel can cause both mitotic arrest and apoptotic cell death. Paclitaxel also induces autophagy[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 33069-62-4. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 500 mg; 1 g; 5 g. Product ID: HY-B0015. | |
| Paclitaxel | Paclitaxel is a compound with anti-tumor activity extracted from the Pacific yew tree Taxus brevifolia. Paclitaxel is a microtubule polymer stabilizer with IC50 of 0.1 pM in human endothelial cells. Uses: Adcs cytotoxin. Synonyms: Docetaxel EP Impurity F; BMS 181339-01; BMS181339-01; BMS-181339-01; Taxol A; Abraxane; Paxene; Taxol. Grade: >98%. CAS No. 33069-62-4. Molecular formula: C47H51NO14. Mole weight: 853.91. | |
| Paclitaxel-13C | Paclitaxel-13C. Group: Biochemicals. Alternative Names: Abraxane-13C. Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| Paclitaxel-[13C6] | Paclitaxel-[13C6] is the labelled analogue of Paclitaxel. Paclitaxel is a chemotherapy medication used to treat a number of types of cancer. CAS No. 379688-61-6. Molecular formula: C41[13C]6H51NO14. Mole weight: 859.86. | |
| Paclitaxel C | Paclitaxel C. Group: Biochemicals. Alternative Names: N-Debenzoyl-N-hexanoylpaclitaxel; (-)-Taxuyunnanine; Taxol C. Grades: Highly Purified. CAS No. 153415-45-3. Pack Sizes: 1mg, 2mg, 5mg, 10mg. Molecular Formula: C46H57NO14. US Biological Life Sciences. | Worldwide |
| Paclitaxel-Curcumin Liposome (PEGylated) | Paclitaxel (PTX) is a taxane drug extracted from Taxus brevifolia, widely used in the treatment of breast cancer, ovarian cancer, non-small cell lung cancer, and other malignancies. Curcumin is a polyphenolic compound with various pharmacological effects such as tumor, anti-inflammatory and antioxidant. This product is a pre-formulated liposome encapsulating Paclitaxel and Curcumin. It is only for research purposes. Group: Drug-loaded liposome. |  |
| Paclitaxel-d5 | Paclitaxel-d5 is a deuterium-labeled Paclitaxel. Paclitaxel is a naturally occurring antineoplastic agent and stabilizes tubulin polymerization[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1129540-33-5. Pack Sizes: 500 μg; 1 mg; 5 mg; 10 mg. Product ID: HY-B0015S. | |
| Paclitaxel-[d5] | Paclitaxel-[d5] is the labelled analogue of Paclitaxel, which is isolated from the Pacific yew and approved as a chemotherapy medication. Synonyms: Paclitaxel-D5 (Benzoyloxy); (5beta,7beta,10beta,13alpha)-4,10-Bis(acetyloxy)-13-{[(2R,3S)-3-benzamido-2-hydroxy-3-phenylpropanoyl]oxy}-1,7-dihydroxy-9-oxo-5,20-epoxytax-11-en-2-yl (2H5)benzoate. Grade: 95% by HPLC; 95% atom D. CAS No. 1261254-56-1. Molecular formula: C47H46D5NO14. Mole weight: 858.94. | |
Our database is helping our users find suppliers everyday.
