American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
Asn-asp-asp-cys-glu-leu-cys-val-asn-val-ala-cys-thr-gly-cys-leu Asn-asp-asp-cys-glu-leu-cys-val-asn-val-ala-cys-thr-gly-cys-leu. Uses: Designed for use in research and industrial production. Additional or Alternative Names: asn-asp-asp-cys-glu-leu-cys-val-asn-val-ala-cys-thr-gly-cys-leu [disulfide bridges: 4-12,7-15]; UGN (HUMAN); Uroguanylin (huMan)UGN (huMan); UROGUANYLIN; Uroguanylin; UROGUANYLIN (HUMAN). Product Category: Heterocyclic Organic Compound. CAS No. 154525-25-4. Molecular formula: C64H102N18O26S4. Mole weight: 1667.86. Purity: 0.96. IUPACName: (2S)-2-[[(1R,4S,7S,10S,13S,16R,21R,27S,34R,37S,40S)-10-(2-amino-2-oxoethyl)-34-[[(2S)-3-carboxy-2-[[(2S)-3-carboxy-2-[[(2S)-2,4-diamino-4-oxobutanoyl]amino]propanoyl]amino]propanoyl]amino]-37-(2-carboxyethyl)-27-[(1R)-1-hydroxyethyl]-4-methyl-40-(2-methyl. Canonical SMILES: CC1C(=O)NC2CSSCC(C(=O)NC(C(=O)NC(C(=O)NC(CSSCC(NC(=O)CNC(=O)C(NC2=O)C(C)O)C(=O)NC(CC(C)C)C(=O)O)C(=O)NC(C(=O)NC(C(=O)NC(C(=O)N1)C(C)C)CC(=O)N)C(C)C)CC(C)C)CCC(=O)O)NC(=O)C(CC(=O)O)NC(=O)C(CC(=O)O)NC(=O)C(CC(=O)N)N. Product ID: ACM154525254. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 5
Asnuciclib Asnuciclib (CDKI-73; LS-007) is an orally active and highly efficacious CDK9 inhibitor, with Ki values of 4 nM, 4 nM and 3 nM for CDK9, CDK1 and CDK2, respectively. Asnuciclib down-regulates the RNAPII phosphorylation. Asnuciclib is also a novel pharmacological inhibitor of Rab11 cargo delivery and innate immune secretion[1][2][3][4]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: CDKI-73; LS-007. CAS No. 1421693-22-2. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-12445. MedChemExpress MCE
ASO 556089 sodium ASO 556089 sodium is a 16 nucleotide length gapmer (3-10-3) that targets the human and mouse long non-coding RNA MALAT1, with the sequence: 5-GmCATTmCTAATAGmCAGmC-3 [1]. Uses: Scientific research. Group: Signaling pathways. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-148688. MedChemExpress MCE
a-Solanine a-Solanine, an organic compound existing naturally in potatoes and tomatoes, has garnered attention in the field of biomedicine. Its viability in combating specific forms of cancer has been extensively explored. Extensive research illustrates that a-Solanine showcases exceptional anticancer traits by restraining tumor proliferation and stimulating programmed cell death in malignant cells. Synonyms: (3β)-Solanid-5-en-3-yl O-6-deoxy-α-L-mannopyranosyl-(1→2)-O-[β-D-glucopyranosyl-(1→3)]-β-D-galactopyranoside; α-Solanine; α-Solanin. CAS No. 20562-02-1. Molecular formula: C45H73NO15. Mole weight: 868.06. BOC Sciences 6
Asomate Asomate. Group: Biochemicals. Alternative Names: N, N-Di methyl carbamodithioic Acid Anhydrosulfide with Arsenotrithious Acid; Thioarsenious Acid (H3AsS3), Tris(anhydrosulfide) with Dimethyldithiocarbamic Acid (8CI); Asomate; TDDA; TTCA; Tris (di methyl dithiocarbamato) arsenic; Tris (di methyl dithiocarbamoyl) arsine. Grades: Highly Purified. CAS No. 3586-60-5. Pack Sizes: 1g. Molecular Formula: C9H18AsN3S6, Molecular Weight: 435.57. US Biological Life Sciences. USBiological 3
Worldwide
Asoprisnil Asoprisnil is a selective progesterone receptor (PR) modulator developed for the treatment of progesterone sensitive myomata. Synonyms: J867; J-867; J 867; Asoprisnil; Asoprisnilum. 11beta-(4-((E)-(Hydroxyimino)methyl)phenyl)-17beta-methoxy-17-(methoxymethyl)estra-4,9-dien-3-one; (8S,11R,13S,14S,17S)-11-[4-[(E)-hydroxyiminomethyl]phenyl]-17-methoxy-17-(methoxymethyl)-13-methyl-1,2,6,7,8,11,12,14,15,16-decahydrocyclopenta[a]phenanthren-3-one. Grade: 98%. CAS No. 199396-76-4. Molecular formula: C28H35NO4. Mole weight: 449.58. BOC Sciences 6
Asoprisnil Asoprisnil (J867), a selective progesterone receptor modulator, exhibits mixed progesterone agonist and antagonist effects on various progesterone targeted tissues in animal and human [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: J867. CAS No. 199396-76-4. Pack Sizes: 1 mg; 5 mg. Product ID: HY-119433. MedChemExpress MCE
Asoprisnil ecamate Asoprisnil ecamate is a selective progesterone receptor modulator potentially for the treatment of endometriosis. Synonyms: Benzaldehyde, 4-[(11β,17β)-17-methoxy-17-(methoxymethyl)-3-oxoestra-4,9-dien-11-yl]-, 1-[O-[(ethylamino)carbonyl]oxime], [C(E)]-; J 956; (E)-4-((8S,11R,13S,14S,17S)-17-methoxy-17-(methoxymethyl)-13-methyl-3-oxo-2,3,6,7,8,11,12,13,14,15,16,17-dodecahydro-1H-cyclopenta[a]phenanthren-11-yl)benzaldehyde O-ethylcarbamoyl oxime; (11β,17β)-11-{4-[(E)-{[(Ethylcarbamoyl)oxy]imino}methyl]phenyl}-17-methoxy-17-(methoxymethyl)estra-4,9-dien-3-one. Grade: ≥95%. CAS No. 222732-94-7. Molecular formula: C31H40N2O5. Mole weight: 520.67. BOC Sciences 6
Asoxime chloride Asoxime chloride. Group: Biochemicals. Alternative Names: 1 [ [ [4- (Aminocarbonyl) pyridinio] methoxy] methyl] -2- [ (hydroxyimino) methyl] pyridinium dichloride; HI 6 chloride; HJ 6. Grades: Highly Purified. CAS No. 34433-31-3. Pack Sizes: 25mg, 50mg, 100mg, 250mg, 500mg. Molecular Formula: C14H16Cl2N4O3. US Biological Life Sciences. USBiological 6
Worldwide
Asoxime chloride Asoxime chloride. Uses: Designed for use in research and industrial production. Additional or Alternative Names: (((4-(iminocarbonyl)pyridinio)methoxy)methyl)-2-((hydroxyimino)methyl)pyridi;4'-carbamoyl-2-formyl-1,1'-(oxydimethylene)di-pyridinium-dichloride-2-oxime;hi6;hi-6;hi-6dichloride;hj6;pyridinium,1-(((4-(aminocarbonyl)pyridinio)methoxy)methyl)-2-((hydroxyimino);pyridinium,4'-carbamoyl-2-formyl-1,1'-(oxydimethylene)di-,dichloride,2-oxi. Appearance: Off-White Solid. CAS No. 34433-31-3. Molecular formula: C14H16Cl2N4O3. Mole weight: 359.21. Purity: 0.98. IUPACName: ASOXIME CHLORIDE. Product ID: ACM34433313. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry.
Asoxime Chloride Cholinesterase reactivator. A potential antidote for organophosphate poisoning. Synonyms: 1[[[4-(Aminocarbonyl)pyridinio]methoxy]methyl]-2-[(hydroxyimino)methyl]pyridinium Dichloride. Grade: > 95%. CAS No. 34433-31-3. Molecular formula: C14H16N4O3.2 Cl. Mole weight: 359.21. BOC Sciences 6
Asoxime Chloride (1 [ [ [4- (Aminocarbonyl) pyridinio] methoxy] methyl] -2- [ (hydroxyimino) methyl] pyridinium Dichloride) Cholinesterase reactivator. A potential antidote for organophosphate poisoning. Group: Biochemicals. Alternative Names: 1 [ [ [4- (Aminocarbonyl) pyridinio] methoxy] methyl] -2- [ (hydroxyimino) methyl] pyridinium Dichloride. Grades: Highly Purified. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 1
Worldwide
Asoxime-d4 Chloride Asoxime-d4 Chloride is a labelled Asoxime Chloride. Asoxime Chloride is a cholinesterase reactivator used in the treatment of organophosphate poisoning. Synonyms: 1[[[4-(Aminocarbonyl)pyridinio-d4]methoxy]methyl]-2-[(hydroxyimino)methyl]pyridinium Dichloride; HI 6-d4 Chloride; HJ 6-d4. Grade: > 95%. Molecular formula: C14H12N4O3D4·2Cl. Mole weight: 363.23. BOC Sciences 6
ASP1126 ASP1126 is a selective and orally active agonist of sphingosine-1-phosphate (S1P), with EC50s of 7.12 and 517 nM for hS1P1 and hS1P3, respectively. ASP1126 can reduce the number of peripheral lymphocytes, naive T cells, central memory T cells and effector memory T cells in the peripheral blood, and has the potential to be used in clinical transplantation to improve safety profile. Synonyms: 1-[(7-{[4-(2,2,2-Trifluoroethoxy)-3-(trifluoromethyl)benzyl]oxy}-2H-chromen-3-yl)methyl]-4-piperidinecarboxylic acid hydrochloride (1:1); 4-Piperidinecarboxylic acid, 1-[[7-[[4-(2,2,2-trifluoroethoxy)-3-(trifluoromethyl)phenyl]methoxy]-2H-1-benzopyran-3-yl]methyl]-, hydrochloride (1:1). Grade: ≥95%. CAS No. 1228580-11-7. Molecular formula: C26H26ClF6NO5. Mole weight: 581.93. BOC Sciences 6
ASP-1645 ASP-1645 is a novel P2Y12 receptor antagonist using as an antiplatelet agent. Uses: An antiplatelet agent. Synonyms: ASP-1645; ASP 1645; ASP1645; UNII-M5SN288R8N; (2S)-2-((7-(cyclohexylamino)-1-cyclopentyl-6-fluoro-1,4-dihydro-4-oxo-3-quinolinyl)oxy)-Propanoic acid. Grade: 98%. CAS No. 1347392-70-4. Molecular formula: C23H29FN2O4. Mole weight: 416.49. BOC Sciences 6
ASP2535 ASP2535 is a potent, orally bioavailable, selective, brain permeable and centrally-active glycine transporter-1 (GlyT1) inhibitor. ASP2535 can improve cognitive impairment in animal models of schizophrenia and Alzheimer's disease [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 374886-51-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg. Product ID: HY-110176. MedChemExpress MCE
ASP 2535 ASP 2535. Group: Biochemicals. Grades: Purified. CAS No. 374886-51-8. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 5
Worldwide
ASP 2535 ASP-2535 has been found to be a GlyT1 inhibitor and brain penetrant. Synonyms: ASP-2535; ASP 2535; ASP2535; 4-[3-(1-Methylethyl)-5-(6-phenyl-3-pyridinyl)-4H-1,2,4-triazol-4-yl]-2,1,3-benzoxadiazole. Grade: ≥98% by HPLC. CAS No. 374886-51-8. Molecular formula: C22H18N6O. Mole weight: 382.42. BOC Sciences 6
Asp-26-Calcitonin Asp-26-Calcitonin is an impurity of Calcitonin salmon, which is a calcium regulating hormone used to be an effective alternative for the treatment of postmenopausal osteoporosis. Synonyms: H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bond between Cys1 and Cys7); L-cysteinyl-L-seryl-L-asparagyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-α-aspartyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolinamide (1->7)-disulfide. Molecular formula: C145H239N43O49S2. Mole weight: 3432.88. BOC Sciences 6
ASP 2905 ASP 2905 is a potent and selective potassium channel KCNH3 (Kv12.2) inhibitor with an IC50 of 9.0 nM. KCNH3 is concentrated in the forebrain, and its overexpression in mice leads to cognitive deficits. ASP 2905 has been identified as a candidate for the treatment of attention deficit/hyperactivity disorder. Synonyms: N2-(4-Fluorophenyl)-N4-phenyl-N6-(pyrimidin-2-ylmethyl)-1,3,5-triazine-2,4,6-triamine. Grade: 98%. CAS No. 792184-90-8. Molecular formula: C20H17FN8. Mole weight: 388.40. BOC Sciences 6
ASP 3026 ASP 3026. Group: Biochemicals. Grades: Purified. CAS No. 1097917-15-1. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
ASP-3026 ASP3026 is a novel and selective inhibitor for the ALK kinase. ASP3026 potently inhibited ALK kinase activity and was more selective than crizotinib in a Tyr-kinase panel. In an anchorage independent in vitro cell growth assay, ASP3026 inhibited the growth of NCI-H2228, a human NSCLC tumor cell line endogenously expressing EML4-ALK variant 3 and that of 3T3 cells expressing EML4-ALK variant 1, 2 and 3. Synonyms: ASP3026; ASP 3026. Grade: 0.98. CAS No. 1097917-15-1. Molecular formula: C29H40N8O3S. Mole weight: 580.74. BOC Sciences 6
Asp371,tyrosinase(369-377),human Asp371,tyrosinase(369-377),human. Uses: Designed for use in research and industrial production. Additional or Alternative Names: CHEMBL1893277, CA-1602, NCGC00167161-01, (Asp371)-Tyrosinase (369-377) (human), 168650-46-2. Product Category: Heterocyclic Organic Compound. CAS No. 168650-46-2. Molecular formula: C42H66N10O16S2. Mole weight: 1031.16. Purity: 0.96. IUPACName: (2S)-2-[[(2S)-5-amino-2-[[(2S)-2-[[(2S)-2-[[(2S,3R)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-amino-3-(4-hydroxyphenyl)propanoyl]amino]-4-methylsulfanylbutanoyl]amino]-3-carboxypropanoyl]amino]acetyl]amino]-3-hydroxybutanoyl]amino]-4-methylsulfanylbutanoyl]amino]-. Canonical SMILES: CC(C)C(C(=O)O)NC(=O)C(CCC(=O)N)NC(=O)C(CO)NC(=O)C(CCSC)NC(=O)C(C(C)O)NC(=O)CNC(=O)C(CC(=O)O)NC(=O)C(CCSC)NC(=O)C(CC1=CC=C(C=C1)O)N. Product ID: ACM168650462. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 4
Asp(3)-Calcitonin (salmon) Asp(3)-Calcitonin is an impurity of Calcitonin salmon, which is a calcium regulating hormone used to be an effective alternative for the treatment of postmenopausal osteoporosis. Synonyms: Cys-Ser-Asp-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2(Cys1&Cys7 bridge); Asp3-Calcitonin(salmon); [Asp3]-Calcitonin (salmon); Calcitonin C; H-Cys-Ser-Asp-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2; CSDLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2(Cys1&Cys7 bridge); L-Cysteinyl-L-seryl-L-alpha-aspartyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-asparagyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolinamide (1->7)-disulfide; Asp(3)-Calcitonin. Grade: >90%. Molecular formula: C145H239N43O49S2. Mole weight: 3432.88. BOC Sciences 6
ASP-4000 ASP-4000 is a dipeptidyl peptidase 4 (DPP) inhibitor with antihyperglycemic activity. Uses: Hyperlipidaemia;hyperlipoproteinaemia type iia;primary biliary cirrhosis. Synonyms: ASP4000; ASP-4000 free base; 2-Pyrrolidinecarbonitrile, 1-(((1R,3S,4S,6R)-6-hydroxy-2-azabicyclo(2.2.1)hept-3-yl)carbonyl)-, (2S)-. Grade: 98%. CAS No. 851510-67-3. Molecular formula: C12H17N3O2. Mole weight: 235.28. BOC Sciences 6
ASP-4000 hydrochoride ASP-4000 is a dipeptidyl peptidase 4 (DPP) inhibitor. It has antihyperglycemic activity. Uses: Antihyperglycemic agent. Synonyms: ASP-4000 hydrochoride; ASP 4000 hydrochoride; ASP4000 hydrochoride; UNII-7393JFE67B; (2S)-1-(((1R,3S,4S,6R)-6-Hydroxy-2-azabicyclo(2.2.1)hept-3-yl)carbonyl)-2-pyrrolidinecarbonitrile hydrochloride. Grade: 98%. CAS No. 851389-35-0. Molecular formula: C12H18ClN3O2. Mole weight: 271.74. BOC Sciences 6
ASP-4058 ASP-4058 is a selective, next-generation and orally active Sphingosine 1-Phosphate receptors 1 and 5 (S1P1 and S1P5) agonist. It ameliorates experimental autoimmune encephalomyelitis in rodent with a favorable safety profile. Synonyms: 1H-Benzimidazole, 5-[5-[3-(trifluoromethyl)-4-[(1S)-2,2,2-trifluoro-1-methylethoxy]phenyl]-1,2,4-oxadiazol-3-yl]-; 5-{5-[3-(Trifluoromethyl)-4-{[(2S)-1,1,1-trifluoro-2-propanyl]oxy}phenyl]-1,2,4-oxadiazol-3-yl}-1H-benzimidazole. Grade: ≥95%. CAS No. 952565-91-2. Molecular formula: C19H12F6N4O2. Mole weight: 442.31. BOC Sciences 6
ASP-4058 hydrochloride ASP-4058 hydrochloride is a selective, next-generation and orally active Sphingosine 1-Phosphate receptors 1 and 5 (S1P1 and S1P5) agonist. It ameliorates experimental autoimmune encephalomyelitis in rodent with a favorable safety profile. Synonyms: 5-(5-(3-(Trifluoromethyl)-4-(((2S)-1,1,1-trifluoropropan-2-yl)oxy)phenyl)-1,2,4-oxadiazol-3-yl)-1H-benzimidazole hydrochloride; 1H-Benzimidazole, 6-(5-(3-(trifluoromethyl)-4-((1S)-2,2,2-trifluoro-1-methylethoxy)phenyl)-1,2,4-oxadiazol-3-yl)-, hydrochloride (1:1). Grade: ≥95%. CAS No. 952510-14-4. Molecular formula: C19H13ClF6N4O2. Mole weight: 478.78. BOC Sciences 6
ASP4132 ASP4132 is an orally active activator of adenosine monophosphate-activated protein kinase (AMPK) with EC50 of 0.018 μM. CAS No. 1640294-30-9. Molecular formula: C46H51F3N6O8S2. Mole weight: 937.06. BOC Sciences 6
ASP-5854 ASP-5854 is an adenosine A1 and A2A receptor antagonist receptor. It has therapeutic potential for the treatment of Parkinson's disease to ameliorate motor deficiencies. Uses: Parkinson's disease. Synonyms: ASP-5854; ASP 5854; ASP5854; UNII-BJS8Y4IC5V; C524699; 5-(5-amino-3-(4-fluorophenyl)-2-pyrazinyl)-1-(1-methylethyl)-2(1H)-Pyridinone. Grade: 98%. CAS No. 851087-60-0. Molecular formula: C18H17FN4O. Mole weight: 324.35. BOC Sciences 6
ASP5878 ASP5878 is an oral active inhibitor of FGFR 1, 2, 3, and 4 , with IC 50 values of 0.47 nM, 0.6 nM, 0.74 nM and 3.5 nM for FGFR 1, 2, 3, and 4 kinase activity. ASP5878 has potential antineoplastic activity [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1453208-66-6. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-19983. MedChemExpress MCE
ASP5878 ASP5878 is a potent and selective inhibitor of fibroblast growth factor receptor (FGFR). Synonyms: ASP-5878; ASP 5878. CAS No. 1453208-66-6. Molecular formula: C18H19F2N5O4. Mole weight: 407.37. BOC Sciences 6
Asp5-Atosiban An impurity of Atosiban. Atosiban is a synthetic peptide that acts as a selective oxytocin receptor antagonist, primarily used to delay preterm labor in pregnant women. Synonyms: Mpr-DTyr(Et)-Ile-Thr-Asp-Cys-Pro-Orn-Gly-NH2(Mpr1&Cys6 bridge); deamino-Cys-D-Tyr(Et)-Ile-Thr-Asp-Cys-Pro-Orn-Gly-NH2 (Disulfide bridge: Cys1-Cys6); Deamino-cysteinyl-O4-ethyl-D-tyrosyl-L-isoleucyl-L-threonyl-L-alpha-aspartyl-L-cysteinyl-L-prolyl-L-ornithyl-glycinamide (1->6)-disulfide; [Asp5]-Atosiban; Asp(5)-Atosiban. Grade: ≥95%. CAS No. 2014351-16-5. Molecular formula: C43H66N10O13S2. Mole weight: 995.18. BOC Sciences 6
Asp(5)-AVP Asp(5)-AVP is an impurity of Vasopressin, which is an antidiuretic hormone secreted from the posterior pituitary. Synonyms: Asp5-AVP; Asp(5)-Arg-Vasopressin; Asp(5)-Vasopressin; Vasopressin, 5-L-aspartic acid-8-L-arginine-; H-Cys-Tyr-Phe-Gln-Asp-Cys-Pro-Arg-Gly-NH2 (Disulfide bridge: Cys1-Cys6); L-cysteinyl-L-tyrosyl-L-phenylalanyl-L-glutaminyl-L-aspartyl-L-cysteinyl-L-prolyl-L-arginyl-glycinamide (1->6)-disulfide. CAS No. 78031-79-5. Molecular formula: C46H64N14O13S2. Mole weight: 1085.22. BOC Sciences 6
Asp 5-Oxytocin Asp 5-Oxytocin is an impurity of Oxytocin, which is a mammalian neurohypophysial hormone used as a vasodilator agent. Synonyms: [5-Aspartic acid]oxytocin; L-Cystyl-L-tyrosyl-L-isoleucyl-L-glutaminyl-L-aspartyl-L-cystyl-L-leucyl-L-prolyl-L-glycinamide (disulfide bridge between cysteines); H-Cys-Tyr-Ile-Gln-Asp-Cys-Pro-Leu-Gly-NH2 (Disulfide bridge: Cys1-Cys6); Oxytocin, 5-L-aspartic acid-; [5-Aspartic acid]-oxytocin; L-Cysteinyl-L-tyrosyl-L-isoleucyl-L-glutaminyl-L-alpha-aspartyl-L-cysteinyl-L-prolyl-L-leucyl-glycinamide (1->6)-disulfide; [Asp5]-Oxytocin; Oxytocin EP Impurity I; 5-L-Aspartic acid-oxytocin; 5-Asp-oxytocin; Asp5-Oxytocin; Asp5-Oxytocin; CYIQDCPLG-NH2(Cys1&Cys6 bridge); Cys-Tyr-Ile-Gln-Asp-Cys-Pro-Leu-Gly-NH2(Cys1&Cys6 bridge). Grade: ≥95%. CAS No. 65907-78-0. Molecular formula: C43H65N11O13S2. Mole weight: 1008.18. BOC Sciences 6
ASP-7657 ASP-7657 is an analgesic and anti-inflammatory agent for the treatment of diabetic neuropathies developed by Astellas Pharma. A phase I clinical trial to evaluate the safety and tolerability of single and multiple ascending oral doses of ASP7657 in healthy subjects was started in 2014 but discontinued in 2015. Uses: An analgesics and anti-inflammatories for the treatment of diabetic neuropathies. Synonyms: ASP 7657; ASP7657; trans-4-[[[[1-(2-quinolinylmethyl)-5-(trifluoromethyl)-1H-indol-7-yl]carbonyl]amino]methyl]-cyclohexanecarboxylic acid. Grade: ≥98%. CAS No. 1196045-28-9. Molecular formula: C28H26F3N3O3. Mole weight: 509.52. BOC Sciences 6
ASP7663 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
ASP7663 ASP7663 is an orally active and selective TRPA1 agonist. ASP7663 exerts both anti-constipation and anti-abdominal pain actions [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1190217-35-6. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-101907. MedChemExpress MCE
ASP 7663 ASP 7663. Group: Biochemicals. Grades: Purified. CAS No. 1190217-35-6. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
ASP 7663 ASP 7663 has been found to be a TRPA1 activator and could show abdominal analgesic activities. Synonyms: ASP7663; ASP-7663; ASP 7663; (2E)-2-[7-Fluoro-1,2-dihydro-1-(2-methylpropyl)-2-oxo-3H-indol-3-ylidene]acetic acid. Grade: ≥98% by HPLC. CAS No. 1190217-35-6. Molecular formula: C14H14FNO3. Mole weight: 263.26. BOC Sciences 6
Asp(7)-Linaclotide Asp(7)-Linaclotde is an impurity of Linaclotide, which is a peptide agonist of guanylate cyclase 2C used for the treatment of abdominal pain in patients with irritable bowel syndrome (IBS) associated with constipation. Synonyms: L-cysteinyl-L-cysteinyl-L-alpha-glutamyl-L-tyrosyl-L-cysteinyl-L-cysteinyl-L-α-aspartyl-L-prolyl-L-alanyl-L-cysteinyl-L-threonyl-glycyl-L-cysteinyl-L-tyrosine (1-6),(2-10),(5-13)-tris(disulfide); H-Cys-Cys-Glu-Tyr-Cys-Cys-Asp-Pro-Ala-Cys-Thr-Gly-Cys-Tyr-OH (Disulfide bridge: Cys1-Cys6, Cys2-Cys10, Cys5-Cys13); [7-Asp]-linaclotide; L-Tyrosine, L-cysteinyl-L-cysteinyl-L-α-glutamyl-L-tyrosyl-L-cysteinyl-L-cysteinyl-L-α-aspartyl-L-prolyl-L-alanyl-L-cysteinyl-L-threonylglycyl-L-cysteinyl-, cyclic (1→6),(2→10),(5→13)-tris(disulfide). CAS No. 1207977-38-5. Molecular formula: C59H78N14O22S6. Mole weight: 1527.71. BOC Sciences 6
ASP-8497 ASP8497 is a long-acting and potent DPP-IV inhibitor. It improves glucose tolerance through glucose-dependent insulinotropic action via elevation of the GLP-1 level. It is used as a therapeutic agent for impaired glucose tolerance and type 2 diabetes. Uses: Asp8497 is used as a therapeutic agent for impaired glucose tolerance and type 2 diabetes. Synonyms: 2-Pyrrolidinecarbonitrile, 4-fluoro-1-(((4-methyl-1-(methylsulfonyl)-4-piperidinyl)amino)acetyl)-, (2S,4S)-(2E)-2-butenedioate (1:1); ASP8497; ASP 8497; (E)-but-2-enedioic acid (2S,4S)-4-fluoro-1-[2-[(4-methyl-1-methylsulfonylpiperidin-4-yl)amino]acetyl]pyrrolidine-2. Grade: 98%. CAS No. 651055-26-4. Molecular formula: C18H27FN4O7S. Mole weight: 462.49. BOC Sciences 6
ASP-8497 free base ASP-8497 free base is a long-acting and potent DPP-IV inhibitor. It improves glucose tolerance through glucose-dependent insulinotropic action via elevation of the GLP-1 level. It is used as a therapeutic agent for impaired glucose tolerance and type 2 diabetes. Uses: Asp-8497 free base is used as a therapeutic agent for impaired glucose tolerance and type 2 diabetes. Synonyms: 2-Pyrrolidinecarbonitrile, 4-fluoro-1-(((4-methyl-1-(methylsulfonyl)-4-piperidinyl)amino)acetyl)-, (2S,4S)-; (2S,4S)-4-fluoro-1-[2-[(4-methyl-1-methylsulfonylpiperidin-4-yl)amino]acetyl]pyrrolidine-2-carbonitrile; ASP8497; ASP 8497 free base. Grade: 98%. CAS No. 651055-25-3. Molecular formula: C14H23FN4O3S. Mole weight: 346.42. BOC Sciences 6
Asp8,Gly12-Terlipressin An impurity of Terlipressin. Terlipressin is a synthetic vasopressin analogue primarily used to improve kidney function in adults with hepatorenal syndrome (HRS), a condition that causes kidney problems in individuals with severe liver disease. It acts as a vasoconstrictor, predominantly in the splanchnic circulation, which helps increase arterial pressure and reduce portal venous pressure. Synonyms: Gly-Gly-Gly-Cys-Tyr-Phe-Gln-Asp-Cys-Pro-Lys-Gly(Cys4&Cys9 bridge); [8-L-aspartic acid,12-glycine]terlipressin; Terlipressin EP Impurity L; H-Gly-Gly-Gly-Cys-Tyr-Phe-Gln-Asp-Cys-Pro-Lys-Gly-OH (Disulfide bridge: Cys4-Cys9); Glycyl-glycyl-glycyl-L-cysteinyl-L-tyrosyl-L-phenylalanyl-L-α-aspartyl-L-asparagyl-L-cysteinyl-L-prolyl-L-lysyl-glycine (4->9)-disulfide; GGGCYFQDCPKG(Cys4&Cys9 bridge); [Asp8, Gly12]-Terlipressin; Terlipressin Impurity L; [Asp(8), Gly(12)]-Terlipressin [Asp(8)-TLY-COOH]. Grade: ≥95%. Molecular formula: C52H72N14O17S2. Mole weight: 1229.35. BOC Sciences 6
Asp8-Terlipressin An impurity of Terlipressin. Terlipressin is a synthetic vasopressin analogue primarily used to improve kidney function in adults with hepatorenal syndrome (HRS), a condition that causes kidney problems in individuals with severe liver disease. It acts as a vasoconstrictor, predominantly in the splanchnic circulation, which helps increase arterial pressure and reduce portal venous pressure. Synonyms: Gly-Gly-Gly-Cys-Tyr-Phe-Gln-Asp-Cys-Pro-Lys-Gly-NH2(Cys4&Cys9 bridge); α-Asp(8)-Terlipressin; GGGCYFQDCPKG-NH2(Cys4&Cys9 bridge); N-[N-(N-Glycylglycyl)glycyl]-5-L-aspartic acid-8-L-lysine-vasopressin; Terlipressin EP Impurity H; [8-L-α-aspartic acid]terlipressin; H-Gly-Gly-Gly-Cys-Tyr-Phe-Gln-Asp-Cys-Pro-Lys-Gly-NH2 (Disulfide bridge: Cys4-Cys9); Glycyl-glycyl-glycyl-L-cysteinyl-L-tyrosyl-L-phenylalanyl-L-glutaminyl-L-α-aspartyl-L-cysteinyl-L-prolyl-L-lysyl-glycinamide (4->9)-disulfide; [Asp8]-Terlipressin; Asp(8)-Terlipressin. Grade: ≥95%. CAS No. 159594-68-0. Molecular formula: C52H73N15O16S2. Mole weight: 1228.37. BOC Sciences 6
ASP-9521 ASP-9521 is a potent, selective and orally available AKR1C3 inhibitor with an IC50 of 11 nM for human AKR1C3. Uses: Scientific research. Group: Signaling pathways. CAS No. 1126084-37-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg; 200 mg. Product ID: HY-19903. MedChemExpress MCE
ASP-9521 ASP9521 is a novel, selective, orally bioavailable inhibitor of 17β-hydroxysteroid dehydrogenase type 5 (17βHSD5; AKR1C3). ASP9521 has demonstrated anti-tumour activity in in vitro and in vivo preclinical models. ASP9521 inhibited conversion of androstenedione (AD) into testosterone (T) by recombinant human or cynomolgus monkey AKR1C3 in a concentration-dependent manner. Synonyms: ASP9521; ASP-9521; ASP 9521. AKR1C3 inhibitor ; 17HSD5 inhibitor; 4-(2-Hydroxy-2-methylpropyl)piperidino(5-methoxy-1H-indole-2-yl)methanone; 1-[1-[(5-Methoxy-1H-indol-2-yl)carbonyl]piperidin-4-yl]-2-methylpropan-2-ol. Grade: 98%. CAS No. 1126084-37-4. Molecular formula: C19H26N2O3. Mole weight: 330.428. BOC Sciences 6
Asp9-Bivalirudin Asp9-Bivalirudin is a modified analog of the anticoagulant peptide Bivalirudin, with an aspartic acid residue at the 9th position. Bivalirudin is a direct thrombin inhibitor used as an anticoagulant to prevent blood clots in patients undergoing certain medical procedures or with specific conditions. Synonyms: H-D-Phe-Pro-Arg-Pro-Gly-Gly-Gly-Gly-Asp-Gly-Asp-Phe-Glu-Glu-Ile-Pro-Glu-Glu-Tyr-Leu-OH; D-Phenylalanyl-L-prolyl-L-arginyl-L-prolylglycylglycylglycylglycyl-L-α-aspartylglycyl-L-α-aspartyl-L-phenylalanyl-L-α-glutamyl-L-α-glutamyl-L-isoleucyl-L-prolyl-L-α-glutamyl-L-α-glutamyl-L-tyrosyl-L-leucine; [Asp9]-Bivalirudin; DPhe-PRPGGGGDGDFEEIPEEYL; DPhe-Pro-Arg-Pro-Gly-Gly-Gly-Gly-Asp-Gly-Asp-Phe-Glu-Glu-Ile-Pro-Glu-Glu-Tyr-Leu. Grade: ≥95%. CAS No. 1182140-65-3. Molecular formula: C98H137N23O34. Mole weight: 2181.27. BOC Sciences 6
AspA2 I One unit of the enzyme is the amount required to hydrolyze 1 μg of Lambda DNA (HindIII-digest) in 1 hour at 37°C in a total reaction volume of 50 μl. Applications: After 10-fold overdigestion with enzyme more than 90% of the dna fragments can be ligated and recut. Group: Restriction Enzymes. Purity: 500U; 2500U. C↑CTAGG GGATC↓C. Activity: 10000u.a./ml. Storage: -20°C. Form: Liquid. Source: Arthrobacter species A2. Pack: 10 mM Tris-HCl (pH 7.5); 100 mM NaCl; 0.1 mM EDTA; 7 mM 2-mercaptoethanol; 100 μg/ml BSA; 50% glycerol. Cat No: RE-1024EN. Creative Enzymes
Aspalathin primary reference standard. Group: Herbal medicinal products standards. Alfa Chemistry Analytical Products
asparaginase Asparaginase, also known as crisantaspase, is an enzyme that is used as a medication and in food manufacturing. As a medication it is used to treat acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), and non-Hodgkin's lymphoma. It is given by injection into a vein, muscle, or under the skin. A pegylated version is also available. In food manufacturing it is used to decrease the acrylamide. Group: Enzymes. Synonyms: asparaginase II; L-asparaginase; colaspase; elspar; leunase; crasnitin; α-asparaginase. Enzyme Commission Number: EC 3.5.1.1. CAS No. 9015-68-3. Asparaginase. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4377; asparaginase; EC 3.5.1.1; 9015-68-3; asparaginase II; L-asparaginase; colaspase; elspar; leunase; crasnitin; α-asparaginase. Cat No: EXWM-4377. Creative Enzymes
Asparaginase from E. coli, Recombinant Asparaginase (EC 3.5.1.1, USAN) or Colaspase (BAN) is an enzyme that catalyzes the hydrolysis of asparagine to aspartic acid. Asparaginases are enzymes expressed and produced by microorganisms. Group: Enzymes. Synonyms: EC 3.5.1.1; Asparaginase; Colaspase; L-asparaginase; L-asparagine amidohydrolase. Enzyme Commission Number: EC 3.5.1.1. CAS No. 9015-68-3. Asparaginase. Mole weight: ~ 37,900. Activity: ~ 15 U/mg. Stability: > 4 years at 4°C. Storage: 4°C. Form: In 2.5 M lithium sulphate. Source: E. coli. EC 3.5.1.1; Asparaginase; Colaspase; L-asparaginase; L-asparagine amidohydrolase. Cat No: NATE-1932. Creative Enzymes
Asparaginase?polyethylene glycol from Escherichia coli lyophilized powder, ~70 units/mg protein. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Asparagine anhydrous United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards. Alfa Chemistry Analytical Products 2
Asparagine monohydrate United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standardseuropean pharmacopoeia (ph. eur.)pharmacopoeial standards. Alternative Names: Asparagine monohydrate, (2S)-2,4-Diamino-4-oxobutanoic acid monohydrate. Alfa Chemistry Analytical Products 4
Asparagine Monohydrate Asparagine Monohydrate. Group: Biochemicals. Alternative Names: (±)-Asparagine; 2-Aminosuccinamic Acid; NSC 206243; NSC 7891; DL-Aspartamine. Grades: Highly Purified. CAS No. 3130-87-8. Pack Sizes: 10g. Molecular Formula: C4H10N2O4, Molecular Weight: 150.13. US Biological Life Sciences. USBiological 3
Worldwide
asparagine-oxo-acid transaminase A pyridoxal-phosphate protein. Group: Enzymes. Synonyms: asparagine-keto acid aminotransferase. Enzyme Commission Number: EC 2.6.1.14. CAS No. 9030-43-7. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2854; asparagine-oxo-acid transaminase; EC 2.6.1.14; 9030-43-7; asparagine-keto acid aminotransferase. Cat No: EXWM-2854. Creative Enzymes
asparagine synthase (glutamine-hydrolysing) The enzyme from Escherichia coli has two active sites that are connected by an intramolecular ammonia tunnel. The enzyme catalyses three distinct chemical reactions: glutamine hydrolysis to yield ammonia takes place in the N-terminal domain. The C-terminal active site mediates both the synthesis of a β-aspartyl-AMP intermediate and its subsequent reaction with ammonia. The ammonia released is channeled to the other active site to yield asparagine. Group: Enzymes. Synonyms: asparagine synthetase (glutamine-hydrolysing); glutamine-dependent asparagine synthetase; asparagine synthetase B; AS; AS-B. Enzyme Commission Number: EC 6.3.5.4. CAS No. 37318-72-2. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5807; asparagine synthase (glutamine-hydrolysing); EC 6.3.5.4; 37318-72-2; asparagine synthetase (glutamine-hydrolysing); glutamine-dependent asparagine synthetase; asparagine synthetase B; AS; AS-B. Cat No: EXWM-5807. Creative Enzymes
asparagine-tRNA ligase This enzyme belongs to the family of ligases, to be specific those forming carbon-oxygen bonds in aminoacyl-tRNA and related compounds. This enzyme participates in alanine and aspartate metabolism and aminoacyl-trna biosynthesis. Group: Enzymes. Synonyms: asparaginyl-tRNA synthetase; asparaginyl-transfer ribonucleate synthetase; asparaginyl transfer RNA synthetase; asparaginyl transfer ribonucleic acid synthetase; asparagyl-transfer RNA synthetase; asparagine translase. Enzyme Commission Number: EC 6.1.1.22. CAS No. 37211-76-0. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5654; asparagine-tRNA ligase; EC 6.1.1.22; 37211-76-0; asparaginyl-tRNA synthetase; asparaginyl-transfer ribonucleate synthetase; asparaginyl transfer RNA synthetase; asparaginyl transfer ribonucleic acid synthetase; asparagyl-transfer RNA synthetase; asparagine translase. Cat No: EXWM-5654. Creative Enzymes
Asparaginyl-arginine Asparaginyl-arginine. Molecular formula: C10H20N6O4. Mole weight: 288.3. BOC Sciences 12
Asparaginyl-asparagine Asparaginyl-asparagine is a dipeptide composed of two L-asparagine. It is an incomplete breakdown product of protein digestion or protein catabolism. It has a role as a Mycoplasma genitalium metabolite. Synonyms: L-Asparagine, L-asparaginyl-; H-NN-OH; Asn-Asn; L-Asparaginyl-L-asparagine; Asparagylasparagin; L-Asn-L-Asn; (S)-4-Amino-2-((S)-2,4-diamino-4-oxobutanamido)-4-oxobutanoic acid. Grade: ≥95%. CAS No. 58471-52-6. Molecular formula: C8H14N4O5. Mole weight: 246.22. BOC Sciences 12
Asparaginyl-glutamine Asparaginyl-glutamine is a dipeptide composed of asparagine and glutamine. CAS No. 14608-83-4. Molecular formula: C9H16N4O5. Mole weight: 260.25. BOC Sciences 12
Asparaginyl-glycine Asparaginyl-glycine is a dipeptide composed of asparagine and glycine. It is an incomplete breakdown product of protein digestion or protein catabolism. Synonyms: Glycine, N-L-asparaginyl-; H-NG-OH; L-asparagyl-glycine; L-asparaginylglycine; Asn-Gly; L-Asn-Gly; (S)-2-(2,4-Diamino-4-oxobutanamido)acetic acid. Grade: ≥95%. CAS No. 67576-72-1. Molecular formula: C6H11N3O4. Mole weight: 189.17. BOC Sciences 12
Asparaginyl-histidine Asparaginyl-histidine is a dipeptide composed of asparagine and histidine. Synonyms: L-Asparaginyl-L-histidine. CAS No. 224638-52-2. Molecular formula: C10H15N5O4. Mole weight: 269.26. BOC Sciences 12
Asparaginyl-isoleucine Asparaginyl-isoleucine is a dipeptide composed of asparagine and isoleucine. It is an incomplete breakdown product of protein digestion or protein catabolism. Synonyms: L-Isoleucine, L-asparaginyl-; L-asparaginyl-L-isoleucine; Asn-Ile; NI dipeptide; H-NI-OH; H-L-Asn-L-Ile-OH. Grade: ≥98%. CAS No. 438533-59-6. Molecular formula: C10H19N3O4. Mole weight: 245.28. BOC Sciences 12
Asparaginyl-lysine Asparaginyl-Lysine is a dipeptide composed of asparagine and lysine. Synonyms: Asn-Lys; NK dipeptide. CAS No. 22677-58-3. Molecular formula: C10H20N4O4. Mole weight: 260.29. BOC Sciences 12
Asparaginyl-phenylalanine Asparaginyl-Phenylalanine is a dipeptide composed of asparagine and phenylalanine. Synonyms: L-Asparaginyl-L-phenylalanine; Asn-Phe. CAS No. 22849-01-0. Molecular formula: C13H17N3O4. Mole weight: 279.29. BOC Sciences 12
Asparaginyl-proline Asparaginyl-proline is a dipeptide composed of asparagine and proline. It is an incomplete breakdown product of protein digestion or protein catabolism. Synonyms: L-Proline, 1-L-asparaginyl-; H-NP-OH; L-asparagyl-L-proline; Asn-Pro; L-Asn-L-Pro. Grade: ≥95%. CAS No. 78346-95-9. Molecular formula: C9H15N3O4. Mole weight: 229.23. BOC Sciences 12
Asparaginyl-serine Asparaginyl-serine is a dipeptide composed of asparagine and serine. It is an incomplete breakdown product of protein digestion or protein catabolism. Synonyms: L-Serine, L-asparaginyl-; Asn-Ser; L-Asn-L-Ser; L-Asparaginyl-L-serine; H-NS-OH; Asparaginylserine. Grade: ≥95%. CAS No. 92172-15-1. Molecular formula: C7H13N3O5. Mole weight: 219.20. BOC Sciences 12
asparaginyl-tRNA synthase (glutamine-hydrolysing) This reaction forms part of a two-reaction system for producing asparaginyl-tRNA in Deinococcus radiodurans and other organisms lacking a specific enzyme for asparagine synthesis. In the first step, a non-discriminating ligase (EC 6.1.1.23, aspartate-tRNAAsn ligase) mischarges tRNAAsn with aspartate, leading to the formation of Asp-tRNAAsn. The aspartyl-tRNAAsn is not used in protein synthesis until the present enzyme converts it into asparaginyl-tRNAAsn (aspartyl-tRNAAsp is not a substrate for this reaction). Ammonia or asparagine can substitute for the preferred substrate glutamine. Group: Enzymes. Synonyms: Asp-AdT; Asp-tRNAAsn amidotransferase; aspartyl-tRNAAsn amidotransferase; Asn-tRNAAsn:L-glutamine amido-ligase (ADP-forming); aspartyl-tRNAAsn:L-glutamine amido-ligase (ADP-forming). Enzyme Commission Number: EC 6.3.5.6. CAS No. 37211-76-0. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5809; asparaginyl-tRNA synthase (glutamine-hydrolysing); EC 6.3.5.6; 37211-76-0; Asp-AdT; Asp-tRNAAsn amidotransferase; aspartyl-tRNAAsn amidotransferase; Asn-tRNAAsn:L-glutamine amido-ligase (ADP-forming); aspartyl-tRNAAsn:L-glutamine amido-ligase (ADP-forming). Cat No: EXWM-5809. Creative Enzymes

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products