A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
PAβN dihydrochloride is an efflux pump inhibitor and a substrate for dipeptidyl aminopeptidase I (cathepsin C). Synonyms: H-Phe-Arg-βNA.2HCl; Phe-Arg β-naphthylamide dihydrochloride. Grade: ≥ 99% (TLC). CAS No. 100929-99-5. Molecular formula: C25H32Cl2N6O2. Mole weight: 519.47.
Pabinafusp alfa
Pabinafusp alfa (JR-141) is a transferrin receptor -targeting antibody consisting of Iduronate 2-sulfatase (HY-P76399) and an anti-human transferrin receptor antibody. Pabinafusp alfa is blood-brain permeable and prevents heparan sulfate (HS) deposition in the central nervous system of mucopolysaccharidosis II (MPS II) mice. Pabinafusp alfa improves learning and prevents central nervous system neuronal damage in mice [1]. Uses: Scientific research. Group: Inhibitory antibodies. Alternative Names: JR-141. CAS No. 2140211-48-7. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P99797.
PAC1
PAC1. Group: Biochemicals. Alternative Names: 4-(Phenylmethyl)-1-piperazineacetic acid [ [2-hydroxy-3- (2-propenyl) phenyl] methylene] hydrazide. Grades: Highly Purified. CAS No. 315183-21-2. Pack Sizes: 2g, 5g, 10g, 25g, 50g. Molecular Formula: C23H28N4O2. US Biological Life Sciences.
Worldwide
PAC 1
PAC 1. Group: Biochemicals. Grades: Purified. CAS No. 315183-21-2. Pack Sizes: 10mg, 50mg. US Biological Life Sciences.
Worldwide
PAC-1
PAC-1 is a procaspase-3 activator that induces apoptosis in cancer cells with an EC 50 of 2.08 μM. Uses: Scientific research. Group: Signaling pathways. Alternative Names: Procaspase activating compound 1. CAS No. 315183-21-2. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg; 500 mg. Product ID: HY-13523.
PACA. Uses: Designed for use in research and industrial production. CAS No. 1431724-30-9. Purity: 0.98. Product ID: AP1431724309. Alfa Chemistry ISO 9001:2015 Certified.
PACAP 1-27
PACAP 1-27. Group: Biochemicals. Grades: Purified. CAS No. 127317-03-7. Pack Sizes: 100ug. US Biological Life Sciences.
Worldwide
PACAP (1-27), human, ovine, rat
PACAP (1-27), human, ovine, rat (PACAP 1-27) is the N-terminal fragment of PACAP-38, and is a potent PACAP receptor antagonist with IC 50 s of 3 nM, 2 nM and 5 nM for rat PAC1 , rat VPAC1 and human VPAC2 , respectively [1]. Uses: Scientific research. Group: Peptides. Alternative Names: PACAP 1-27. CAS No. 127317-03-7. Pack Sizes: 500 μg; 1 mg; 5 mg; 10 mg. Product ID: HY-P0176.
PACAP (1-27), human, ovine, rat
Pituitary adenylate cyclase activating polypeptide (PACAP 1-27) is an endogenous neuropeptide showing considerable homology with vasoactive intestinal peptide (VIP). It is a potent PACAP receptor agonist. Synonyms: PACAP 1-27; Pituitary Adenylate Cyclase Activating Polypeptide1-27; H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucinamide. Grade: ≥98% by HPLC. CAS No. 127317-03-7. Molecular formula: C142H224N40O39S. Mole weight: 3147.60.
PACAP (1-27), human, ovine, rat acetate
PACAP (1-27), human, ovine, rat acetate is a neuropeptide originally isolated from the bovine hypothalamus, also found in humans and rats. It is a potent PACAP receptor agonist. Synonyms: H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2.CH3CO2H; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucinamide acetic acid; Pituitary adenylate cyclase-activating peptide-27 (sheep) acetate. Grade: ≥95%. Molecular formula: C144H228N40O41S. Mole weight: 3207.71.
PACAP 1-38
PACAP 1-38. Group: Biochemicals. Grades: Purified. CAS No. 137061-48-4. Pack Sizes: 100ug. US Biological Life Sciences.
Worldwide
PACAP (1-38) free acid
PACAP (1-38) free acid is an endogenous neuropeptide. PACAP (1-38) free acid potently stimulates antral motility and somatostatin secretion, inhibits the secretion of gastrin and stimulates the release of vasoactive intestinal polypeptide, gastrin releasing peptide and substance P. PACAP (1-38) free acid also enhances N-methyl-D-aspartate receptor function and expression of brain-derived neurotrophic factor through RACK1 [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 129405-61-4. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P0221C.
PACAP (1-38), human, ovine, rat
PACAP (1-38), human, ovine, rat is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively. Uses: Scientific research. Group: Peptides. Alternative Names: Pituitary Adenylate Cyclase Activating Polypeptide 38. CAS No. 137061-48-4. Pack Sizes: 500 ?g; 1 mg; 5 mg. Product ID: HY-P0221.
PACAP (1-38), human, ovine, rat
PACAP 1-38, an endogenous neuropeptide, is a highly potent PACAP receptor agonist (Kd = 100 pM). It stimulates adenylate cyclase and phagocytosis. It is reported to serve as a neuronal survival factor. Synonyms: PACAP 1-38; Pituitary Adenylate Cyclase-Activating Polypeptide 1-38; His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grade: ≥99%. CAS No. 137061-48-4. Molecular formula: C203H331N63O53S. Mole weight: 4534.26.
PACAP (1-38), human, ovine, rat TFA
PACAP (1-38), human, ovine, rat TFA, an endogenous neuropeptide, is a highly potent PACAP receptor agonist. It stimulates adenylate cyclase and phagocytosis. It is reported to serve as a neuronal survival factor. Synonyms: Pituitary Adenylate Cyclase Activating Polypeptide 1-38 (TFA); His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2.TFA; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide trifluoroacetic acid. Grade: >98%. Molecular formula: C203H331N63O53S.C2HF3O2. Mole weight: 4648.28.
It has a strong, effective and sustained stimulating effect on the production of sympathetic NPY and catecholamines. PACAP is an effective activator of cAMP formation. Synonyms: Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; Pituitary Adenylate Cyclase Activating Polypeptide-38 (16-38); PACAP-38 (16-38), human, mouse, rat; L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grade: ≥95% by HPLC. CAS No. 144025-82-1. Molecular formula: C123H215N39O28S. Mole weight: 2720.33.
PACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat) is distinguished as a bioactive peptide fragment. By binding and subsequently activating PAC1 receptors, it aids in the research of an array of ailments spanning neurodegenerative disorders to cardiovascular conditions. Synonyms: H-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide; L-Lysinamide, glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparaginyl-. Grade: 95%. CAS No. 160489-86-1. Molecular formula: C61H110N24O14. Mole weight: 1403.68.
An activator of cAMP formation. It stimulates sympathetic neuronal NPY and catecholamine production. Synonyms: PACAP-38 (31-38), human, mouse, rat; PACAP (31-38); Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grade: ≥98%. CAS No. 138764-85-9. Molecular formula: C47H83N17O11. Mole weight: 1062.27.
PACAP-38 (31-38), human, mouse, rat
PACAP-38 (31-38), human, mouse, rat is a PAC 1 receptor activator and increases the α-secretase activity. PACAP-38 (31-38), human, mouse, rat elevates cytosolic Ca 2+ , increases proliferation and increases phosphorylation of extracellular regulates kinase (ERK) and the epidermal growth factor receptor (EGFR). PACAP-38 (31-38), human, mouse, rat demonstrates potent, efficacious, and sustained stimulatory effects on sympathetic neuronal NPY and catecholamine production. PACAP-38 (31-38), human, mouse, rat can be used for neurotrophic and neuroprotective research [1] [2] [3]. Uses: Scientific research. Group: Peptides. CAS No. 138764-85-9. Pack Sizes: 500 μg; 5 mg; 10 mg. Product ID: HY-P1845.
Pacap-38(6-38)(human,chicken,mouse,ovine,porcine,rat). Uses: Designed for use in research and industrial production. Additional or Alternative Names: FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2;HIS-SER-ASP-GLY-ILE-PHE-THR-AP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS-LYS-TYR-LEU-ALA-ALA-VAL-LEU-GLY-LYS-ARG-TYR-LYS-GLN-ARG-VAL-LYS-ASN-LYS-NH2;H-PHE-THR-ASP-SER-TYR-SER-ARG-TYR-ARG-LYS-GLN-MET-ALA-VAL-LYS. Product Category: Heterocyclic Organic Compound. CAS No. 143748-18-9. Molecular formula: C182H300N56O45S. Product ID: ACM143748189. Alfa Chemistry ISO 9001:2015 Certified.
Pacap-38(human,mouse,ovine,porcine,rat)
Pacap-38(human,mouse,ovine,porcine,rat). Uses: Designed for use in research and industrial production. Additional or Alternative Names: PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE;PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE (1-38)AMIDE (HUMAN, OVINE, RAT);PITUITARY ADENYLATE CYCLASE ACTIVATING POLYPEPTIDE-38 (HUMAN, MOUSE, OVINE, PORCINE, RAT);PITUITARY ADENYLATE CYCLASE AC. Product Category: Heterocyclic Organic Compound. CAS No. 124123-15-5. Molecular formula: C203H331N63O53S. Product ID: ACM124123155. Alfa Chemistry ISO 9001:2015 Certified.
PACAP-38 (human, mouse, ovine, porcine, rat)
PACAP-38 (human, mouse, ovine, porcine, rat) is a multifunctional neuropeptide that interacts with PACAP receptors and vasoactive intestinal peptide receptors to enhance intracellular cyclic AMP levels and exert systemic effects. It is a PAC1 agonist that strongly increases α-secretase activity. Upregulation of the APP-degrading enzyme promotes non-amyloidogenic processing of APP by reducing Aβ40/42 production, and thus may contribute to the prevention of Alzheimer's disease. Intranasal application of PACAP-38 in APP[V717I]-transgenic mice promotes the production of Aβ-degrading enzyme neprilysin by inducing somatostatin. Synonyms: Pituitary Adenylate Cyclase Activating Polypeptide-38 (human, mouse, ovine, porcine, rat); H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; L-histidyl-L-seryl-L-alpha-aspartyl-glycyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grade: 95%. CAS No. 124123-15-5. Molecular formula: C203H331N63O53S. Mole weight: 4534.32.
PACAP (6-27)
PACAP 6-27 is a potent PACAP receptor antagonist. It induces insulin secretion by pancreatic beta cells. Synonyms: H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2; L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucinamide; Pituitary Adenylate Cyclase-activating Peptide (6-27). Grade: ≥95%. CAS No. 136134-68-4. Molecular formula: C121H193N33O31S. Mole weight: 2638.09.
PACAP (6-27) (human, ovine, rat)
PACAP (6-27) (human, ovine, rat) is a PACAP receptor antagonist that blocks the canine adrenal catecholamine response to exogenous vasoactive intestinal peptide (VIP). PACAP (6-27) (human, ovine, rat) has the potential to study cardiovascular and neurological diseases [1]. Uses: Scientific research. Group: Peptides. Alternative Names: Pituitary adenylate cyclase-activating peptide (6-27). CAS No. 136134-68-4. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P3117.
PACAP 6-38
PACAP 6-38. Group: Biochemicals. Grades: Purified. CAS No. 143748-18-9. Pack Sizes: 100ug. US Biological Life Sciences.
Worldwide
PACAP (6-38), human, ovine, rat
PACAP 6-38 is a PACAP (pituitary adenylate cyclase-activating polypeptide) non-stimulating competitive antagonist (IC50 = 2 nM), with antitumor activity in vivo. And it inhibits PACAP(1-27)-induced stimulation of adenylate cyclase (Ki = 1.5 nM). Synonyms: H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK; L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide. Grade: ≥99%. CAS No. 143748-18-9. Molecular formula: C182H300N56O45S. Mole weight: 4024.74.
PACAP (6-38), human, ovine, rat TFA
It is a PACAP (pituitary adenylate cyclase-activating polypeptide) non-stimulating competitive antagonist with antitumor activity in vivo. It inhibits PACAP(1-27)-induced stimulation of adenylate cyclase. Synonyms: Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2.TFA; L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-seryl-L-tyrosyl-L-seryl-L-arginyl-L-tyrosyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-alanyl-L-alanyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-arginyl-L-tyrosyl-L-lysyl-L-glutaminyl-L-arginyl-L-valyl-L-lysyl-L-asparagyl-L-lysinamide trifluoroacetic acid. Grade: >98%. Molecular formula: C182H300N56O45S.C2HF3O2. Mole weight: 4138.76.
PACAP (6-38), human, ovine, rat TFA
PACAP (6-38), human, ovine, rat TFA is a potent PACAP receptor antagonist with IC50s of 30, 600, and 40 nM for PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2, respectively. Uses: Scientific research. Group: Peptides. Pack Sizes: 500 ?g; 1 mg; 5 mg. Product ID: HY-P0220A.
PACAP Related Peptide (1-29) (rat)
PACAP Related Peptide (1-29) (rat) entails an invaluable compound, effectively deployed to study an array of prevalent ailments. Its profound efficacy lies in its remarkable prowess to intricately govern the release of vital neurotransmitters, while simultaneously rendering indispensable neuroprotective attributes and studying inflammatory processes. Synonyms: H-Asp-Val-Ala-His-Glu-Ile-Leu-Asn-Glu-Ala-Tyr-Arg-Lys-Val-Leu-Asp-Gln-Leu-Ser-Ala-Arg-Lys-Tyr-Leu-Gln-Ser-Met-Val-Ala-OH; L-alpha-aspartyl-L-valyl-L-alanyl-L-histidyl-L-alpha-glutamyl-L-isoleucyl-L-leucyl-L-asparagyl-L-alpha-glutamyl-L-alanyl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alpha-aspartyl-L-glutaminyl-L-leucyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-tyrosyl-L-leucyl-L-glutaminyl-L-seryl-L-methionyl-L-valyl-L-alanine. Grade: 95%. CAS No. 132769-35-8. Molecular formula: C148H242N42O45S. Mole weight: 3361.82.
PACAP-Related Peptide (PRP), human
It is a 29 amino-acid region of the PACAP precursor protein. Synonyms: Asp-Val-Ala-His-Gly-Ile-Leu-Asn-Glu-Ala-Tyr-Arg-Lys-Val-Leu-Asp-Gln-Leu-Ser-Ala-Gly-Lys-His-Leu-Gln-Ser-Leu-Val-Ala. Grade: ≥95%. Molecular formula: C139H229N41O42. Mole weight: 3146.55.
p-Acetamidophenyl ?-D-glucuronide sodium salt
analytical standard. Group: Additional drugs.
Pacetinib citrate
Pacetinib citrate. Uses: For analytical and research use. Group: Impurity standards. CAS No. 1228923-42-9. Molecular formula: C34H40N4O10. Mole weight: 664.71. Catalog: APB1228923429.
p-Acetoxybenzaldehyde
liquid, d20 1.17, purity 95%. Synonym: p-Formylphenyl Acetate. CAS No. 878-00-2. Pack Sizes: Typically in stock: 25g, 100g. Mole weight: 164.16. MP/BP: B.P. 170-172/35 mm. Order No: FR-1090.
Frinton Laboratories
Pachyaximine A
Pachyaximine A, isolated from the herbs of Pachysandra axillaris, possesses significant antibacterial activity against Escherichia coli, Staphylococcus aureus, Corynebacterium diphtheriae and Corynebacterium pyrogenes. Uses: Antibacterial; antimicrobial. Synonyms: Alkaloid-C; (-)-Pachyaximine A; Pregn-5-en-20-amine,3-Methoxy-N,N-diMethyl-, (3b,20S)- (9CI); (3β,20S)-3-Methoxy-N,N-dimethylpregn-5-en-20-amine. Grade: > 95%. CAS No. 128255-08-3. Molecular formula: C24H41NO. Mole weight: 359.6.
Pachybasin
Pachybasin is an anthraquinone fungal metabolite isolated from Trichoderma harzianum. It regulates the increase in the number of Trichoderma mycoparasitic coils via cAMP signaling. It inhibits the growth of E. coli, S. aureus, B. subtilis, M. luteus bacteria, C. albicans, S. cerevisiae, A. niger, A. flavus and F. oxysporum fungi. Synonyms: 1-Hydroxy-3-methylanthraquinone; 1-Hydroxy-3-methyl-9,10-anthracenedione. Grade: ≥70%. CAS No. 2549-78-2. Molecular formula: C15H10O3. Mole weight: 238.24.
Pachymic acid
Pachymic acid. Group: Biochemicals. CAS No. 29070-92-6. Pack Sizes: 5mg. US Biological Life Sciences.
Worldwide
Pachymic acid
Pachymic acid. Group: Biochemicals. Grades: Plant Grade. CAS No. 29070-92-6. Pack Sizes: 10mg. Molecular Formula: C33H52O5, Molecular Weight: 528.76. US Biological Life Sciences.
Worldwide
Pachypodol
Pachypodol exerts antioxidant and cytoprotective effects in HepG2 cells [1].Pachypodol inhibits the growth of CaCo 2 colon cancer cell line in vitro( IC 50 = 185.6 mM) [2]. Uses: Scientific research. Group: Natural products. CAS No. 33708-72-4. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-N3121.
Pacidamycin 1
It is produced by the strain of Str. coeruleorubidus AB 1183F-64. It has inhibitory effect on Pseudomonas aeruginosa. It also has effect on a few strains of bacteria such as suppurative staphylococcus and Escherichia coli. Serum can reduce its antibacterial activity, pH also affects its antibacterial activity. pH 6.5, The antibacterial activity of Pacidamycin 1 can be enhanced twice. In vivo test of mice infected with pseudomonas aeruginosa (100 mg/kg·d) showed no protective effect. Synonyms: Butanamide, N-[[[(1S)-1-carboxy-2-(1H-indol-3-yl)ethyl]amino]carbonyl]-L-alanyl-N3-(L-alanyl-3-hydroxy-L-phenylalanyl)-2-amino-N-[(Z)-[(4R,5R)-5-(3,4-dihydro-2,4-dioxo-1(2H)-pyrimidinyl)dihydro-4-hydroxy-2(3H)-furanylidene]methyl]-3-(methylamino)-, (2S,3S)-. CAS No. 121264-05-9. Molecular formula: C41H50N10O12. Mole weight: 874.90.
Pacidamycin 2
It is produced by the strain of Str. coeruleorubidus AB 1183F-64. It has inhibitory effect on Pseudomonas aeruginosa. It also has effect on a few strains of bacteria such as suppurative staphylococcus and Escherichia coli. Serum can reduce its antibacterial activity, pH also affects its antibacterial activity. Synonyms: Butanamide, N-[[[(1S)-1-carboxy-2-phenylethyl]amino]carbonyl]-L-alanyl-N3-(L-alanyl-3-hydroxy-L-phenylalanyl)-2-amino-N-[(Z)-[(4R,5R)-5-(3,4-dihydro-2,4-dioxo-1(2H)-pyrimidinyl)dihydro-4-hydroxy-2(3H)-furanylidene]methyl]-3-(methylamino)-, (2S,3S)-. CAS No. 121264-06-0. Molecular formula: C39H49N9O12. Mole weight: 835.86.
Pacidamycin 3
It is produced by the strain of Str. coeruleorubidus AB 1183F-64. It has inhibitory effect on Pseudomonas aeruginosa. It also has effect on a few strains of bacteria such as suppurative staphylococcus and Escherichia coli. Serum can reduce its antibacterial activity, pH also affects its antibacterial activity. CAS No. 121280-49-7. Molecular formula: C39H49N9O13. Mole weight: 851.86.
Pacidamycin 4N
It is produced by the strain of Streptomyces coeruleorubidus NRRL 18370. It's a Pacidamycin antibiotic. It has the activity against pseudomonas aeruginosa with MIC of 4-16 μg/mL. it has no effect on other gram-negative bacteria and gram-positive bacteria, and no effect on drug-resistant pseudomonas aeruginosa. Molecular formula: C39H45N9O11. Mole weight: 815.83.
Pacidamycin 5
It is produced by the strain of Str. coeruleorubidus AB 1183F-64. It has inhibitory effect on Pseudomonas aeruginosa. It also has effect on a few strains of bacteria such as suppurative staphylococcus and Escherichia coli. Serum can reduce its antibacterial activity, pH also affects its antibacterial activity. Synonyms: 3,5,8,11-Tetraazatetradecanoicacid,13-amino-9-[[[(Z)-[(4R,5R)-5-(3,4-dihydro-2,4-dioxo-1(2H)-pyrimidinyl)dihydro-4-hydroxy-2(3H)-furanylidene]methyl]amino]carbonyl]-14-(3-hydroxyphenyl)-6,10,11-trimethyl-4,7,12-trioxo-2-(phenylmethyl)-, (2S,6S,9S,10S,13S)-. CAS No. 122855-43-0. Molecular formula: C36H44N8O11. Mole weight: 764.78.
Pacidamycin 5T
It is produced by the strain of Streptomyces coeruleorubidus NRRL 18370. Molecular formula: C36H44N8O12. Mole weight: 780.78.
Pacidamycin D
It is produced by the strain of Streptomyces coeruleorubidus NRRL 18370. It's a Pacidamycin antibiotic. It has the activity against pseudomonas aeruginosa with MIC of 4-16 μg/mL. it has no effect on other gram-negative bacteria and gram-positive bacteria, and no effect on drug-resistant pseudomonas aeruginosa. CAS No. 287107-95-3. Molecular formula: C32H41N9O10. Mole weight: 711.72.
Packaging
packaging bag
packaging bag. Group: Polymers.
Paclitaxel
United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standardsapi standardschiral moleculeseuropean pharmacopoeia (ph. eur.)impurity standardspharmaceutical toxicologypharmacopoeial standards. Alternative Names: Paclitaxel, 5beta,20-Epoxy-1,7beta-dihydroxy-9-oxotax-11-ene-2alpha,4,10beta,13alpha-tetrayl 4,10-diacetate 2-benzoate 13-[(2R,3S)-3-(benzoylamino)-2-hydroxy-3-phenylpropanoate], Taxol.
Paclitaxel
Paclitaxel. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Paclitaxel 7,11-Methano-5H-cyclodeca[3,4]benz[1,2-b]oxete benzenepropanoic acid deriv. Product Category: Promotional Products. Appearance: solid. CAS No. 33069-62-4. Molecular formula: C47H51NO14. Mole weight: 853.91. Purity: 95+%. IUPACName: [(1S,2S,3R,4S,7R,9S,10S,12R,15S)-4,12-diacetyloxy-15-[(2R,3S)-3-benzamido-2-hydroxy-3-phenylpropanoyl]oxy-1,9-dihydroxy-10,14,17,17-tetramethyl-11-oxo-6-oxatetracyclo[11.3.1.03,10.04,7]heptadec-13-en-2-yl] benzoate. Product ID: ACM33069624-2. Alfa Chemistry ISO 9001:2015 Certified.
Paclitaxel
Paclitaxel is a tetracyclic diterpenoid isolated originally from the bark of the Pacific yew tree, Taxus brevifolia. It is a mitotic inhibitor used in cancer chemotherapy. Note that the use of the former generic name 'taxol' is now limited, as Taxol is a registered trade mark. It has a role as a microtubule-stabilising agent, a metabolite, a human metabolite and an antineoplastic agent. It is a tetracyclic diterpenoid and a taxane diterpenoid. It is functionally related to a baccatin III. Alternative Names: P88XT4IS4D. Paclitaxel. Taxol. Taxol A. CAS No. 33069-62-4. Product ID: PIPE-0599. Molecular formula: C47H51NO14. Mole weight: 853.9. SMILES: CC1=C2[C@H](C(=O)[C@@]3([C@H](C[C@@H]4[C@]([C@H]3[C@@H]([C@@](C2(C)C)(C[C@@H]1OC(=O)[C@@H]([C@H](C5=CC=CC=C5)NC(=O)C6=CC=CC=C6)O)O)OC(=O)C7=CC=CC=C7)(CO4)OC(=O)C)O)C)OC(=O)C. Appearance: White Solid. Category: Natural Extract.
Paclitaxel
Paclitaxel is a compound with anti-tumor activity extracted from the Pacific yew tree Taxus brevifolia. Paclitaxel is a microtubule polymer stabilizer with IC50 of 0.1 pM in human endothelial cells. Uses: Adcs cytotoxin. Synonyms: Docetaxel EP Impurity F; BMS 181339-01; BMS181339-01; BMS-181339-01; Taxol A; Abraxane; Paxene; Taxol. Grade: >98%. CAS No. 33069-62-4. Molecular formula: C47H51NO14. Mole weight: 853.91.
Paclitaxel
Paclitaxel is a naturally occurring antineoplastic agent and stabilizes tubulin polymerization. Paclitaxel can cause both mitotic arrest and apoptotic cell death. Paclitaxel also induces autophagy [1] [2]. Uses: Scientific research. Group: Natural products. CAS No. 33069-62-4. Pack Sizes: 10 mM * 1 mL; 10 mg; 50 mg; 100 mg; 500 mg. Product ID: HY-B0015.
Paclitaxel
1g Pack Size. Group: Bioactive Small Molecules, Research Organics & Inorganics. Formula: C47H51NO14. CAS No. 33069-62-4. Prepack ID 51350888-1g. Molecular Weight 853.91. See USA prepack pricing.
25mg Pack Size. Group: Bioactive Small Molecules, Research Organics & Inorganics. Formula: C47H51NO14. CAS No. 33069-62-4. Prepack ID 51350888-25mg. Molecular Weight 853.91. See USA prepack pricing.
Paclitaxel
100mg Pack Size. Group: Bioactive Small Molecules, Research Organics & Inorganics. Formula: C47H51NO14. CAS No. 33069-62-4. Prepack ID 51350888-100mg. Molecular Weight 853.91. See USA prepack pricing.
Paclitaxel-13C
Paclitaxel-13C. Group: Biochemicals. Alternative Names: Abraxane-13C. Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences.
Worldwide
Paclitaxel-[13C6]
Paclitaxel-[13C6] is the labelled analogue of Paclitaxel. Paclitaxel is a chemotherapy medication used to treat a number of types of cancer. CAS No. 379688-61-6. Molecular formula: C41[13C]6H51NO14. Mole weight: 859.86.
Paclitaxel 98+% (HPLC)
Paclitaxel 98+% (HPLC). Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 1mg, 5mg, 25mg. US Biological Life Sciences.
Worldwide
Paclitaxel C
Paclitaxel C. Group: Biochemicals. Alternative Names: N-Debenzoyl-N-hexanoylpaclitaxel; (-)-Taxuyunnanine; Taxol C. Grades: Highly Purified. CAS No. 153415-45-3. Pack Sizes: 1mg, 2mg, 5mg, 10mg. Molecular Formula: C46H57NO14. US Biological Life Sciences.
Worldwide
Paclitaxel-Curcumin Liposome (PEGylated)
Paclitaxel (PTX) is a taxane drug extracted from Taxus brevifolia, widely used in the treatment of breast cancer, ovarian cancer, non-small cell lung cancer, and other malignancies. Curcumin is a polyphenolic compound with various pharmacological effects such as tumor, anti-inflammatory and antioxidant. This product is a pre-formulated liposome encapsulating Paclitaxel and Curcumin. It is only for research purposes. Group: Drug-loaded liposome.
Paclitaxel-[d5]
Paclitaxel-[d5] is the labelled analogue of Paclitaxel, which is isolated from the Pacific yew and approved as a chemotherapy medication. Synonyms: Paclitaxel-D5 (Benzoyloxy); (5beta,7beta,10beta,13alpha)-4,10-Bis(acetyloxy)-13-{[(2R,3S)-3-benzamido-2-hydroxy-3-phenylpropanoyl]oxy}-1,7-dihydroxy-9-oxo-5,20-epoxytax-11-en-2-yl (2H5)benzoate. Grade: 95% by HPLC; 95% atom D. CAS No. 1261254-56-1. Molecular formula: C47H46D5NO14. Mole weight: 858.94.
Paclitaxel-d5 (Taxol-d5)
An antineoplastic. Used in the study of structure and function of microtubles into tubulin. Group: Biochemicals. Alternative Names: Taxol-d5. Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences.
Worldwide
Paclitaxel EP Impurity B (Cephalomannine)
Cephalomannine is an active anti-cancer agent obtained from Taxus yunnanensis and has an antineoplastic effect on tumors found in mice. Uses: Antitumor. Synonyms: 4,10β-Bis(acetyloxy)-1,7β-dihydroxy-13α-[[(2R,3S)-2-hydroxy-3-[[(2E)-2-methylbut-2-enoyl]amino]-3-phenylpropanoyl]oxy]-9-oxo-5β,20-epoxytax-11-en-2α-yl benzoate; N-Debenzoyl-N-tigloylpaclitaxel; Benzenepropanoic acid, α-hydroxy-β-[[(2E)-2-methyl-1-oxo-2-buten-1-yl]amino]-, (2aR,4S,4aS,6R,9S,11S,12S,12aR,12bS)-6,12b-bis(acetyloxy)-12-(benzoyloxy)-2a,3,4,4a,5,6,9,10,11,12,12a,12b-dodecahydro-4,11-dihydroxy-4a,8,13,13-tetramethyl-5-oxo-7,11-methano-1H-cyclodeca[3,4]benz[1,2-b]oxet-9-yl ester, (αR,βS)-; NSC 318735; Taxol B; USP Paclitaxel Related Compound A; Paclitaxel impurity B; Benzenepropanoic acid, α-hydroxy-β-[(2-methyl-1-oxo-2-butenyl)amino]-, 6,12b-bis(acetyloxy)-12-(benzoyloxy)-2a,3,4,4a,5,6,9,10,11,12,12a,12b-dodecahydro-4,11-dihydroxy-4a,8,13,13-tetramethyl-5-oxo-7,11-methano-1H-cyclodeca[3,4]benz[1,2-b]oxet-9-yl ester, [2aR-[2aα,4β,4aβ,6β,9α[αR*,βS*(E)],11α,12α,12aα,12bα]]-; Paclitaxel Related Compound A; Paclitaxel USP Related Compound A. Grade: 96%. CAS No. 71610-00-9. Molecular formula: C45H53NO14. Mole weight: 831.90.