A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| Asp-26-Calcitonin | Asp-26-Calcitonin is an impurity of Calcitonin salmon, which is a calcium regulating hormone used to be an effective alternative for the treatment of postmenopausal osteoporosis. Synonyms: H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bond between Cys1 and Cys7); L-cysteinyl-L-seryl-L-asparagyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-α-aspartyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolinamide (1->7)-disulfide. Molecular formula: C145H239N43O49S2. Mole weight: 3432.88. |  |
| ASP2905 | ASP2905 is an orally active potassium channel Kv12.2 inhibitor encoded by the Kcnh3/BEC1 gene. ASP2905 can cross the blood-brain barrier and has antipsychotic activities[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 792184-90-8. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-122015. |  |
| ASP 2905 | ASP 2905 is a potent and selective potassium channel KCNH3 (Kv12.2) inhibitor with an IC50 of 9.0 nM. KCNH3 is concentrated in the forebrain, and its overexpression in mice leads to cognitive deficits. ASP 2905 has been identified as a candidate for the treatment of attention deficit/hyperactivity disorder. Synonyms: N2-(4-Fluorophenyl)-N4-phenyl-N6-(pyrimidin-2-ylmethyl)-1,3,5-triazine-2,4,6-triamine. Grade: 98%. CAS No. 792184-90-8. Molecular formula: C20H17FN8. Mole weight: 388.40. | |
| ASP 3026 | ASP 3026. Group: Biochemicals. Grades: Purified. CAS No. 1097917-15-1. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. |  Worldwide |
| ASP-3026 | ASP3026 is a novel and selective inhibitor for the ALK kinase. ASP3026 potently inhibited ALK kinase activity and was more selective than crizotinib in a Tyr-kinase panel. In an anchorage independent in vitro cell growth assay, ASP3026 inhibited the growth of NCI-H2228, a human NSCLC tumor cell line endogenously expressing EML4-ALK variant 3 and that of 3T3 cells expressing EML4-ALK variant 1, 2 and 3. Synonyms: ASP3026; ASP 3026. Grade: 0.98. CAS No. 1097917-15-1. Molecular formula: C29H40N8O3S. Mole weight: 580.74. | |
| Asp(3)-Calcitonin (salmon) | Asp(3)-Calcitonin is an impurity of Calcitonin salmon, which is a calcium regulating hormone used to be an effective alternative for the treatment of postmenopausal osteoporosis. Synonyms: Cys-Ser-Asp-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2(Cys1&Cys7 bridge); Asp3-Calcitonin(salmon); [Asp3]-Calcitonin (salmon); Calcitonin C; H-Cys-Ser-Asp-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2; CSDLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2(Cys1&Cys7 bridge); L-Cysteinyl-L-seryl-L-alpha-aspartyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-asparagyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolinamide (1->7)-disulfide; Asp(3)-Calcitonin. Grade: >90%. Molecular formula: C145H239N43O49S2. Mole weight: 3432.88. | |
| ASP-4000 | ASP-4000 is a dipeptidyl peptidase 4 (DPP) inhibitor with antihyperglycemic activity. Uses: Hyperlipidaemia;hyperlipoproteinaemia type iia;primary biliary cirrhosis. Synonyms: ASP4000; ASP-4000 free base; 2-Pyrrolidinecarbonitrile, 1-(((1R,3S,4S,6R)-6-hydroxy-2-azabicyclo(2.2.1)hept-3-yl)carbonyl)-, (2S)-. Grade: 98%. CAS No. 851510-67-3. Molecular formula: C12H17N3O2. Mole weight: 235.28. | |
| ASP-4000 hydrochoride | ASP-4000 is a dipeptidyl peptidase 4 (DPP) inhibitor. It has antihyperglycemic activity. Uses: Antihyperglycemic agent. Synonyms: ASP-4000 hydrochoride; ASP 4000 hydrochoride; ASP4000 hydrochoride; UNII-7393JFE67B; (2S)-1-(((1R,3S,4S,6R)-6-Hydroxy-2-azabicyclo(2.2.1)hept-3-yl)carbonyl)-2-pyrrolidinecarbonitrile hydrochloride. Grade: 98%. CAS No. 851389-35-0. Molecular formula: C12H18ClN3O2. Mole weight: 271.74. | |
| ASP-4058 | ASP-4058 is a selective, next-generation and orally active Sphingosine 1-Phosphate receptors 1 and 5 (S1P1 and S1P5) agonist. It ameliorates experimental autoimmune encephalomyelitis in rodent with a favorable safety profile. Synonyms: 1H-Benzimidazole, 5-[5-[3-(trifluoromethyl)-4-[(1S)-2,2,2-trifluoro-1-methylethoxy]phenyl]-1,2,4-oxadiazol-3-yl]-; 5-{5-[3-(Trifluoromethyl)-4-{[(2S)-1,1,1-trifluoro-2-propanyl]oxy}phenyl]-1,2,4-oxadiazol-3-yl}-1H-benzimidazole. Grade: ≥95%. CAS No. 952565-91-2. Molecular formula: C19H12F6N4O2. Mole weight: 442.31. | |
| ASP-4058 hydrochloride | ASP-4058 hydrochloride is a selective, next-generation and orally active Sphingosine 1-Phosphate receptors 1 and 5 (S1P1 and S1P5) agonist. It ameliorates experimental autoimmune encephalomyelitis in rodent with a favorable safety profile. Synonyms: 5-(5-(3-(Trifluoromethyl)-4-(((2S)-1,1,1-trifluoropropan-2-yl)oxy)phenyl)-1,2,4-oxadiazol-3-yl)-1H-benzimidazole hydrochloride; 1H-Benzimidazole, 6-(5-(3-(trifluoromethyl)-4-((1S)-2,2,2-trifluoro-1-methylethoxy)phenyl)-1,2,4-oxadiazol-3-yl)-, hydrochloride (1:1). Grade: ≥95%. CAS No. 952510-14-4. Molecular formula: C19H13ClF6N4O2. Mole weight: 478.78. | |
| ASP4132 | ASP4132 is an orally active activator of adenosine monophosphate-activated protein kinase (AMPK) with EC50 of 0.018 μM. CAS No. 1640294-30-9. Molecular formula: C46H51F3N6O8S2. Mole weight: 937.06. | |
| ASP-5854 | ASP-5854 is an adenosine A1 and A2A receptor antagonist receptor. It has therapeutic potential for the treatment of Parkinson's disease to ameliorate motor deficiencies. Uses: Parkinson's disease. Synonyms: ASP-5854; ASP 5854; ASP5854; UNII-BJS8Y4IC5V; C524699; 5-(5-amino-3-(4-fluorophenyl)-2-pyrazinyl)-1-(1-methylethyl)-2(1H)-Pyridinone. Grade: 98%. CAS No. 851087-60-0. Molecular formula: C18H17FN4O. Mole weight: 324.35. | |
| ASP5878 | ASP5878 is a potent and selective inhibitor of fibroblast growth factor receptor (FGFR). Synonyms: ASP-5878; ASP 5878. CAS No. 1453208-66-6. Molecular formula: C18H19F2N5O4. Mole weight: 407.37. | |
| Asp5-Atosiban | An impurity of Atosiban. Atosiban is a synthetic peptide that acts as a selective oxytocin receptor antagonist, primarily used to delay preterm labor in pregnant women. Synonyms: Mpr-DTyr(Et)-Ile-Thr-Asp-Cys-Pro-Orn-Gly-NH2(Mpr1&Cys6 bridge); deamino-Cys-D-Tyr(Et)-Ile-Thr-Asp-Cys-Pro-Orn-Gly-NH2 (Disulfide bridge: Cys1-Cys6); Deamino-cysteinyl-O4-ethyl-D-tyrosyl-L-isoleucyl-L-threonyl-L-alpha-aspartyl-L-cysteinyl-L-prolyl-L-ornithyl-glycinamide (1->6)-disulfide; [Asp5]-Atosiban; Asp(5)-Atosiban. Grade: ≥95%. CAS No. 2014351-16-5. Molecular formula: C43H66N10O13S2. Mole weight: 995.18. | |
| Asp(5)-AVP | Asp(5)-AVP is an impurity of Vasopressin, which is an antidiuretic hormone secreted from the posterior pituitary. Synonyms: Asp5-AVP; Asp(5)-Arg-Vasopressin; Asp(5)-Vasopressin; Vasopressin, 5-L-aspartic acid-8-L-arginine-; H-Cys-Tyr-Phe-Gln-Asp-Cys-Pro-Arg-Gly-NH2 (Disulfide bridge: Cys1-Cys6); L-cysteinyl-L-tyrosyl-L-phenylalanyl-L-glutaminyl-L-aspartyl-L-cysteinyl-L-prolyl-L-arginyl-glycinamide (1->6)-disulfide. CAS No. 78031-79-5. Molecular formula: C46H64N14O13S2. Mole weight: 1085.22. | |
| Asp 5-Oxytocin | Asp 5-Oxytocin is an impurity of Oxytocin, which is a mammalian neurohypophysial hormone used as a vasodilator agent. Synonyms: [5-Aspartic acid]oxytocin; L-Cystyl-L-tyrosyl-L-isoleucyl-L-glutaminyl-L-aspartyl-L-cystyl-L-leucyl-L-prolyl-L-glycinamide (disulfide bridge between cysteines); H-Cys-Tyr-Ile-Gln-Asp-Cys-Pro-Leu-Gly-NH2 (Disulfide bridge: Cys1-Cys6); Oxytocin, 5-L-aspartic acid-; [5-Aspartic acid]-oxytocin; L-Cysteinyl-L-tyrosyl-L-isoleucyl-L-glutaminyl-L-alpha-aspartyl-L-cysteinyl-L-prolyl-L-leucyl-glycinamide (1->6)-disulfide; [Asp5]-Oxytocin; Oxytocin EP Impurity I; 5-L-Aspartic acid-oxytocin; 5-Asp-oxytocin; Asp5-Oxytocin; Asp5-Oxytocin; CYIQDCPLG-NH2(Cys1&Cys6 bridge); Cys-Tyr-Ile-Gln-Asp-Cys-Pro-Leu-Gly-NH2(Cys1&Cys6 bridge). Grade: ≥95%. CAS No. 65907-78-0. Molecular formula: C43H65N11O13S2. Mole weight: 1008.18. | |
| ASP6432 | ASP6432 is a potent and selective type 1 lysophosphatidic acid receptor (LPA1) antagonist with IC50s of 11 nM and 30 nM for human LPA1 and rat LPA1, respectively[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1282549-08-9. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-120478. | |
| ASP-7657 | ASP-7657 is an analgesic and anti-inflammatory agent for the treatment of diabetic neuropathies developed by Astellas Pharma. A phase I clinical trial to evaluate the safety and tolerability of single and multiple ascending oral doses of ASP7657 in healthy subjects was started in 2014 but discontinued in 2015. Uses: An analgesics and anti-inflammatories for the treatment of diabetic neuropathies. Synonyms: ASP 7657; ASP7657; trans-4-[[[[1-(2-quinolinylmethyl)-5-(trifluoromethyl)-1H-indol-7-yl]carbonyl]amino]methyl]-cyclohexanecarboxylic acid. Grade: ≥98%. CAS No. 1196045-28-9. Molecular formula: C28H26F3N3O3. Mole weight: 509.52. | |
| ASP7663 | ASP7663 is an orally active and selective TRPA1 agonist. ASP7663 exerts both anti-constipation and anti-abdominal pain actions[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1190217-35-6. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-101907. | |
| ASP 7663 | ASP 7663 has been found to be a TRPA1 activator and could show abdominal analgesic activities. Synonyms: ASP7663; ASP-7663; ASP 7663; (2E)-2-[7-Fluoro-1,2-dihydro-1-(2-methylpropyl)-2-oxo-3H-indol-3-ylidene]acetic acid. Grade: ≥98% by HPLC. CAS No. 1190217-35-6. Molecular formula: C14H14FNO3. Mole weight: 263.26. | |
| ASP 7663 | ASP 7663. Group: Biochemicals. Grades: Purified. CAS No. 1190217-35-6. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| Asp(7)-Linaclotide | Asp(7)-Linaclotde is an impurity of Linaclotide, which is a peptide agonist of guanylate cyclase 2C used for the treatment of abdominal pain in patients with irritable bowel syndrome (IBS) associated with constipation. Synonyms: L-cysteinyl-L-cysteinyl-L-alpha-glutamyl-L-tyrosyl-L-cysteinyl-L-cysteinyl-L-α-aspartyl-L-prolyl-L-alanyl-L-cysteinyl-L-threonyl-glycyl-L-cysteinyl-L-tyrosine (1-6),(2-10),(5-13)-tris(disulfide); H-Cys-Cys-Glu-Tyr-Cys-Cys-Asp-Pro-Ala-Cys-Thr-Gly-Cys-Tyr-OH (Disulfide bridge: Cys1-Cys6, Cys2-Cys10, Cys5-Cys13); [7-Asp]-linaclotide; L-Tyrosine, L-cysteinyl-L-cysteinyl-L-α-glutamyl-L-tyrosyl-L-cysteinyl-L-cysteinyl-L-α-aspartyl-L-prolyl-L-alanyl-L-cysteinyl-L-threonylglycyl-L-cysteinyl-, cyclic (1→6),(2→10),(5→13)-tris(disulfide). CAS No. 1207977-38-5. Molecular formula: C59H78N14O22S6. Mole weight: 1527.71. | |
| ASP8302 | ASP8302 is a positive and allosteric muscarinic M3 receptor modulator. ASP8302 improves voiding efficiency and reduced residual urine volume in two voiding dysfunction models. ASP8302 can be used for research of underactive bladder[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1839583-42-4. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-160888. | |
| ASP-8497 | ASP8497 is a long-acting and potent DPP-IV inhibitor. It improves glucose tolerance through glucose-dependent insulinotropic action via elevation of the GLP-1 level. It is used as a therapeutic agent for impaired glucose tolerance and type 2 diabetes. Uses: Asp8497 is used as a therapeutic agent for impaired glucose tolerance and type 2 diabetes. Synonyms: 2-Pyrrolidinecarbonitrile, 4-fluoro-1-(((4-methyl-1-(methylsulfonyl)-4-piperidinyl)amino)acetyl)-, (2S,4S)-(2E)-2-butenedioate (1:1); ASP8497; ASP 8497; (E)-but-2-enedioic acid (2S,4S)-4-fluoro-1-[2-[(4-methyl-1-methylsulfonylpiperidin-4-yl)amino]acetyl]pyrrolidine-2. Grade: 98%. CAS No. 651055-26-4. Molecular formula: C18H27FN4O7S. Mole weight: 462.49. | |
| ASP-8497 free base | ASP-8497 free base is a long-acting and potent DPP-IV inhibitor. It improves glucose tolerance through glucose-dependent insulinotropic action via elevation of the GLP-1 level. It is used as a therapeutic agent for impaired glucose tolerance and type 2 diabetes. Uses: Asp-8497 free base is used as a therapeutic agent for impaired glucose tolerance and type 2 diabetes. Synonyms: 2-Pyrrolidinecarbonitrile, 4-fluoro-1-(((4-methyl-1-(methylsulfonyl)-4-piperidinyl)amino)acetyl)-, (2S,4S)-; (2S,4S)-4-fluoro-1-[2-[(4-methyl-1-methylsulfonylpiperidin-4-yl)amino]acetyl]pyrrolidine-2-carbonitrile; ASP8497; ASP 8497 free base. Grade: 98%. CAS No. 651055-25-3. Molecular formula: C14H23FN4O3S. Mole weight: 346.42. | |
| ASP-8731 | ASP-8731 is an orally active BACH1 inhibitor. ASP-8731 activates antioxidant, anti-inflammatory and globin gene pathways by relieving the inhibitory effect of BACH1 on NRF2-mediated gene transcription. ASP-8731 significantly upregulates the expression of HMOX1, FTH1 and various globins (such as HGB, HBG, HBA), increases fetal hemoglobin (HbF) levels, and effectively induces F-cell production in hydroxyurea-unresponsive cells. Meanwhile, ASP-8731 reduces inflammatory responses and white blood cell counts by downregulating VCAM1, ICAM-1 and the phosphorylation level of NF-κB(p65), and blocks heme-induced glutathione depletion and microcirculatory stasis. ASP-8731 holds potential for inhibiting sickle cell disease and related hematological disorders[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2488255-42-9. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-167874. | |
| Asp8,Gly12-Terlipressin | An impurity of Terlipressin. Terlipressin is a synthetic vasopressin analogue primarily used to improve kidney function in adults with hepatorenal syndrome (HRS), a condition that causes kidney problems in individuals with severe liver disease. It acts as a vasoconstrictor, predominantly in the splanchnic circulation, which helps increase arterial pressure and reduce portal venous pressure. Synonyms: Gly-Gly-Gly-Cys-Tyr-Phe-Gln-Asp-Cys-Pro-Lys-Gly(Cys4&Cys9 bridge); [8-L-aspartic acid,12-glycine]terlipressin; Terlipressin EP Impurity L; H-Gly-Gly-Gly-Cys-Tyr-Phe-Gln-Asp-Cys-Pro-Lys-Gly-OH (Disulfide bridge: Cys4-Cys9); Glycyl-glycyl-glycyl-L-cysteinyl-L-tyrosyl-L-phenylalanyl-L-α-aspartyl-L-asparagyl-L-cysteinyl-L-prolyl-L-lysyl-glycine (4->9)-disulfide; GGGCYFQDCPKG(Cys4&Cys9 bridge); [Asp8, Gly12]-Terlipressin; Terlipressin Impurity L; [Asp(8), Gly(12)]-Terlipressin [Asp(8)-TLY-COOH]. Grade: ≥95%. Molecular formula: C52H72N14O17S2. Mole weight: 1229.35. | |
| Asp8-Terlipressin | An impurity of Terlipressin. Terlipressin is a synthetic vasopressin analogue primarily used to improve kidney function in adults with hepatorenal syndrome (HRS), a condition that causes kidney problems in individuals with severe liver disease. It acts as a vasoconstrictor, predominantly in the splanchnic circulation, which helps increase arterial pressure and reduce portal venous pressure. Synonyms: Gly-Gly-Gly-Cys-Tyr-Phe-Gln-Asp-Cys-Pro-Lys-Gly-NH2(Cys4&Cys9 bridge); α-Asp(8)-Terlipressin; GGGCYFQDCPKG-NH2(Cys4&Cys9 bridge); N-[N-(N-Glycylglycyl)glycyl]-5-L-aspartic acid-8-L-lysine-vasopressin; Terlipressin EP Impurity H; [8-L-α-aspartic acid]terlipressin; H-Gly-Gly-Gly-Cys-Tyr-Phe-Gln-Asp-Cys-Pro-Lys-Gly-NH2 (Disulfide bridge: Cys4-Cys9); Glycyl-glycyl-glycyl-L-cysteinyl-L-tyrosyl-L-phenylalanyl-L-glutaminyl-L-α-aspartyl-L-cysteinyl-L-prolyl-L-lysyl-glycinamide (4->9)-disulfide; [Asp8]-Terlipressin; Asp(8)-Terlipressin. Grade: ≥95%. CAS No. 159594-68-0. Molecular formula: C52H73N15O16S2. Mole weight: 1228.37. | |
| ASP-9521 | ASP-9521 is a potent, selective and orally available AKR1C3 inhibitor with an IC50 of 11 nM for human AKR1C3. Uses: Scientific research. Category: Signaling pathways. CAS No. 1126084-37-4. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 200 mg. Product ID: HY-19903. | |
| ASP-9521 | ASP9521 is a novel, selective, orally bioavailable inhibitor of 17β-hydroxysteroid dehydrogenase type 5 (17βHSD5; AKR1C3). ASP9521 has demonstrated anti-tumour activity in in vitro and in vivo preclinical models. ASP9521 inhibited conversion of androstenedione (AD) into testosterone (T) by recombinant human or cynomolgus monkey AKR1C3 in a concentration-dependent manner. Synonyms: ASP9521; ASP-9521; ASP 9521. AKR1C3 inhibitor ; 17HSD5 inhibitor; 4-(2-Hydroxy-2-methylpropyl)piperidino(5-methoxy-1H-indole-2-yl)methanone; 1-[1-[(5-Methoxy-1H-indol-2-yl)carbonyl]piperidin-4-yl]-2-methylpropan-2-ol. Grade: 98%. CAS No. 1126084-37-4. Molecular formula: C19H26N2O3. Mole weight: 330.428. | |
| ASP-9521 (Standard) | ASP-9521 (Standard) is the analytical standard of ASP-9521. This product is intended for research and analytical applications. ASP-9521 is a potent, selective and orally available AKR1C3 inhibitor with an IC50 of 11 nM for human AKR1C3. Uses: Scientific research. Category: Signaling pathways. CAS No. 1126084-37-4. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-19903R. | |
| Asp9-Bivalirudin | Asp9-Bivalirudin is a modified analog of the anticoagulant peptide Bivalirudin, with an aspartic acid residue at the 9th position. Bivalirudin is a direct thrombin inhibitor used as an anticoagulant to prevent blood clots in patients undergoing certain medical procedures or with specific conditions. Synonyms: H-D-Phe-Pro-Arg-Pro-Gly-Gly-Gly-Gly-Asp-Gly-Asp-Phe-Glu-Glu-Ile-Pro-Glu-Glu-Tyr-Leu-OH; D-Phenylalanyl-L-prolyl-L-arginyl-L-prolylglycylglycylglycylglycyl-L-α-aspartylglycyl-L-α-aspartyl-L-phenylalanyl-L-α-glutamyl-L-α-glutamyl-L-isoleucyl-L-prolyl-L-α-glutamyl-L-α-glutamyl-L-tyrosyl-L-leucine; [Asp9]-Bivalirudin; DPhe-PRPGGGGDGDFEEIPEEYL; DPhe-Pro-Arg-Pro-Gly-Gly-Gly-Gly-Asp-Gly-Asp-Phe-Glu-Glu-Ile-Pro-Glu-Glu-Tyr-Leu. Grade: ≥95%. CAS No. 1182140-65-3. Molecular formula: C98H137N23O34. Mole weight: 2181.27. | |
| AspA2 I | One unit of the enzyme is the amount required to hydrolyze 1 μg of Lambda DNA (HindIII-digest) in 1 hour at 37°C in a total reaction volume of 50 μl. Applications: After 10-fold overdigestion with enzyme more than 90% of the dna fragments can be ligated and recut. Group: Restriction Enzymes. Purity: 500U; 2500U. C↑CTAGG GGATC↓C. Activity: 10000u.a./ml. Storage: -20°C. Form: Liquid. Source: Arthrobacter species A2. Pack: 10 mM Tris-HCl (pH 7.5); 100 mM NaCl; 0.1 mM EDTA; 7 mM 2-mercaptoethanol; 100 μg/ml BSA; 50% glycerol. Cat No: RE-1024EN. |  |
| asparaginase | Asparaginase, also known as crisantaspase, is an enzyme that is used as a medication and in food manufacturing. As a medication it is used to treat acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), and non-Hodgkin's lymphoma. It is given by injection into a vein, muscle, or under the skin. A pegylated version is also available. In food manufacturing it is used to decrease the acrylamide. Group: Enzymes. Synonyms: asparaginase II; L-asparaginase; colaspase; elspar; leunase; crasnitin; α-asparaginase. Enzyme Commission Number: EC 3.5.1.1. CAS No. 9015-68-3. Asparaginase. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4377; asparaginase; EC 3.5.1.1; 9015-68-3; asparaginase II; L-asparaginase; colaspase; elspar; leunase; crasnitin; α-asparaginase. Cat No: EXWM-4377. | |
| Asparaginase from E. coli, Recombinant | Asparaginase (EC 3.5.1.1, USAN) or Colaspase (BAN) is an enzyme that catalyzes the hydrolysis of asparagine to aspartic acid. Asparaginases are enzymes expressed and produced by microorganisms. Group: Enzymes. Synonyms: EC 3.5.1.1; Asparaginase; Colaspase; L-asparaginase; L-asparagine amidohydrolase. Enzyme Commission Number: EC 3.5.1.1. CAS No. 9015-68-3. Asparaginase. Mole weight: ~ 37,900. Activity: ~ 15 U/mg. Stability: > 4 years at 4°C. Storage: 4°C. Form: In 2.5 M lithium sulphate. Source: E. coli. EC 3.5.1.1; Asparaginase; Colaspase; L-asparaginase; L-asparagine amidohydrolase. Cat No: NATE-1932. | |
| Asparagine | Asparagine. CAS No. 70-47-3. Cenik is your partner of choice for specialised chemicals. We don't just provide products - we supply solutions to your technical and regulatory specifications. |  |
| Asparagine Monohydrate | Asparagine Monohydrate. Group: Biochemicals. Alternative Names: (±)-Asparagine; 2-Aminosuccinamic Acid; NSC 206243; NSC 7891; DL-Aspartamine. Grades: Highly Purified. CAS No. 3130-87-8. Pack Sizes: 10g. Molecular Formula: C4H10N2O4, Molecular Weight: 150.13. US Biological Life Sciences. | Worldwide |
| asparagine-oxo-acid transaminase | A pyridoxal-phosphate protein. Group: Enzymes. Synonyms: asparagine-keto acid aminotransferase. Enzyme Commission Number: EC 2.6.1.14. CAS No. 9030-43-7. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2854; asparagine-oxo-acid transaminase; EC 2.6.1.14; 9030-43-7; asparagine-keto acid aminotransferase. Cat No: EXWM-2854. | |
| asparagine synthase (glutamine-hydrolysing) | The enzyme from Escherichia coli has two active sites that are connected by an intramolecular ammonia tunnel. The enzyme catalyses three distinct chemical reactions: glutamine hydrolysis to yield ammonia takes place in the N-terminal domain. The C-terminal active site mediates both the synthesis of a β-aspartyl-AMP intermediate and its subsequent reaction with ammonia. The ammonia released is channeled to the other active site to yield asparagine. Group: Enzymes. Synonyms: asparagine synthetase (glutamine-hydrolysing); glutamine-dependent asparagine synthetase; asparagine synthetase B; AS; AS-B. Enzyme Commission Number: EC 6.3.5.4. CAS No. 37318-72-2. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5807; asparagine synthase (glutamine-hydrolysing); EC 6.3.5.4; 37318-72-2; asparagine synthetase (glutamine-hydrolysing); glutamine-dependent asparagine synthetase; asparagine synthetase B; AS; AS-B. Cat No: EXWM-5807. | |
| asparagine-tRNA ligase | This enzyme belongs to the family of ligases, to be specific those forming carbon-oxygen bonds in aminoacyl-tRNA and related compounds. This enzyme participates in alanine and aspartate metabolism and aminoacyl-trna biosynthesis. Group: Enzymes. Synonyms: asparaginyl-tRNA synthetase; asparaginyl-transfer ribonucleate synthetase; asparaginyl transfer RNA synthetase; asparaginyl transfer ribonucleic acid synthetase; asparagyl-transfer RNA synthetase; asparagine translase. Enzyme Commission Number: EC 6.1.1.22. CAS No. 37211-76-0. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5654; asparagine-tRNA ligase; EC 6.1.1.22; 37211-76-0; asparaginyl-tRNA synthetase; asparaginyl-transfer ribonucleate synthetase; asparaginyl transfer RNA synthetase; asparaginyl transfer ribonucleic acid synthetase; asparagyl-transfer RNA synthetase; asparagine translase. Cat No: EXWM-5654. | |
| Asparaginyl-arginine | Asparaginyl-arginine. Molecular formula: C10H20N6O4. Mole weight: 288.3. | |
| Asparaginyl-asparagine | Asparaginyl-asparagine is a dipeptide composed of two L-asparagine. It is an incomplete breakdown product of protein digestion or protein catabolism. It has a role as a Mycoplasma genitalium metabolite. Synonyms: L-Asparagine, L-asparaginyl-; H-NN-OH; Asn-Asn; L-Asparaginyl-L-asparagine; Asparagylasparagin; L-Asn-L-Asn; (S)-4-Amino-2-((S)-2,4-diamino-4-oxobutanamido)-4-oxobutanoic acid. Grade: ≥95%. CAS No. 58471-52-6. Molecular formula: C8H14N4O5. Mole weight: 246.22. | |
| Asparaginyl-glutamine | Asparaginyl-glutamine is a dipeptide composed of asparagine and glutamine. CAS No. 14608-83-4. Molecular formula: C9H16N4O5. Mole weight: 260.25. | |
| Asparaginyl-glycine | Asparaginyl-glycine is a dipeptide composed of asparagine and glycine. It is an incomplete breakdown product of protein digestion or protein catabolism. Synonyms: Glycine, N-L-asparaginyl-; H-NG-OH; L-asparagyl-glycine; L-asparaginylglycine; Asn-Gly; L-Asn-Gly; (S)-2-(2,4-Diamino-4-oxobutanamido)acetic acid. Grade: ≥95%. CAS No. 67576-72-1. Molecular formula: C6H11N3O4. Mole weight: 189.17. | |
| Asparaginyl-histidine | Asparaginyl-histidine is a dipeptide composed of asparagine and histidine. Synonyms: L-Asparaginyl-L-histidine. CAS No. 224638-52-2. Molecular formula: C10H15N5O4. Mole weight: 269.26. | |
| Asparaginyl-isoleucine | Asparaginyl-isoleucine is a dipeptide composed of asparagine and isoleucine. It is an incomplete breakdown product of protein digestion or protein catabolism. Synonyms: L-Isoleucine, L-asparaginyl-; L-asparaginyl-L-isoleucine; Asn-Ile; NI dipeptide; H-NI-OH; H-L-Asn-L-Ile-OH. Grade: ≥98%. CAS No. 438533-59-6. Molecular formula: C10H19N3O4. Mole weight: 245.28. | |
| Asparaginyl-lysine | Asparaginyl-Lysine is a dipeptide composed of asparagine and lysine. Synonyms: Asn-Lys; NK dipeptide. CAS No. 22677-58-3. Molecular formula: C10H20N4O4. Mole weight: 260.29. | |
| Asparaginyl-phenylalanine | Asparaginyl-Phenylalanine is a dipeptide composed of asparagine and phenylalanine. Synonyms: L-Asparaginyl-L-phenylalanine; Asn-Phe. CAS No. 22849-01-0. Molecular formula: C13H17N3O4. Mole weight: 279.29. | |
| Asparaginyl-proline | Asparaginyl-proline is a dipeptide composed of asparagine and proline. It is an incomplete breakdown product of protein digestion or protein catabolism. Synonyms: L-Proline, 1-L-asparaginyl-; H-NP-OH; L-asparagyl-L-proline; Asn-Pro; L-Asn-L-Pro. Grade: ≥95%. CAS No. 78346-95-9. Molecular formula: C9H15N3O4. Mole weight: 229.23. | |
| Asparaginyl-serine | Asparaginyl-serine is a dipeptide composed of asparagine and serine. It is an incomplete breakdown product of protein digestion or protein catabolism. Synonyms: L-Serine, L-asparaginyl-; Asn-Ser; L-Asn-L-Ser; L-Asparaginyl-L-serine; H-NS-OH; Asparaginylserine. Grade: ≥95%. CAS No. 92172-15-1. Molecular formula: C7H13N3O5. Mole weight: 219.20. | |
| asparaginyl-tRNA synthase (glutamine-hydrolysing) | This reaction forms part of a two-reaction system for producing asparaginyl-tRNA in Deinococcus radiodurans and other organisms lacking a specific enzyme for asparagine synthesis. In the first step, a non-discriminating ligase (EC 6.1.1.23, aspartate-tRNAAsn ligase) mischarges tRNAAsn with aspartate, leading to the formation of Asp-tRNAAsn. The aspartyl-tRNAAsn is not used in protein synthesis until the present enzyme converts it into asparaginyl-tRNAAsn (aspartyl-tRNAAsp is not a substrate for this reaction). Ammonia or asparagine can substitute for the preferred substrate glutamine. Group: Enzymes. Synonyms: Asp-AdT; Asp-tRNAAsn amidotransferase; aspartyl-tRNAAsn amidotransferase; Asn-tRNAAsn:L-glutamine amido-ligase (ADP-forming); aspartyl-tRNAAsn:L-glutamine amido-ligase (ADP-forming). Enzyme Commission Number: EC 6.3.5.6. CAS No. 37211-76-0. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5809; asparaginyl-tRNA synthase (glutamine-hydrolysing); EC 6.3.5.6; 37211-76-0; Asp-AdT; Asp-tRNAAsn amidotransferase; aspartyl-tRNAAsn amidotransferase; Asn-tRNAAsn:L-glutamine amido-ligase (ADP-forming); aspartyl-tRNAAsn:L-glutamine amido-ligase (ADP-forming). Cat No: EXWM-5809. | |
| Asparaginyl-tryptophan | Asparaginyl-tryptophan is a dipeptide composed of asparagine and tryptophan. It is an incomplete breakdown product of protein digestion or protein catabolism. Synonyms: L-Tryptophan, L-asparaginyl-; H-NW-OH; L-asparagyl-L-tryptophan; Asn-Trp; Asparaginyltryptophan; L-Tryptophan, N-L-asparaginyl-. Grade: ≥95%. CAS No. 74105-03-6. Molecular formula: C15H18N4O4. Mole weight: 318.33. | |
| asparagusate reductase | Also acts on lipoate. Group: Enzymes. Synonyms: asparagusate dehydrogenase; asparagusic dehydrogenase; asparagusate reductase (NADH2); NADH2:asparagusate oxidoreductase. Enzyme Commission Number: EC 1.8.1.11. CAS No. 56126-52-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1637; asparagusate reductase; EC 1.8.1.11; 56126-52-4; asparagusate dehydrogenase; asparagusic dehydrogenase; asparagusate reductase (NADH2); NADH2:asparagusate oxidoreductase. Cat No: EXWM-1637. | |
| Asparagusic acid | Asparagusic acid is a sulfur-containing flavor component produced by Asparagus officinalis Linn., with anti-parasitic effect. Asparagusic acid is a plant growth inhibitor[1][2][3]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2224-2-4. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-50730. | |
| Asparagus Officinalis Stem Extract | Highly purified asparagus (Asparagus officinalis) extract. CAS No. 84649-90-1. Product ID: CI-SC-0635. Alfa Chemistry - ISO 9001:32057 Certified. |  |
| Asparagus Powder(Asparagus officinalis) | Asparagus Powder(Asparagus officinalis). |  CA, FL & NJ |
| Asparenomycin A | Asparenomycin A is a carbapenem antibiotic produced by Streptomyces tokunonensis sp. (PA-31088) and Srt.argenteolus (PA-39504). It has anti-gram-positive and negative bacteria activity, can inhibit a variety of β-lactamases, and also has an effect on β-lactamase-producing strains. Synonyms: Asparenomycin. CAS No. 76466-24-5. Molecular formula: C14H16N2O6S. Mole weight: 340.35. | |
| Asparenomycin B | Asparenomycin B is a carbapenem antibiotic produced by Streptomyces tokunonensis sp. (PA-31088) and Srt.argenteolus (PA-39504). It has anti-gram-positive and negative bacteria activity, can inhibit a variety of β-lactamases, and also has an effect on β-lactamase-producing strains. CAS No. 79366-72-6. Molecular formula: C14H18N2O6S. Mole weight: 342.37. | |
| Asparenomycin C | Asparenomycin C is a carbapenem antibiotic produced by Streptomyces tokunonensis sp. (PA-31088) and Srt.argenteolus (PA-39504). It has anti-gram-positive and negative bacteria activity, can inhibit a variety of β-lactamases, and also has an effect on β-lactamase-producing strains. CAS No. 81018-71-5. Molecular formula: C14H16N2O5S. Mole weight: 324.35. | |
| Aspartame | Aspartame. Synonyms: Asp-Phe methyl ester, N-(L-α-Aspartyl)-L-phenylalanine methyl ester, Asp-Phe-OMe, Aspartame. CAS No. 22839-47-0. Pack Sizes: pkg of 500 mg. Product ID: CDC10-0186. Molecular formula: C14H18N2O5. Category: Flavoring Chemical Agents. Product Keywords: Cosmetic Ingredients; Flavoring Chemical Agents; Aspartame; CDC10-0186; 22839-47-0; C14H18N2O5; Asp-Phe methyl ester, N-(L-α-Aspartyl)-L-phenylalanine methyl ester, Asp-Phe-OMe, Aspartame; 245-261-3; MFCD00002724; 22839-47-0. Grade: analytical standard. Color: White. EC Number: 245-261-3. Physical State: Powder. Solubility: Sparingly soluble or slightly soluble in water and in ethanol (96 per cent), practically insoluble in hexane and in methylene chloride. Quality Level: 100. Storage: 2-8°C. Application: Refer to the product's Certificate of Analysis for more information on a suitable instrument technique. Contact Technical Service for further support. Boiling Point: 436.08°C (rough estimate). Melting Point: 242-248 °C. Density: 1.2051 g/mL(rough estimate). |  |
| Aspartame | Aspartame is an artificial, non-saccharide sweetener used as a sugar substitute in some foods and beverages. Uses: Aspartame is a dipeptide compound composed of two amino acids (aspartic acid and phenylalanine) and a methyl ester bond. it was discovered in 1965 and approved for use by the u.s. food and drug administration (fda) in 1981. aspartame is extremely sweet, about 200 times sweeter than sucrose (table sugar), so only a very small amount is needed to achieve the desired sweetness. aspartame is often use. Synonyms: L-α-Aspartyl-L-phenylalanine 2-Methyl Ester; Canderel; Dipeptide Sweetener; E 951; Equal; Finn; L-Aspartame; NutraSweet; Pal Sweet; Palsweet Diet; Sweet Dipeptide; Zero-Cal; α-Aspartame; α-L-Aspartyl-L-phenylalanine Methyl Ester; α-Sweet. Grade: >98%. CAS No. 22839-47-0. Molecular formula: C14H18N2O5. Mole weight: 294.31. | |
| Aspartame | Aspartame. Synonyms: c-mer;Monoclonal Anti-MERTK antibody produced in mouse;RP38;E962;Asp-Phe-OMe H-Asp-Phe-OMe N-(L-α-Aspartyl)-L-phenylalanine methyl ester N-L-alpha-Aspartyl-L-phenylalanine 1-Methyl Ester L-Aspartyl-L-phenylalanine methyl ester;L-ASPARTYL-L-PHENYLALANINE METHYL ESTER;L-ASP-PHE METHYL ESTER;Asp-Phe-OMe. CAS No. 22839-47-0. Pack Sizes: 5 g. Product ID: CDF4-0165. Molecular formula: C14H18N2O5. Category: Sweeteners. Product Keywords: Food Ingredients; Sweeteners; Aspartame; CDF4-0165; 22839-47-0; C14H18N2O5; 245-261-3; 22839-47-0. Purity: 0.99. Color: White. EC Number: 245-261-3. Physical State: Powder. Solubility: Sparingly soluble or slightly soluble in water and in ethanol (96 per cent), practically insoluble in hexane and in methylene chloride. Storage: 2-8°C. Boiling Point: 436.08°C (rough estimate). Melting Point: 242-248 °C. Density: 1.2051 (rough estimate). | |
| Aspartame | Aspartame. CAS No. 22839-47-0. Product ID: PE-0003. Molecular formula: C14H18N2O5. Mole weight: 294.303. Category: Sweetening agent; Corrective Excipients. Product Keywords: Pharmaceutical Excipients; Excipients for Liquid Dosage Form; Corrective Excipients; Aspartame; PE-0003; C14H18N2O5; 22839-47-0; 22839-47-0. Appearance: White powder or tablets. Purity: 0.99. Storage: 2-8°C. Boiling Point: 535.8°C at 760 mmHg. Melting Point: 248-250°C. Density: 1.28 g/cm3. | |
| Aspartame | A dipeptide ester about 160 times sweeter than sucrose in aqueous solution. A non-nutritive sweetener. Group: Biochemicals. Alternative Names: L-α-Aspartyl-L-phenylalanine 2-Methyl Ester; Canderel; Dipeptide Sweetener; E 951; Equal; Finn; L-Aspartame; NutraSweet; Pal Sweet; Palsweet Diet; Sweet Dipeptide; Zero-Cal; α-Aspartame; α-L-Aspartyl-L-phenylalanine Methyl Ester; α-Sweet. Grades: Highly Purified. CAS No. 22839-47-0. Pack Sizes: 5g. US Biological Life Sciences. | Worldwide |
| Aspartame Acesulfame K Arabinose | Aspartame Acesulfame K Arabinose. Group: Sweeteners. |  |
| Aspartame-d3 | A labeled dipeptide ester about 160 times sweeter than sucrose in aqueous solution. A non-nutritive sweetener. Group: Biochemicals. Alternative Names: L-α-Aspartyl-L-phenylalanine 2-(Methyl-d3) Ester; Canderel-d3; Dipeptide-d3 Sweetener; E 951; Equal-d3; Finn-d3; L-Aspartame-d3; NutraSweet-d3; Pal Sweet-d3; Palsweet Diet-d3; Sweet Dipeptide-d3; Zero-Cal-d3; α-Aspartame-d3; α-L-Aspartyl-L-phenylalanine (Methyl-d3) Ester; α-Sweet-d3. Grades: Highly Purified. CAS No. 1356841-28-5. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| Aspartame-d5 | A labeled dipeptide ester about 160 times sweeter than sucrose in aqueous solution. A non-nutritive sweetener. Group: Biochemicals. Alternative Names: L-α-Aspartyl-L-phenylalanine 2-(Methyl-d5) Ester; Canderel-d5; Dipeptide-d5 Sweetener; E 951; Equal-d5; Finn-d5; L-Aspartame-d5; NutraSweet-d5; Pal Sweet-d5; Palsweet Diet-d5; Sweet Dipeptide-d5; Zero-Cal-d5; α-Aspartame-d5; α-L-Aspartyl-L-phenylalanine (Methyl-d5) Ester; α-Sweet-d5. Grades: Highly Purified. CAS No. 1356849-17-6. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| Aspartame-[d5] | Aspartame-[d5] is the labelled analogue of Aspartame. Aspartame is an artificial, non-saccharide sweetener used as a sugar substitute in some foods and beverages. Synonyms: Aspartame D5; L-α-Aspartyl-L-phenylalanine 2-(Methyl-d5) Ester; Canderel-d5; Dipeptide-d5 Sweetener; Equal-d5; Finn-d5; L-Aspartame-d5; NutraSweet-d5; Pal Sweet-d5; Palsweet Diet-d5; Sweet Dipeptide-d5; Zero-Cal-d5; α-Aspartame-d5; α-L-Aspartyl-L-phenylalanine (Methyl-d5) Ester; α-Sweet-d5. Grade: ≥95%; ≥97% atom D. CAS No. 1356849-17-6. Molecular formula: C14H13D5N2O5. Mole weight: 299.34. | |
| Aspartame EP Impurity A | Aspartame EP Impurity A. Uses: For analytical and research use. CAS No. 5262-10-2. Molecular formula: C13H14N2O4. Mole weight: 262.27. Catalog: APB5262102. |  |
| Aspartame EP Impurity B | Aspartame EP Impurity B. Uses: For analytical and research use. CAS No. 13433-09-5. Molecular formula: C13H16N2O5. Mole weight: 280.28. Catalog: APB13433095. | |
Our database is helping our users find suppliers everyday.
