A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| PACAP-38 (31-38) (human, chicken, mouse, ovine, porcine, rat) | An activator of cAMP formation. It stimulates sympathetic neuronal NPY and catecholamine production. Synonyms: PACAP-38 (31-38), human, mouse, rat; PACAP (31-38); Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥98%. CAS No. 138764-85-9. Molecular formula: C47H83N17O11. Mole weight: 1062.27. |  |
| PACAP-38 (31-38), human, mouse, rat | PACAP-38 (31-38), human, mouse, rat is a PAC 1 receptor activator and increases the α-secretase activity. PACAP-38 (31-38), human, mouse, rat elevates cytosolic Ca 2+ , increases proliferation and increases phosphorylation of extracellular regulates kinase (ERK) and the epidermal growth factor receptor (EGFR). PACAP-38 (31-38), human, mouse, rat demonstrates potent, efficacious, and sustained stimulatory effects on sympathetic neuronal NPY and catecholamine production. PACAP-38 (31-38), human, mouse, rat can be used for neurotrophic and neuroprotective research [1] [2] [3]. Uses: Scientific research. Group: Peptides. CAS No. 138764-85-9. Pack Sizes: 500 μg; 5 mg; 10 mg. Product ID: HY-P1845. |  |
| Pacap-38(6-38)(human,chicken,mouse,ovine,porcine,rat) | Pacap-38(6-38)(human,chicken,mouse,ovine,porcine,rat). Uses: Designed for use in research and industrial production. Additional or Alternative Names: FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2;HIS-SER-ASP-GLY-ILE-PHE-THR-AP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-GLY-LYS-ARG-TYR-LYS-GLN-ARG-VAL-LYS-ASN-LYS-NH2;H-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS. Product Category: Heterocyclic Organic Compound. CAS No. 143748-18-9. Molecular formula: C182H300N56O45S. Product ID: ACM143748189. Alfa Chemistry ISO 9001:2015 Certified. |  |
| Pacap-38(human,mouse,ovine,porcine,rat) | Pacap-38(human,mouse,ovine,porcine,rat). Uses: Designed for use in research and industrial production. Additional or Alternative Names: PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE;PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE (1-38)AMIDE (HUMAN, OVINE, RAT);PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE-38 (HUMAN, MOUSE, OVINE, PORCINE, RAT);PITUITARY ADENYLATE CYCLASE AC. Product Category: Heterocyclic Organic Compound. CAS No. 124123-15-5. Molecular formula: C203H331N63O53S. Product ID: ACM124123155. Alfa Chemistry ISO 9001:2015 Certified. | |
| PACAP (6-27) | PACAP 6-27 is a potent PACAP receptor antagonist. It induces insulin secretion by pancreatic beta cells. Synonyms: H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2; L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucinamide; Pituitary Adenylate Cyclase-activating Peptide (6-27). Grades: ≥95%. CAS No. 136134-68-4. Molecular formula: C121H193N33O31S. Mole weight: 2638.09. | |
| PACAP 6-27 | Cas No. 136134-68-4. | |
| PACAP (6-27) (human, ovine, rat) | PACAP (6-27) (human, ovine, rat) is a PACAP receptor antagonist that blocks the canine adrenal catecholamine response to exogenous vasoactive intestinal peptide (VIP). PACAP (6-27) (human, ovine, rat) has the potential to study cardiovascular and neurological diseases [1]. Uses: Scientific research. Group: Peptides. Alternative Names: Pituitary adenylate cyclase-activating peptide (6-27). CAS No. 136134-68-4. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P3117. | |
| PACAP 6-38 | PACAP 6-38. Group: Biochemicals. Grades: Purified. CAS No. 143748-18-9. Pack Sizes: 100ug. US Biological Life Sciences. |  Worldwide |
| PACAP (6-38), human, ovine, rat | PACAP 6-38 is a PACAP (pituitary adenylate cyclase-activating polypeptide) non-stimulating competitive antagonist (IC50 = 2 nM), with antitumor activity in vivo. And it inhibits PACAP(1-27)-induced stimulation of adenylate cyclase (Ki = 1.5 nM). Synonyms: H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK; L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grades: ≥99%. CAS No. 143748-18-9. Molecular formula: C182H300N56O45S. Mole weight: 4024.74. | |
| PACAP Related Peptide (1-29) (rat) | PACAP Related Peptide (1-29) (rat) entails an invaluable compound, effectively deployed to study an array of prevalent ailments. Its profound efficacy lies in its remarkable prowess to intricately govern the release of vital neurotransmitters, while simultaneously rendering indispensable neuroprotective attributes and studying inflammatory processes. Synonyms: H-Asp-Val-Ala-His-Glu-Ile-Leu-Asn-Glu-Ala-Tyr-Arg-Lys-Val-Leu-Asp-Gln-Leu-Ser-Ala-Arg-Lys-Tyr-Leu-Gln-Ser-Met-Val-Ala-OH; L-alpha-aspartyl-L-valyl-L-alanyl-L-histidyl-L-alpha-glutamyl-L-isoleucyl-L-leucyl-L-asparagyl-L-alpha-glutamyl-L-alanyl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alpha-aspartyl-L-glutaminyl-L-leucyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-tyrosyl-L-leucyl-L-glutaminyl-L-seryl-L-methionyl-L-valyl-L-alanine. Grades: 95%. CAS No. 132769-35-8. Molecular formula: C148H242N42O45S. Mole weight: 3361.82. | |
| PACAP-Related Peptide (PRP), human | It is a 29 amino-acid region of the PACAP precursor protein. Synonyms: Asp-Val-Ala-His-Gly-Ile-Leu-Asn-Glu-Ala-Tyr-Arg-Lys-Val-Leu-Asp-Gln-Leu-Ser-Ala-Gly-Lys-His-Leu-Gln-Ser-Leu-Val-Ala. Grades: ≥95%. Molecular formula: C139H229N41O42. Mole weight: 3146.55. | |
| Pac-dA-Me Phosphoramidite | Pac-dA-Me Phosphoramidite is an indispensable constituent in the field of medicinal chemistry, which has emerged as a universal building block to instill methylation patterns on adenine bases in oligonucleotides. The modified nucleotide resulting from this chemical makeup has contributed extensively to current attempts to develop antiviral agents, as well as gene-based treatment strategies directed against life-threatening diseases like cancer and genetic malformations. Synonyms: 5'-Dimethoxytrityl-N-phenoxyacetyl-2'-deoxyAdenosine, 3'-[methyl-(N,N-diisopropyl)]-phosphoramidite. Molecular formula: C46H53N6O8P. Mole weight: 848.93. | |
| Pacetinib citrate | Pacetinib citrate. Uses: For analytical and research use. Group: Impurity standards. CAS No. 1228923-42-9. Molecular Formula: C34H40N4O10. Mole Weight: 664.71. Catalog: APB1228923429. |  |
| p-Acetoxybenzaldehyde | liquid, d20 1.17, purity 95%. Synonyms: p-Formylphenyl Acetate. CAS No. 878-00-2. Pack Sizes: 25g, 100g. Product ID: FR-1090. B.P. 170-172/35 mm. Mole weight: 164.16. |  Frinton Laboratories |
| Pachybasin | Pachybasin is an anthraquinone fungal metabolite isolated from Trichoderma harzianum. It regulates the increase in the number of Trichoderma mycoparasitic coils via cAMP signaling. It inhibits the growth of E. coli, S. aureus, B. subtilis, M. luteus bacteria, C. albicans, S. cerevisiae, A. niger, A. flavus and F. oxysporum fungi. Synonyms: 1-Hydroxy-3-methylanthraquinone; 1-Hydroxy-3-methyl-9,10-anthracenedione. Grades: ≥70%. CAS No. 2549-78-2. Molecular formula: C15H10O3. Mole weight: 238.24. | |
| Pachyman | b-1,3-glucan. CAS No. 9037-88-1. Product ID: 4-00542. Purity: ~96%. |  |
| Pachymic acid | Pachymic acid. Group: Biochemicals. Grades: Plant Grade. CAS No. 29070-92-6. Pack Sizes: 10mg. Molecular Formula: C33H52O5, Molecular Weight: 528.76. US Biological Life Sciences. | Worldwide |
| Pachymic acid | Pachymic acid. Group: Biochemicals. CAS No. 29070-92-6. Pack Sizes: 5mg. US Biological Life Sciences. | Worldwide |
| Pachypodol | Pachypodol exerts antioxidant and cytoprotective effects in HepG2 cells [1].Pachypodol inhibits the growth of CaCo 2 colon cancer cell line in vitro( IC 50 = 185.6 mM) [2]. Uses: Scientific research. Group: Natural products. CAS No. 33708-72-4. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-N3121. | |
| Pacidamycin 1 | It is produced by the strain of Str. coeruleorubidus AB 1183F-64. It has inhibitory effect on Pseudomonas aeruginosa. It also has effect on a few strains of bacteria such as suppurative staphylococcus and Escherichia coli. Serum can reduce its antibacterial activity, pH also affects its antibacterial activity. pH 6.5, The antibacterial activity of Pacidamycin 1 can be enhanced twice. In vivo test of mice infected with pseudomonas aeruginosa (100 mg/kg·d) showed no protective effect. Synonyms: Butanamide, N-[[[(1S)-1-carboxy-2-(1H-indol-3-yl)ethyl]amino]carbonyl]-L-alanyl-N3-(L-alanyl-3-hydroxy-L-phenylalanyl)-2-amino-N-[(Z)-[(4R,5R)-5-(3,4-dihydro-2,4-dioxo-1(2H)-pyrimidinyl)dihydro-4-hydroxy-2(3H)-furanylidene]methyl]-3-(methylamino)-, (2S,3S)-. CAS No. 121264-05-9. Molecular formula: C41H50N10O12. Mole weight: 874.90. | |
| Pacidamycin 2 | It is produced by the strain of Str. coeruleorubidus AB 1183F-64. It has inhibitory effect on Pseudomonas aeruginosa. It also has effect on a few strains of bacteria such as suppurative staphylococcus and Escherichia coli. Serum can reduce its antibacterial activity, pH also affects its antibacterial activity. Synonyms: Butanamide, N-[[[(1S)-1-carboxy-2-phenylethyl]amino]carbonyl]-L-alanyl-N3-(L-alanyl-3-hydroxy-L-phenylalanyl)-2-amino-N-[(Z)-[(4R,5R)-5-(3,4-dihydro-2,4-dioxo-1(2H)-pyrimidinyl)dihydro-4-hydroxy-2(3H)-furanylidene]methyl]-3-(methylamino)-, (2S,3S)-. CAS No. 121264-06-0. Molecular formula: C39H49N9O12. Mole weight: 835.86. | |
| Pacidamycin 3 | It is produced by the strain of Str. coeruleorubidus AB 1183F-64. It has inhibitory effect on Pseudomonas aeruginosa. It also has effect on a few strains of bacteria such as suppurative staphylococcus and Escherichia coli. Serum can reduce its antibacterial activity, pH also affects its antibacterial activity. CAS No. 121280-49-7. Molecular formula: C39H49N9O13. Mole weight: 851.86. | |
| Pacidamycin 4N | It is produced by the strain of Streptomyces coeruleorubidus NRRL 18370. It's a Pacidamycin antibiotic. It has the activity against pseudomonas aeruginosa with MIC of 4-16 μg/mL. it has no effect on other gram-negative bacteria and gram-positive bacteria, and no effect on drug-resistant pseudomonas aeruginosa. Molecular formula: C39H45N9O11. Mole weight: 815.83. | |
| Pacidamycin 5 | It is produced by the strain of Str. coeruleorubidus AB 1183F-64. It has inhibitory effect on Pseudomonas aeruginosa. It also has effect on a few strains of bacteria such as suppurative staphylococcus and Escherichia coli. Serum can reduce its antibacterial activity, pH also affects its antibacterial activity. Synonyms: 3,5,8,11-Tetraazatetradecanoicacid,13-amino-9-[[[(Z)-[(4R,5R)-5-(3,4-dihydro-2,4-dioxo-1(2H)-pyrimidinyl)dihydro-4-hydroxy-2(3H)-furanylidene]methyl]amino]carbonyl]-14-(3-hydroxyphenyl)-6,10,11-trimethyl-4,7,12-trioxo-2-(phenylmethyl)-, (2S,6S,9S,10S,13S)-. CAS No. 122855-43-0. Molecular formula: C36H44N8O11. Mole weight: 764.78. | |
| Pacidamycin 5T | It is produced by the strain of Streptomyces coeruleorubidus NRRL 18370. Molecular formula: C36H44N8O12. Mole weight: 780.78. | |
| Pacidamycin D | It is produced by the strain of Streptomyces coeruleorubidus NRRL 18370. It's a Pacidamycin antibiotic. It has the activity against pseudomonas aeruginosa with MIC of 4-16 μg/mL. it has no effect on other gram-negative bacteria and gram-positive bacteria, and no effect on drug-resistant pseudomonas aeruginosa. CAS No. 287107-95-3. Molecular formula: C32H41N9O10. Mole weight: 711.72. | |
| Packaging |  | |
| packaging bag | packaging bag. Group: Polymers. |  |
| Paclitaxel | 1g Pack Size. Group: Bioactive Small Molecules, Research Organics & Inorganics. Formula: C47H51NO14. CAS No. 33069-62-4. Prepack ID 51350888-1g. Molecular Weight 853.91. See USA prepack pricing. |  |
| Paclitaxel | Paclitaxel. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Paclitaxel 7,11-Methano-5H-cyclodeca[3,4]benz[1,2-b]oxete benzenepropanoic acid deriv. Product Category: Promotional Products. Appearance: solid. CAS No. 33069-62-4. Molecular formula: C47H51NO14. Mole weight: 853.91. Purity: 95+%. IUPACName: [(1S,2S,3R,4S,7R,9S,10S,12R,15S)-4,12-diacetyloxy-15-[(2R,3S)-3-benzamido-2-hydroxy-3-phenylpropanoyl]oxy-1,9-dihydroxy-10,14,17,17-tetramethyl-11-oxo-6-oxatetracyclo[11.3.1.03,10.04,7]heptadec-13-en-2-yl] benzoate. Product ID: ACM33069624-2. Alfa Chemistry ISO 9001:2015 Certified. | |
| Paclitaxel | 25mg Pack Size. Group: Bioactive Small Molecules, Research Organics & Inorganics. Formula: C47H51NO14. CAS No. 33069-62-4. Prepack ID 51350888-25mg. Molecular Weight 853.91. See USA prepack pricing. | |
| Paclitaxel | 100mg Pack Size. Group: Bioactive Small Molecules, Research Organics & Inorganics. Formula: C47H51NO14. CAS No. 33069-62-4. Prepack ID 51350888-100mg. Molecular Weight 853.91. See USA prepack pricing. | |
| Paclitaxel | Paclitaxel. CAS No. 33069-62-4. Product ID: 1-00914. Molecular formula: C47H51NO14. Mole weight: 853.92. Purity: 55%. Properties: white solid. Source : Taxus brevifolia. | |
| Paclitaxel | Paclitaxel. CAS No. 33069-62-4. Product ID: 1-00913. Molecular formula: C47H51NO14. Mole weight: 853.92. Purity: 0.75. Properties: white solid. Source : Taxus brevifolia. Reference: | |
| Paclitaxel | Taxol®. CAS No. 33069-62-4. Product ID: 8-01306. Molecular formula: C47H51NO14. Mole weight: 853.92. Purity: >99%. | |
| Paclitaxel | Paclitaxel is a naturally occurring antineoplastic agent and stabilizes tubulin polymerization. Paclitaxel can cause both mitotic arrest and apoptotic cell death. Paclitaxel also induces autophagy [1] [2]. Uses: Scientific research. Group: Natural products. CAS No. 33069-62-4. Pack Sizes: 10 mM * 1 mL; 10 mg; 50 mg; 100 mg; 500 mg. Product ID: HY-B0015. | |
| Paclitaxel | Paclitaxel Inhibitor. Uses: Scientific use. Product Category: T0968. CAS No. 33069-62-4. |  |
| Paclitaxel | Paclitaxel - Product ID: NST-10-124. Category: Alkaloids. Alternative Names: Abraxane, Apealea, Capxol, Cyclopax, Cynviloq, Ebetaxel, Genaxol, Genexol, Infinnium, Intaxel, Mitotax, Nanotax, Nanoxel, Onxal, Pacitaxel, Padexol, Paxene, Pazenir, Plaxicel, Sindaxel, Taclantis, Taxol, Yewtaxan, Zisu. Purity: 98%. Test method: HPLC. CAS No. 33069-62-4. Pack Sizes: 0,05g, 0,1g, 0,25g, 0,5g. Appearance: White Powder. Molecular formula: C47H51NO14. Mole weight: 853.91. Storage: +2 +8 °C. |  |
| Paclitaxel 10,13-Bis Side Chain | An impurity of Paclitaxel which is a taxane used as a chemotherapy medication. Grades: > 95%. Molecular formula: C61H62N2O16. Mole weight: 1079.18. | |
| Paclitaxel-13C | Paclitaxel-13C. Group: Biochemicals. Alternative Names: Abraxane-13C. Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| Paclitaxel-8-hydro-bicyclo(3.3.0)octane | Paclitaxel-8-hydro-bicyclo(3.3.0)octane is an analogue of Paclitaxel, which is a chemotherapy medication used to treat a number of types of cancer. Synonyms: (1R, 2R, 4S, 5S, 7R, 10S, 11R, 12S, 13S, 15S, 16S)-2, 10-diacetyloxy-5, 13-dihydroxy-4, 16, 17, 17-tetramethyl-8-oxa-3-oxo-12-phenylcarbonyloxypentacyclo[11. 3. 1. 01, 11. 04, 11. 07, 10]heptadec-15-yl (2R,3S)-2-hydroxy-3-phenyl-3-(phenylcarbonylamino)propanoate; Benzenepropanoic acid, β-(benzoylamino)-α-hydroxy-, 2a,8-bis(acetyloxy)-3-(benzoyloxy)dodecahydro-4,10-dihydroxy-7,9a,12,12-tetramethyl-9-oxo-3H-4,7a-methanocyclohept[3,3a]indeno[5,4-b]oxet-6-yl ester, [2aS-[2aα, 2bS*, 3α, 4α, 6α(αS*, βR*), 7β, 7aβ, 8β, 9aβ, 10β, 11aα]]-; Paclitaxel Photodegradant; Paclitaxel Photodegradant Impurity. Grades: 93%. CAS No. 146139-03-9. Molecular formula: C47H51NO14. Mole weight: 853.90. | |
| Paclitaxel 98+% (HPLC) | Paclitaxel 98+% (HPLC). Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 1mg, 5mg, 25mg. US Biological Life Sciences. | Worldwide |
| Paclitaxel C | Paclitaxel C. Group: Biochemicals. Alternative Names: N-Debenzoyl-N-hexanoylpaclitaxel; (-)-Taxuyunnanine; Taxol C. Grades: Highly Purified. CAS No. 153415-45-3. Pack Sizes: 1mg, 2mg, 5mg, 10mg. Molecular Formula: C46H57NO14. US Biological Life Sciences. | Worldwide |
| Paclitaxel-d5 (Taxol-d5) | An antineoplastic. Used in the study of structure and function of microtubles into tubulin. Group: Biochemicals. Alternative Names: Taxol-d5. Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| Paclitaxel EP Impurity A | Paclitaxel EP Impurity A. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: Iso Cephalomannine; (2aR,4S,4aS,6R,9S,11S,12S,12aR,12bS)-9-(((2R,3S)-3-benzamido-2-hydroxy-3-phenylpropanoyl)oxy)-4,11-dihydroxy-4a,8,13,13-tetramethyl-12-(((E)-2-methylbut-2-enoyl)oxy)-5-oxo-2a,3,4,4a,5,6,9,10,11,12,12a,12b-dodecahydro-1H-7,11-methanocycl. CAS No. 173101-54-7. Molecular Formula: C45H53NO14. Mole Weight: 831.90. Catalog: APB173101547. | |
| Paclitaxel EP Impurity B | Paclitaxel EP Impurity B. Uses: For analytical and research use. Group: Impurity standards. CAS No. 71610-00-9. Molecular Formula: C45H53NO14. Mole Weight: 831.91. Catalog: APB71610009. | |
| Paclitaxel EP Impurity C | Paclitaxel EP Impurity C. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: (2aR,4S,4aS,6R,9S,11S,12S,12aR,12bS)-12-(benzoyloxy)-9-(((2R,3S)-3-hexanamido-2-hydroxy-3-phenylpropanoyl)oxy)-4,11-dihydroxy-4a,8,13,13-tetramethyl-5-oxo-2a,3,4,4a,5,6,9,10,11,12,12a,12b-dodecahydro-1H-7,11-methanocyclodeca[3,4]benzo[1,2-b]oxete-6,12b-diyl diacetate. CAS No. 153415-45-3. Molecular Formula: C46H57NO14. Mole Weight: 847.94. Catalog: APB153415453. | |
| Paclitaxel EP Impurity D | Paclitaxel EP Impurity D. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: 7-epi-Cephalomannine; (2aR,4R,4aS,6R,9S,11S,12S,12aR,12bS)-12-(benzoyloxy)-4,11-dihydroxy-9-(((2R,3S)-2-hydroxy-3-((E)-2-methylbut-2-enamido)-3-phenylpropanoyl)oxy)-4a,8,13,13-tetramethyl-5-oxo-2a,3,4,4a,5,6,9,10,11,12,12a,12b-dodecahydro-1H-7,11-methanocyclodeca[3,4]benzo[1,2-b]oxete-6,12b-diyl diacetate. CAS No. 150547-36-7. Molecular Formula: C45H53NO14. Mole Weight: 831.9. Catalog: APB150547367. | |
| Paclitaxel EP Impurity E | Paclitaxel EP Impurity E. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: 7-epi Paclitaxel; (2aR,4R,4aS,6R,9S,11S,12S,12aR,12bS)-9-(((2R,3S)-3-benzamido-2-hydroxy-3-phenylpropanoyl)oxy)-12-(benzoyloxy)-4,11-dihydroxy-4a,8,13,13-tetramethyl-5-oxo-2a,3,4,4a,5,6,9,10,11,12,12a,12b-dodecahydro-1H-7,11-methanocyclodeca[3,4]benzo[1,2-b]oxete-6,12b-diyl diacetate. CAS No. 105454-04-4. Molecular Formula: C47H51NO14. Mole Weight: 853.91. Catalog: APB105454044. | |
| Paclitaxel EP Impurity F | Paclitaxel EP Impurity F. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: N-methylpaclitaxel C; (2aR,4S,4aS,6R,9S,11S,12S,12aR,12bS)-12-(benzoyloxy)-4,11-dihydroxy-9-(((2R,3S)-2-hydroxy-3-(N-methylhexanamido)-3-phenylpropanoyl)oxy)-4a,8,13,13-tetramethyl-5-oxo-2a,3,4,4a,5,6,9,10,11,12,12a,12b-dodecahydro-1H-7,11-methanocyclodeca[3,4]benzo[1,2-b]oxete-6,12b-diyl diacetate. CAS No. 153083-53-5. Molecular Formula: C47H59NO14. Mole Weight: 861.97. Catalog: APB153083535. | |
| Paclitaxel EP Impurity G | Paclitaxel EP Impurity G. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: Paclitaxel Impurity 22; (2aR,4S,4aS,6R,9S,11S,12S,12aR,12bS)-12b-acetoxy-9-(((2R,3S)-3-benzamido-2-hydroxy-3-phenylpropanoyl)oxy)-4,6,11-trihydroxy-4a,8,13,13-tetramethyl-5-oxo-2a,3,4,4a,5,6,9,10,11,12,12a,12b-dodecahydro-1H-7,11-methanocyclodeca[3,4]benzo[1,2-b]oxet-12-yl benzoate. CAS No. 78432-77-6. Molecular Formula: C45H49NO13. Mole Weight: 811.87. Catalog: APB78432776. | |
| Paclitaxel EP Impurity H | Paclitaxel EP Impurity H. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: Paclitaxel USP Related Compound B; 7-epi-10-Desacetyl-Paclitaxel; (2aR,4R,4aS,6R,9S,11S,12S,12aR,12bS)-12b-acetoxy-9-(((2R,3S)-3-benzamido-2-hydroxy-3-phenylpropanoyl)oxy)-4,6,11-trihydroxy-4a,8,13,13-tetramethyl-5-oxo-2a,3,4,4a,5,6,9,10,11,12,12a,12b-dodecahydro-1H-7,11-methanocyclodeca[3,4]benzo[1,2-b]oxet-12-yl benzoate. CAS No. 78454-17-8. Molecular Formula: C45H49NO13. Mole Weight: 811.87. Catalog: APB78454178. | |
| Paclitaxel EP Impurity I | Paclitaxel EP Impurity I. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: Paclitaxel 10,13-Bis Side Chain; (2R,2'R,3S,3'S)-(2aR,4S,4aS,6R,9S,11S,12S,12aR,12bS)-12b-acetoxy-12-(benzoyloxy)-4,11-dihydroxy-4a,8,13,13-tetramethyl-5-oxo-2a,3,4,4a,5,6,9,10,11,12,12a,12b-dodecahydro-1H-7,11-methanocyclodeca[3,4]benzo[1,2-b]oxete-6,9-diyl bis(3-benzamido-2-hydroxy-3-phenylpropanoate). CAS No. 2157462-42-3. Molecular Formula: C61H62N2O16. Mole Weight: 1079.15. Catalog: APB2157462423. | |
| Paclitaxel EP Impurity J | Paclitaxel EP Impurity J. Uses: For analytical and research use. Group: Impurity standards. CAS No. 2757197-26-3. Molecular Formula: C49H53NO15. Mole Weight: 895.96. Catalog: APB2757197263. | |
| Paclitaxel EP Impurity J | Paclitaxel EP Impurity J. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: 10-Acetoacetyl Paclitaxel; (2aR,4S,4aS,6R,9S,11S,12S,12aR,12bS)-12b-acetoxy-9-(((2R,3S)-3-benzamido-2-hydroxy-3-phenylpropanoyl)oxy)-4,11-dihydroxy-4a,8,13,13-tetramethyl-5-oxo-6-((3-oxobutanoyl)oxy)-2a,3,4,4a,5,6,9,10,11,12,12a,12b-dodecahydro-1H-7,11-methanocyclodeca[3,4]benzo[1,2-b]oxet-12-yl benzoate. Molecular Formula: C49H53NO15. Mole Weight: 895.94. Catalog: APB01943. | |
| Paclitaxel EP Impurity K | Paclitaxel EP Impurity K. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: (2aR,4S,4aS,6R,9S,11S,12S,12aR,12bS)-9-(((2R,3S)-3-benzamido-2-hydroxy-3-phenylpropanoyl)oxy)-12-(benzoyloxy)-11-hydroxy-4a,8,13,13-tetramethyl-5-oxo-4-((triethylsilyl)oxy)-2a,3,4,4a,5,6,9,10,11,12,12a,12b-dodecahydro-1H-7,11-methanocyclodeca[3,4]benzo[1. CAS No. 148930-55-6. Molecular Formula: C53H65NO14Si. Mole Weight: 968.17. Catalog: APB148930556. | |
| Paclitaxel EP Impurity L | Paclitaxel EP Impurity L. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: 7-Acetyl Paclitaxel; (2aR,4S,4aS,6R,9S,11S,12S,12aR,12bS)-9-(((2R,3S)-3-benzamido-2-hydroxy-3-phenylpropanoyl)oxy)-12-(benzoyloxy)-11-hydroxy-4a,8,13,13-tetramethyl-5-oxo-2a,3,4,4a,5,6,9,10,11,12,12a,12b-dodecahydro-1H-7,11-methanocyclodeca[3,4]benzo[1,2-b]oxete-4,6,12b-triyl triacetate. CAS No. 92950-39-5. Molecular Formula: C49H53NO15. Mole Weight: 895.94. Catalog: APB92950395. | |
| Paclitaxel EP Impurity M | Paclitaxel EP Impurity M. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: Paclitaxel Oxetane Ring-Opened 3-Acetyl 4-Benzoyl Impurity; (1S,3S,4S,4aR,5S,6S,8S,11R,12aS)-8-(((2R,3S)-3-benzamido-2-hydroxy-3-phenylpropanoyl)oxy)-4-((benzoyloxy)methyl)-1,4,5,6-tetrahydroxy-9,12a,13,13-tetramethyl-12-oxo-1,2,3,4,4a,5,6,7,8,11,12,12a-d. CAS No. 932042-85-8. Molecular Formula: C47H53NO15. Mole Weight: 871.92. Catalog: APB932042858. | |
| Paclitaxel EP Impurity N | Paclitaxel EP Impurity N. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: Baccatin III; (2aR,4S,4aS,6R,9S,11S,12S,12aR,12bS)-12-(benzoyloxy)-4,9,11-trihydroxy-4a,8,13,13-tetramethyl-5-oxo-2a,3,4,4a,5,6,9,10,11,12,12a,12b-dodecahydro-1H-7,11-methanocyclodeca[3,4]benzo[1,2-b]oxete-6,12b-diyl diacetate. CAS No. 27548-93-2. Molecular Formula: C31H38O11. Mole Weight: 586.63. Catalog: APB27548932. | |
| Paclitaxel EP Impurity O | Paclitaxel EP Impurity O. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: N-cinnamoyl-N-debenzoylpaclitaxel; (2aR,4S,4aS,6R,9S,11S,12S,12aR,12bS)-12-(benzoyloxy)-9-(((2R,3S)-3-cinnamamido-2-hydroxy-3-phenylpropanoyl)oxy)-4,11-dihydroxy-4a,8,13,13-tetramethyl-5-oxo-2a,3,4,4a,5,6,9,10,11,12,12a,12b-dodecahydro-1H-7,11-methanocyclodeca[3,4]benzo[1,2-b]oxete-6,12b-diyl diacetate. CAS No. 219783-77-4. Molecular Formula: C49H53NO14. Mole Weight: 879.94. Catalog: APB219783774. | |
| Paclitaxel EP Impurity P | Paclitaxel EP Impurity P. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: (2aR,4S,4aS,6R,9S,11S,12S,12aR,12bS)-12-(benzoyloxy)-4,11-dihydroxy-9-(((2R,3S)-2-hydroxy-3-phenyl-3-(2-phenylacetamido)propanoyl)oxy)-4a,8,13,13-tetramethyl-5-oxo-2a,3,4,4a,5,6,9,10,11,12,12a,12b-dodecahydro-1H-7,11-methanocyclodeca[3,4]benzo[1,2-b]oxete-6,12b-diyl diacetate. CAS No. 173101-56-9. Molecular Formula: C48H53NO14. Mole Weight: 867.93. Catalog: APB173101569. | |
| Paclitaxel EP Impurity Q | Paclitaxel EP Impurity Q. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: (2aR,4S,4aS,6R,9S,11S,12S,12aR,12bS)-12-(benzoyloxy)-9-(((2R,3S)-3-((E)-hex-2-enamido)-2-hydroxy-3-phenylpropanoyl)oxy)-4,11-dihydroxy-4a,8,13,13-tetramethyl-5-oxo-2a,3,4,4a,5,6,9,10,11,12,12a,12b-dodecahydro-1H-7,11-methanocyclodeca[3,4]benzo[1,2-b]oxete-6,12b-diyl diacetate. CAS No. 502626-06-4. Molecular Formula: C46H55NO14. Mole Weight: 845.93. Catalog: APB502626064. | |
| Paclitaxel EP Impurity R | Paclitaxel EP Impurity R. Uses: For analytical and research use. Group: Impurity standards. CAS No. 159001-25-9. Molecular Formula: C45H55NO14. Mole Weight: 833.93. Catalog: APB159001259. | |
| Paclitaxel EP Impurity R | Paclitaxel EP Impurity R. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: (2aR,4S,4aS,6R,9S,11S,12S,12aR,12bS)-12-(benzoyloxy)-4,11-dihydroxy-9-(((2R,3S)-2-hydroxy-3-((S)-2-methylbutanamido)-3-phenylpropanoyl)oxy)-4a,8,13,13-tetramethyl-5-oxo-2a,3,4,4a,5,6,9,10,11,12,12a,12b-dodecahydro-1H-7,11-methanocyclodeca[3,4]benzo[1,2-b]. Molecular Formula: C45H55NO14. Mole Weight: 833.92. Catalog: APB01944. | |
| Paclitaxel Half Synthetic | Paclitaxel Half Synthetic. Group: other nano materials. CAS No. 33069-62-4. Molecular formula: 853.906g/mol. Mole weight: C47H51NO14. 99.99%. | |
| Paclitaxel Impurity | Cas No. 173101-54-7. | |
| Paclitaxel Impurity 1 | An impurity of Paclitaxel which is a chemotherapy medicine approved to be used alone or with other drugs. Grades: > 95%. Molecular formula: C16H15NO3. Mole weight: 269.3. | |
| Paclitaxel Impurity 2 | Paclitaxel Impurity 2 is one of Paclitaxel impurities. Paclitaxel is a tetracyclic diterpenoid isolated originally from the Pacific yew tree Taxus brevifolia. It is a mitotic inhibitor used in cancer chemotherapy. It has a role as a microtubule-stabilising agent, a metabolite, a human metabolite and an antineoplastic agent. Synonyms: (3S,4aR,5S,6S,11R,12R,12aR)-5-(Acetyloxy)-1,2,3,4,4a,5,6,7,8,11,12,12a-dodecahydro-6,11,12-trihydroxy-9,12a,13,13-tetramethyl-4-methylene-8-oxo-6,10-methanobenzocyclodecen-3-yl β-(Dimethylamino)-benzenepropanoate. CAS No. 959572-72-6. Molecular formula: C33H45NO8. Mole weight: 583.71. | |
| Paclitaxel Impurity 20 | Paclitaxel Impurity 20. Uses: For analytical and research use. Group: Impurity standards. CAS No. 2097541-16-5. Molecular Formula: C28H29NO5. Mole Weight: 459.54. Catalog: APB2097541165. | |
| Paclitaxel Impurity 21 | Paclitaxel Impurity 21. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: (1S,2S,4S,6R,7aS,8S,9aR,11aS)-4-(((2R,3S)-3-benzamido-2-hydroxy-3-phenylpropanoyl)oxy)-1-(benzoyloxy)-2,8-dihydroxy-5,7a,12,12-tetramethyl-7-oxododecahydro-1H-2,5a-methanocyclohepta[3,3a]indeno[5,4-b]oxete-6,11a-diyl diacetate. CAS No. 146139-03-9. Molecular Formula: C47H51NO14. Mole Weight: 853.91. Catalog: APB146139039. | |
Our database is helping our users find suppliers everyday.
