American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
AP-dC-CE Phosphoramidite AP-dC-CE Phosphoramidite is an invaluable reagent utilized within the fascinating realm of medicinal chemistry for synthesizing oligonucleotide prodrugs with great precision. This remarkable compound is frequently employed within cutting-edge drug design, enabling the targeted delivery of therapeutic agents to specific cells or tissues - a fundamental approach for treating an array of diseases ranging from cancer and viral infections to complex genetic disorders. Synonyms: 1-[5'-O-(4,4'-Dimethoxytrityl)-β-D-2'-deoxyribofuranosyl]-9-(2-trifluoroacetamidoethoxy)-1,3-diaza-2-oxophenoxazine, 3'-[(2-cyanoethyl)-(N,N-diisopropyl)]phosphoramidite. Molecular formula: C49H54F3N6O10P. Mole weight: 974.97. BOC Sciences 6
APDC-DTPA APDC-DTPA. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 3,4-Bis(4-(diphenylamino)phenyl) acenaphtho[1,2-b]pyrazine-8,9-dicarbonitrile. Product Category: Organic Light Emitting Diode (OLED). CAS No. 2102527-13-7. Molecular formula: C52H32N6. Mole weight: 740.85 g/mol. Product ID: ACM2102527137. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 2
AP-dC Phosphoramidite AP-dC Phosphoramidite is a modified cytidine phosphoramidite used in oligonucleotide synthesis. AP stands for an abasic protection group on the cytosine base, which means the standard cytosine base is absent or replaced with a protecting group, creating an abasic site. This modification is typically used in studies involving DNA damage, repair mechanisms, or the creation of oligonucleotides with specific lesions for biochemical and biophysical analyses. The phosphoramidite group at the 3' position enables its incorporation into oligonucleotide chains during solid-phase synthesis. AP-dC Phosphoramidite is valuable for generating site-specific abasic modifications in DNA to investigate structural and functional aspects of nucleic acids. Synonyms: N-[2-[[3-[5-O-[Bis(4-methoxyphenyl)phenylmethyl]-3-O-[[bis(1-methylethyl)amino](2-cyanoethoxy)phosphino]-2-deoxy-β-D-erythro-pentofuranosyl]-2,3-dihydro-2-oxo-1H-pyrimido[5,4-b][1,4]benzoxazin-9-yl]oxy]ethyl]-2,2,2-trifluoroacetamide; DNA C-clamp (TFA); 1-[5'-O-(4,4'-Dimethoxytrityl)-β-D-2'-deoxyribofuranosyl]-9-(2-trifluoroacetamidoethoxy)-1,3-diaza-2-oxophenoxazine, 3'-[(2-cyanoethyl)-(N,N-diisopropyl)]phosphoramidite; AP-dC-CE Phosphoramidite. Grade: ≥97%. CAS No. 1360536-91-9. Molecular formula: C49H54F3N6O10P. Mole weight: 974.96. BOC Sciences 6
APD-I APD-I is an ester peptide antibiotic produced by Bacillus subtilis C-756. It can inhibit the activity of cyclic-AMP phosphodiesterase. CAS No. 87098-49-5. Molecular formula: C51H89N7O13. Mole weight: 1008.29. BOC Sciences 12
APD-II APD-II is an ester peptide antibiotic produced by Bacillus subtilis C-756. It can inhibit the activity of cyclic-AMP phosphodiesterase. CAS No. 87099-78-3. Molecular formula: C52H91N7O13. Mole weight: 1022.32. BOC Sciences 12
APD-III APD-III is an ester peptide antibiotic produced by Bacillus subtilis C-756. It can inhibit the activity of cyclic-AMP phosphodiesterase. CAS No. 87098-48-4. Molecular formula: C53H93N7O13. Mole weight: 1036.34. BOC Sciences 12
APE1 Inhibitor III APE1 Inhibitor III is a selective and competitive inhibitor of apurinic/apyrimidinic (AP) endonuclease 1 (APE1) with 2.0 micromolar activity against the purified APE1 enzyme. Synonyms: N-[3-(1,3-Benzothiazol-2-yl)-6-isopropyl-4,5,6,7-tetrahydrothieno[2,3-c]pyridin-2-yl]acetamide. Grade: 99%. CAS No. 524708-03-0. Molecular formula: C19H21N3OS2. Mole weight: 371.52. BOC Sciences 6
APE1 Inhibitor III (Apurinic Endonuclease 1 Inhibitor III) (Apurinic/Apyrimidinic Endonuclease 1 Inhibitor III)(N-(3-(1,3-Benzo[d]thiazol-2-yl)-6-isopropyl-4,5,6,7-tetrahydrothieno[2,3-c]pyridin-2-yl)acetamide) A cell-permeable benzothiazolyltetra hydrothienopyridine compound that acts as a potent, competitive, and active site targeting inhibitor of APE1 (IC50=2.0uM in a fluorescence based HTS assay; and 12uM in a radiotracer incision assay). Shown to block APE1 activity in HEK293T and HeLa cells extract (IC50=600nM) and increase genomic AP site accumulation. Potentiates the cytotoxicity of DNA-damaging alkylating agents in HeLa cells by ~3-fold. Exhibits favorable pharmacokinetic properties and desirable ADME attributes. Due to its lipophilic nature, it crosses the blood-brain barrier rather easily and shows desirable stability (t1/2=80min). Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 4
Worldwide
Apelin-12 Apelin-12 is one of the most potent C-terminal fragments of the polypeptide that possesses a high affinity to orphan receptor APJ receptor. Apelin-12 is involved in the regulation of body fluid homeostasis and in the central control of feeding. Apelin-12 blocks HIV-1 entry through APJ receptor. Apelin-12 exerts neuroprotective effect [1] [2] [3]. Uses: Scientific research. Group: Peptides. CAS No. 229961-08-4. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P2537. MedChemExpress MCE
Apelin-12 acetate Apelin-12 induces calcium mobilization in APJ-Gαq16 cells expressing human APJ and inhibits HIV-1 and HIV-2 infection in NP-2/CD4/APJ cells. Apelin-12 inhibits the JNK and p38 MAPK signaling pathway of the apoptosis-related MAPKs family, thus offering protection to neurons. Synonyms: Preproapelin (66-77) (human, bovine, mouse, rat) acetate; (Des-Gln1)-Apelin-13 (human, bovine, mouse, rat) acetate; Apelin Precursor (66-77) (human, bovine, mouse, rat) acetate. Molecular formula: C66H107N21O16S. Mole weight: 1482.77. BOC Sciences 6
Apelin-12 (human, bovine, mouse, rat) Apelin-12 (human, bovine, mouse, rat), an endogenous ligand of the human orphan receptor APJ, lowers arterial blood pressure without altering heart rate in anesthetized rats. Its vasoactive effect may be related to the activation of endothelial nitric oxide synthase. Synonyms: Preproapelin (66-77) (human, bovine, mouse, rat); H-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH; L-arginyl-L-prolyl-L-arginyl-L-leucyl-L-seryl-L-histidyl-L-lysyl-glycyl-L-prolyl-L-methionyl-L-prolyl-L-phenylalanine; (Des-Gln1)-Apelin-13 (human, bovine, mouse, rat); Apelin Precursor (66-77) (human, bovine, mouse, rat); N5-(Diaminomethylene)-L-ornithyl-L-prolyl-N5-(diaminomethylene)-L-ornithyl-L-leucyl-L-seryl-L-histidyl-L-lysylglycyl-L-prolyl-L-methionyl-L-prolyl-L-phenylalanine. Grade: ≥95% by HPLC. CAS No. 229961-08-4. Molecular formula: C64H103N21O14S. Mole weight: 1422.72. BOC Sciences
Apelin-13 Apelin-13, an endogenous neuropeptide, is the ligand for the G-protein-coupled receptor APJ, an alternative coreceptor with CD4 for HIV-1 infection. Apelin-13 is generated from apelin-36, which is a putative receptor protein related to the angiotensin receptor (AT1). Apelin-13 exerted an acidification-rate-promoting activity in the CHO cells expressing the APJ receptor with EC50 value of 0.37 nM. Apelin-13 is a 13 amino acid polypeptide encoded by the apelin gene which yields a pre-proprotein that is processed to generate bioactive peptides. Apelin-13 is also involved in the learning and memory process. Synonyms: Apelin-13 (human, bovine, mouse, rat); H-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH; L-glutaminyl-L-arginyl-L-prolyl-L-arginyl-L-leucyl-L-seryl-L-histidyl-L-lysyl-glycyl-L-prolyl-L-methionyl-L-prolyl-L-phenylalanine. Grade: ≥95%. CAS No. 217082-58-1. Molecular formula: C69H111N23O16S. Mole weight: 1550.85. BOC Sciences
Apelin-13 TFA Apelin-13 TFA is an endogenous ligand for the G-protein coupled receptor angiotensin II protein J (APJ), activating this G protein-coupled receptor with an EC 50 value of 0.37 nM. Apelin-13 TFA has vasodilatory and antihypertensive effects. Apelin-13 TFA also can be used for researching type 2 diabetes and metabolic syndrome[1][2][3]. Uses: Scientific research. Group: Peptides. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P1944A. MedChemExpress MCE
Apelin-13 trifluoroacetate salt ?95%. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Apelin-13 trifluoroacetate salt Apelin-13 trifluoroacetate salt is the endogenous ligand of the APJ receptor, activating this G protein-coupled receptor with an EC50 value of 0.37 nM. Synonyms: Apelin-13 triTFA. Molecular formula: C75H114F9N23O22S. Mole weight: 1892.89. BOC Sciences 6
Apelin-17 (human, bovine) Apelin-17 (human, bovine). Group: Biochemicals. Grades: Purified. CAS No. 217082-57-0. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 5
Worldwide
Apelin-17(human, bovine) Apelin-17(human, bovine) is an endogenous orphan G protein-coupled receptor APJ agonist. Apelin-17(human, bovine) binds to human APJ receptors expressed in HEK 293 cells (pIC50=9.02). Apelin-17(human, bovine) inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ[1][2][3]. Uses: Scientific research. Group: Peptides. CAS No. 217082-57-0. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P1066. MedChemExpress MCE
Apelin-17 (Human, Bovine) Apelin-17 (human, bovine) is an endogenous ligand of the G protein-coupled APJ receptor with EC50 value of 2.5 nM that is secreted by adipocytes. It potently inhibits forskolin-stimulated cAMP production in vitro. Synonyms: [Phe17]-Apelin 17. Grade: 98.86%. CAS No. 217082-57-0. Molecular formula: C96H156N34O20S. Mole weight: 2138.56. BOC Sciences
Apelin-17 (human, bovine) acetate Apelin-17 (human, bovine) acetate, secreted by adipocytes, is an endogenous ligand of the G protein-coupled APJ receptor with an EC50 of 2.5 nM. It is an endogenous apelin receptor agonist that potently inhibits forskolin-stimulated cAMP production in vitro. Synonyms: H-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH.CH3CO2H; L-lysyl-L-phenylalanyl-L-arginyl-L-arginyl-L-glutaminyl-L-arginyl-L-prolyl-L-arginyl-L-leucyl-L-seryl-L-histidyl-L-lysyl-glycyl-L-prolyl-L-methionyl-L-prolyl-L-phenylalanine acetic acid. Grade: ≥95%. Molecular formula: C98H160N34O22S. Mole weight: 2198.63. BOC Sciences 6
Apelin-36 (human) Endogenous APJ receptor agonist (EC50 = 20 nM) that is secreted by adipocytes. Binds with high affinity to human APJ receptors expressed in HEK 293 cells (pIC50= 8.61). Involved in regulation of cardiovascular function, fluid homeostasis and feeding. Blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ. Group: Biochemicals. Grades: Highly Purified. CAS No. 252642-12-9. Pack Sizes: 1mg. Molecular Formula: C184H297N69O43S, Mass Spectrum: Consistent with structure. US Biological Life Sciences. USBiological 5
Worldwide
Apelin-36 (human) Apelin-36 (human) is an endogenous ligand of the G protein-coupled APJ receptor with EC50 value of 20 nM that is secreted by adipocytes. It is the full-length mature peptide produced from the translated 77 amino acid prepropeptide. It acts primarily in the central nervous and peripheral system. It is important in regulating fluid homeostasis, cardiovascular function, insulin and hypertension sensitivity. It potently blocks HIV-1 and HIV-2 strains entry into cells expressing APJ and CD4 and limits HIV infection. It endogenously binds with high affinity to human APJ receptors expressed in HEK 293 cells. Synonyms: H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH; L-leucyl-L-valyl-L-glutaminyl-L-prolyl-L-arginyl-glycyl-L-seryl-L-arginyl-L-asparagyl-glycyl-L-prolyl-glycyl-L-prolyl-L-tryptophyl-L-glutaminyl-glycyl-glycyl-L-arginyl-L-arginyl-L-lysyl-L-phenylalanyl-L-arginyl-L-arginyl-L-glutaminyl-L-arginyl-L-prolyl-L-arginyl-L-leucyl-L-seryl-L-histidyl-L-lysyl-glycyl-L-prolyl-L-methionyl-L-prolyl-L-phenylalanine. Grade: ≥95% by HPLC. CAS No. 252642-12-9. Molecular formula: C184H297N69O43S. Mole weight: 4195.87. BOC Sciences
Apelin-36(human) Apelin-36(human) is an endogenous orphan G protein-coupled receptor APJ agonist, with an EC 50 of 20 nM. Apelin-36(human) shows high affinity to human APJ receptors expressed in HEK 293 cells (pIC 50 =8.61). Apelin-36 has been linked to two major types of biological activities: cardiovascular and metabolic. Apelin-36(human) inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ [1] [2] [3] [4]. Uses: Scientific research. Group: Peptides. CAS No. 252642-12-9. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P1064. MedChemExpress MCE
Apelin-36(human) Apelin-36(human) is an endogenous orphan G protein-coupled receptor APJ agonist, with an EC50 of 20 nM. Apelin-36(human) shows high affinity to human APJ receptors expressed in HEK 293 cells (pIC50=8.61). Apelin-36 has been linked to two major types of biological activities: cardiovascular and metabolic. Apelin-36(human) inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ. Uses: Designed for use in research and industrial production. Additional or Alternative Names: LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF;H-LEU-VAL-GLN-PRO-ARG-GLY-SER-ARG-ASN-GLY-PRO-GLY-PRO-TRP-GLN-GLY-GLY-ARG-ARG-LYS-PHE-ARG-ARG-GLN-ARG-PRO-ARG-LEU-SER-HIS-LYS-GLY-PRO-MET-PRO-PHE-OH;LEU-VAL-GLN-PRO-ARG-GLY-SER-ARG-ASN-GLY-PRO-GLY-PRO-TRP-GLN-GLY-GLY-. Product Category: Inhibitors. CAS No. 252642-12-9. Molecular formula: C184H297N69O43S. Purity: 0.9811. Product ID: ACM252642129. Alfa Chemistry — ISO 9001:2015 Certified. Categories: Apelin-36 (human). Alfa Chemistry.
Apelin-36 (rat, mouse) Apelin-36 (rat, mouse) is an endogenous ligand of the G protein-coupled APJ receptor with EC50 value of 5.4 nM that is secreted by adipocytes. It potently inhibits cAMP production in vitro. It is important in regulating fluid homeostasis, cardiovascular function and feeding. It potently blocks HIV-1 and HIV-2 strains entry into cells expressing APJ and CD4 and limits HIV infection. Synonyms: Apelin-36 (rat, mouse); Apelin 36 (rat, mouse); Apelin36 (rat, mouse). Grade: 95%. CAS No. 230299-95-3. Molecular formula: C185H304N68O43S. Mole weight: 4200.93. BOC Sciences
Apelin-36 (rat, mouse) Apelin-36 (rat, mouse). Group: Biochemicals. Grades: Purified. CAS No. 230299-95-3. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 5
Worldwide
a-Pentylcinnamaldehyde diethyl acetal a-Pentylcinnamaldehyde diethyl acetal. Group: Biochemicals. Grades: Highly Purified. CAS No. 60763-41-9. Pack Sizes: 100mg, 250mg, 500mg. Molecular Formula: C18H28O2. US Biological Life Sciences. USBiological 6
Worldwide
APETx2 APETx2. Group: Biochemicals. Grades: Purified. CAS No. 713544-47-9. Pack Sizes: 100ug. US Biological Life Sciences. USBiological 5
Worldwide
APETx2 APETx2, an ion channel 3 (ASIC3) channel blocker, has been found to exhibit analgesic properties against acid-induced and inflammatory pain. Synonyms: APETx2; 713544-47-9; AKOS024458355; H-Gly-DL-xiThr-DL-Ala-DL-Cys(1)-DL-Ser-DL-Cys(2)-Gly-DL-Asn-DL-Ser-DL-Lys-Gly-DL-xiIle-DL-Tyr-DL-Trp-DL-Phe-DL-Tyr-DL-Arg-DL-Pro-DL-Ser-DL-Cys(3)-DL-Pro-DL-xiThr-DL-Asp-DL-Arg-Gly-DL-Tyr-DL-xiThr-Gly-DL-Ser-DL-Cys(2)-DL-Arg-DL-Tyr-DL-Phe-DL-Leu-Gly-DL-xiThr-DL-Cys(1)-DL-Cys(3)-DL-xiThr-DL-Pro-DL-Ala-DL-Asp-OH. Grade: >98%. CAS No. 713544-47-9. Molecular formula: C196H280N54O61S6. Mole weight: 4561.06. BOC Sciences
APF APF is a fluorescence probe that can selectively, and dose dependently detect certain species among ROS and that are highly resistant to autoxidation. APF can be used in enzymatic and cellular systems [1]. Uses: Scientific research. Group: Fluorescent dye. CAS No. 359010-70-1. Pack Sizes: 500 μg (11.81 mM * 100 μL in Methyl acetate). Product ID: HY-119977. MedChemExpress MCE
APF Sialoglycopeptide ammonium salt APF Sialoglycopeptide ammonium salt is a cutting-edge biomedical compound, demonstrating remarkable capabilities in research of dental caries. Proven to possess potent antimicrobial properties against the notorious Streptococcus mutans, this compound also exhibits an extraordinary affinity for hydroxyapatite, amplifying the process of tooth remineralization. Synonyms: O-(Acetamido-3,5-dideoxy-D-glycero-a-D-galacto-2-nonulopyranosylonic acid)-(2→3)-O-b-D- galactopyranosyl-(1→3)-O-a-2-acetamido-2-deoxy-D-galactopyranosyl-(1 →O)- Thr-Val-Pro-Ala-Ala-Val-Val-Val-Ala; NeuNAc-a(2→3)-Gal-b(1→3)-GalNAc-a-Thr-Val-Pro-Ala-Ala-Val-Val-Val-Ala. Molecular formula: C63H107N11O29. Mole weight: 1482.58. BOC Sciences 6
ApG ApG is a scientifically advanced compound, specifically designed to study inflammatory skin disorders as well as combat skin infections. It comprises a potent blend of bioactive drugs exhibiting exceptional antimicrobial and anti-inflammatory attributes. Grade: ≥ 95% by HPLC. Molecular formula: C20H25N10O11P (free acid). Mole weight: 612.14 (free acid). BOC Sciences 6
APG-1387 APG-1387 is an inhibitor of IAPs. Study shows that APG-1387 could induce apoptosis of PLC/PRF/5 which was HBV positive both in vitro and in vivo. Synonyms: APG 1387; APG1387. Grade: 98% by HPLC. CAS No. 1570231-89-8. Molecular formula: C60H72N10O10S2. Mole weight: 1157.4. BOC Sciences 6
APG-2449 APG-2449 is an orally active ALK/ROS1/FAK inhibitor. APG-2449 shows antitumor activity in mouse models of non-small cell lung cancer (NSCLC) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2196186-84-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-155163. MedChemExpress MCE
APHA Compound 8 APHA Compound 8 is a synthetic HDAC (histone deacetylase) inhibitor, which is in the same structural class as SAHA. The IC50 for mouse HDAC1 is 0.5 μM. It induces histone hyperacetylation, growth inhibition, and terminal cell differentiation. Synonyms: MC-1353; MC1353; MC 1353; APHA-8; APHA Compound 8; Aroyl pyrrole hydroxy amide #8; APHA 8; APHA8. Grade: ≥98%. CAS No. 676599-90-9. Molecular formula: C16H16N2O3. Mole weight: 284.3. BOC Sciences 6
APHA Compound 8 ?98% (HPLC), solid. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
APHE-2 APHE-2 is a pyrazoloisoquinolinone antibiotic produced by Streptoverticillium griseocarneum. It has weak anti-Gram-positive bacteria activity. Synonyms: 1H-Indole, 3-(2-propyl-5-oxazolyl)-; WS-30581A. CAS No. 93773-64-9. Molecular formula: C14H14N2O. Mole weight: 226.27. BOC Sciences 12
APHE-3 APHE-3 is a pyrazoloisoquinolinone antibiotic produced by Streptoverticillium griseocarneum. It has weak anti-Gram-positive bacteria activity. APHE-3 can also inhibit lymphocyte proliferation in the presence of Phytohemagglutinin, with IC50 of about 0.1 mmol/L. Synonyms: Pimprinine; WS 30581C. Grade: >95% by HPLC. CAS No. 13640-26-1. Molecular formula: C12H10N2O. Mole weight: 198.22. BOC Sciences
APHE-4 APHE-4 is a pyrazoloisoquinolinone antibiotic produced by Streptoverticillium griseocarneum. It has weak anti-Gram-positive bacteria activity. Synonyms: WS 30581B. CAS No. 93773-63-8. Molecular formula: C15H16N2O. Mole weight: 240.30. BOC Sciences 12
a-Phenyl-a-(2-pyridyl)acetonitrile a-Phenyl-a-(2-pyridyl)acetonitrile. Group: Biochemicals. Alternative Names: a-Phenyl-2-pyridineacetonitrile; 2-Pyridyl phenyl acetonitri le; NSC 16276. Grades: Highly Purified. CAS No. 5005-36-7. Pack Sizes: 500mg, 1g, 2g, 5g, 10g. Molecular Formula: C13H10N2. US Biological Life Sciences. USBiological 8
Worldwide
a-Phenyllactic acid 99+% a-Phenyllactic acid 99+%. Group: Biochemicals. Grades: Reagent Grade. CAS No. 515-30-0. Pack Sizes: 1g, 5g, 25g. US Biological Life Sciences. USBiological 4
Worldwide
a-Phenylpiperidine-2-acetamide ≥97% (HPLC) a-Phenylpiperidine-2-acetamide ≥97% (HPLC). Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 1g, 5g, 25g. US Biological Life Sciences. USBiological 4
Worldwide
a-Phenyl-trans-cinnamamide Crystalline. CAS No. 20432-29-5. Pack Sizes: Typically in stock: 1g. Mole weight: 223.28. MP/BP: M.P. 127. Order No: FR-0594. Frinton Laboratories Inc
Frinton Laboratories
a-Phenyl-trans-cinnamic acid White powder, 98%. Synonym: trans-2,3-Diphenylpropionic acid. CAS No. 91-48-5. Pack Sizes: Typically in stock: 25g, 100g. Mole weight: 224.26. MP/BP: M.P. 170-171. Order No: FR-0253. Frinton Laboratories Inc
Frinton Laboratories
Aphermate Aphermate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: alpha,3,3-trimethyl-cyclohexanemethanoformate;Cyclohexanemethanol. alpha.-3,3-trimethyl-,formate;APHERMATE;CYCLOHEXANE-1-METHANOL, ALPHA, 3,3-TRIMETHYL:FORMATE;alpha,3,3-trimethylcyclohexylmethyl formate;l-Cyclocitronelleneformate;alpha,3,3-Trimethylcycl. Product Category: Heterocyclic Organic Compound. CAS No. 25225-08-5. Molecular formula: C11H20O2. Mole weight: 184.28. Purity: 0.96. IUPACName: 1-(3,3-dimethylcyclohexyl)ethyl formate. Canonical SMILES: CC(C1CCCC(C1)(C)C)OC=O. Density: 0.918g/cm³. ECNumber: 246-735-2. Product ID: ACM25225085. Alfa Chemistry — ISO 9001:2015 Certified. Categories: Aphera tessellata. Alfa Chemistry. 3
aphidicolan-16β-ol synthase This is a bifunctional enzyme which also has EC 5.5.1.14 syn-copalyl diphosphate synthase activity. Aphidicolan-16β-ol is a precursor of aphidicolin, a specific inhibitor of DNA polymerase α (EC 2.7.7.7). Group: Enzymes. Synonyms: PbACS. Enzyme Commission Number: EC 4.2.3.42. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5201; aphidicolan-16β-ol synthase; EC 4.2.3.42; PbACS. Cat No: EXWM-5201. Creative Enzymes
Aphidicolin Aphidicolin is an inhibitor of DNA polymerase α and δ, prevents mitotic cell division by interfering DNA polymerase activity. Aphidicolin is an antibiotic produced by mold Cephalosporium aphidicola , inhibits cellular deoxyribonucleic acid synthesis and the growth of herpes simplex virus. Aphidicolin exhibits anti-orthopoxvirus activity and potentiates apoptosis induced by arabinosyl nucleosides in a human promyelocytic leukemia cell line [1] [2] [3]. Uses: Scientific research. Group: Natural products. CAS No. 38966-21-1. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-N6733. MedChemExpress MCE
Aphidicolin Aphidicolin is an inhibitor of DNA polymerase α and δ, prevents mitotic cell division by interfering DNA polymerase activity. Aphidicolin is an antibiotic produced by mold Cephalosporium aphidicola, inhibits cellular deoxyribonucleic acid synthesis and the growth of herpes simplex virus. Aphidicolin exhibits anti-orthopoxvirus activity and potentiates apoptosis induced by arabinosyl nucleosides in a human promyelocytic leukemia cell line. Uses: Designed for use in research and industrial production. Product Category: Inhibitors. Appearance: Solid. CAS No. 38966-21-1. Molecular formula: C20H34O4. Mole weight: 338.48. Purity: ≥99.0%. Canonical SMILES: C[C@@]12[C@]34[C@](CC[C@@]1([H])[C@@](C)([C@H](O)CC2)CO)([H])C[C@]([C@](CO)(O)CC4)([H])C3. Product ID: ACM38966211. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry.
Aphidicolin Aphidicolin is an antibiotic produced by Cephalosporium aphidicola and Nigrospora sphaerica, which has the effect of inhibiting mitosis and anti-DNA virus. Aphidicolin potentiates apoptosis induced by arabinosyl nucleosides in a human promyelocytic leukemia cell line. Uses: A reversible inhibitor of eukaryotic nuclear dna replication. Synonyms: (+)-Aphidicolin; (3R,4R,4aR,6aS,8R,9R,11aS,11bS)-4,9-bis(hydroxymethyl)-4,11b-dimethyltetradecahydro-8,11a-methanocyclohepta[a]naphthalene-3,9-diol. Grade: >98%. CAS No. 38966-21-1. Molecular formula: C20H34O4. Mole weight: 338.48. BOC Sciences
Aphidicolin analytical standard. Group: Application areas. Alfa Chemistry Analytical Products 4
Aphidicolin-17-monoacetate Aphidicolin-17-monoacetate is an antibiotic produced by Phoma betae PS-13, which inhibits DNA polymerase and interferes with root growth. Molecular formula: C22H36O5. Mole weight: 380.52. BOC Sciences 12
Aphidicolin-3,18-orthoacetate Aphidicolin-3,18-orthoacetate is an antibiotic produced by Phoma betae. It is a kind of phytotoxin, which can inhibit the growth of the roots of rice and mango. Molecular formula: C22H36O5. Mole weight: 380.52. BOC Sciences 12
Aphidicolin - CAS 38966-21-1 Aphidicolin, CAS 38966-21-1, is a cell-permeable antibiotic that acts as a cell synchronization agent. Blocks the cell cycle at early S-phase. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
Aphidicolin from Nigrospora sphaerica ?98% (HPLC), powder. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
APHS APHS is a specific and covalent COX-2 inhibitor with neuroprotective effects. COX-2 is a prostaglandin (PG) synthetase overexpressed in colorectal cancer (CRC) and has pleiotropic cancer-promoting effects. APHS modifies COX-2 by acetylating the active site (serine 516), thereby inhibiting prostaglandin production. The neuroprotective activity of APHS is inhibited by prostaglandin E2. APHS also co-inhibits the WNT pathway, an anti-tumor mechanism in addition to COX-2 inhibition [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 209125-28-0. Pack Sizes: 1 mg (38.11 mM * 100 μL in Methyl acetate); 5 mg (38.11 mM * 500 μL in Methyl acetate); 10 mg (38.11 mM * 1 mL in Methyl acetate). Product ID: HY-129284. MedChemExpress MCE
Aphthosin Aphthosin is a tetrapeptide glycoside isolated from Peltigera aphthosa (L.) Willd. Synonyms: 2,6-Cresotic acid, 4-methoxy-, 4-ester with 6-methyl-β-resorcylic acid, 4-ester with 6-methyl-β-resorcylic acid, 4-ester with methyl 6-methyl-β-resorcylate (8CI). CAS No. 31449-13-5. Molecular formula: C34H30O13. Mole weight: 646.59. BOC Sciences 12
API-1 API-1. Group: Biochemicals. Grades: Purified. CAS No. 36707-00-3. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 5
Worldwide
API-1 Akt/protein kinase B (PKB) inhibitor. Binds the pleckstrin homology domain of Akt and blocks Akt membrane translocation. Inhibits EGF-induced kinase activity of Akt1, Akt2 and Akt3. Induces cell growt h arrest and apoptosis in human cancer cells expressing constitutively active Akt. Synonyms: API 1; API1; NSC177233; NSC 177233; NSC-177233; 4-Amino-5,6,7,8-tetrahydro-5-oxo-8-(beta-D-ribofuranosyl)pyrido[2,3-d]pyrimidine-6-carboxamide. Grade: >98%. CAS No. 36707-00-3. Molecular formula: C28H30FN5O2. Mole weight: 337.29. BOC Sciences 6
API-2 API-2. Group: Biochemicals. Grades: Purified. CAS No. 35943-35-2. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 5
Worldwide
Apicidin Apicidin (OSI 2040) is a fungal metabolite, acts as an orally active histone deacetylase 7/8 ( HDAC7/8 ) inhibitor, with antiparasitic activity and a broad spectrum antiproliferative activity. Apicidin can be used for cancer research [1] [2] [3] [4]. Uses: Scientific research. Group: Natural products. Alternative Names: OSI 2040. CAS No. 183506-66-3. Pack Sizes: 1 mg; 5 mg. Product ID: HY-N6735. MedChemExpress MCE
Apicidin ?98% (HPLC), from microbial. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
Apicidin Apicidin is a cyclic peptide antibiotic with broad-spectrum antiproliferative, antiparasitic and antiprotozoan activity. It is a histone deacetylase (HDAC) inhibitor with anti-angiogenesis and apoptosis-inducing effects. Synonyms: OSI 2040; Cyclo[(2S)-2-amino-8-oxodecanoyl-1-methoxy-L-tryptophyl-L-isoleucyl-(2R)-2-piperidinecarbonyl]; Cyclo(8-oxo-L-2-aminodecanoyl-1-methoxy-L-tryptophyl-L-isoleucyl-D-2-piperidinecarbonyl); Apicidin Ia; 2H-Pyrido[1,2-a][1,4,7,10]tetraazacyclododecine-1,4,7,10(3H,12H)-tetrone, octahydro-6-[(1-methoxy-1H-indol-3-yl)methyl]-9-[(1S)-1-methylpropyl]-3-(6-oxooctyl)-, (3S,6S,9S,15aR)-. Grade: >98%. CAS No. 183506-66-3. Molecular formula: C34H49N5O6. Mole weight: 623.78. BOC Sciences
Apicidin Apicidin is a cyclic peptide antibiotic with broad spectrum antiparasitic and antiprotozoan activity. Apicidin, a histone deacetylase inhibitor, is anti-angiogenic and induces apoptosis. A potent, cell permeable inhibitor of histone deacetylase (IC50 = 700 pM for parasitic histone deacetylase). Inhibits HeLa cell proliferation (IC50 = 50 - 100 nM) and induces the transcriptional activation of p21 (WAF1) in a reversible manner. Also prevents H-ras-induced invasive phenotype of MCF-10A cells possibly by down regulating MMP-2 in a reversible manner. Apicidin has antiproliferative activity on HeLa cells accompanied by cell arrest at the G1 phase. Apicidin induces selective changes in the expression of p21 and gelsolin. Group: Biochemicals. Alternative Names: Cyclo[(2S)-2-amino-8-oxodecanoyl-1-methoxy-L-tryptophyl-L-isoleucyl-(2R)-2-piperidinecarbonyl]; Cyclo(8-oxo-L-2-aminodecanoyl-1-methoxy-L-tryptophyl-L-isoleucyl-D-2-piperidinecarbonyl); Apicidin Ia; OSI 2040. Grades: Highly Purified. CAS No. 183506-66-3. Pack Sizes: 2mg. US Biological Life Sciences. USBiological 1
Worldwide
Apicidin, Fusarium sp. A potent, cell-permeable inhibitor of histone deacetylase (IC??= 700 pM for parasitic histone deactetylase) that also exibits antiprotozoal and potential anti-malarial properties. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Apicidin, HDAC Inhibitor (Cyclo- N-O-methyl-L-tryptophanyl-Lisoleucinyl- Dpipecolinyl- L-2-amino-8-oxodecanoyl) Cyclopeptide inhibitor of histone deactylases (HDACs). Inhibits HeLa cell proliferation (IC50=50-. Group: Biochemicals. Alternative Names: Cyclo- N-O-methyl-L-tryptophanyl-Lisoleucinyl- Dpipecolinyl- L-2-amino-8-oxodecanoyl. Grades: Highly Purified. CAS No. 183506-66-3. Pack Sizes: 1mg, 5mg. US Biological Life Sciences. USBiological 3
Worldwide
Apicularen A Apicularen A is a macrolide antibiotic produced by Chondromyces robustus Cma 13. Apicularen A has no antibacterial activity, but for human and animal tumor cells such as KB-3-1, KB-V1, K-562, HL-60, U-937, A-498, A-549, PC-3 and SK-OV -3 grade has strong cytotoxicity. CAS No. 220757-04-0. Molecular formula: C25H31NO6. Mole weight: 441.52. BOC Sciences 12
Apicularen B Apicularen B is a macrolide antibiotic produced by Chondromyces robustus Cma 13. Apicularen B has low cytotoxicity and weak anti-Gram-positive bacteria activity. CAS No. 220757-06-2. Molecular formula: C33H44N2O11. Mole weight: 644.71. BOC Sciences 12
Apidaecin IB acetate Apidaecin IB acetate is an insect antimicrobial peptide with a minimum concentration of 8 μM against Escherichia coli (E. coli ML35, o18k1h7 and ATCC 25922). Synonyms: H-Gly-Asn-Asn-Arg-Pro-Val-Tyr-Ile-Pro-Gln-Pro-Arg-Pro-Pro-His-Pro-Arg-Leu-OH.CH3CO2H; glycyl-L-asparagyl-L-asparagyl-L-arginyl-L-prolyl-L-valyl-L-tyrosyl-L-isoleucyl-L-prolyl-L-glutaminyl-L-prolyl-L-arginyl-L-prolyl-L-prolyl-L-histidyl-L-prolyl-L-arginyl-L-leucine acetic acid; 18-L-leucine-Apidaecin Ia acetate; Apidaecin Ib acetate. Grade: ≥95%. Molecular formula: C97H154N32O25. Mole weight: 2168.46. BOC Sciences 9
Apigenin Apigenin. Group: Biochemicals. Grades: Purified. CAS No. 520-36-5. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
Apigenin 1g Pack Size. Group: Aroma Chemicals, Building Blocks, Organics. Formula: C15H10O5. CAS No. 520-36-5. Prepack ID 22930039-1g. Molecular Weight 270.24. See USA prepack pricing. Molekula Americas
Apigenin Apigenin - Product ID: NST-10-78. Category: Flavonoids. Alternative Names: Baicalein-7-O-glucuronide. Purity: 98%. Test method: HPLC. CAS No. 520-36-5. Pack Sizes: 10g, 20g, 50g, 100g. Appearance: Yellow Powder. Molecular formula: C15H10O5. Mole weight: 270.24. Storage: +2 … +8 °C. NATURE SCIENCE TECHNOLOGIES

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products