A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
ASK1-IN-1 is a CNS-penetrant ASK1 (apoptosis signal-regulating kinase 1) inhibitor, with good potency (cell IC 50 =138 nM; Biochemical IC 50 =21 nM) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2411382-24-4. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-133554.
ASK1-IN-2
ASK1-IN-2 is a potent and orally active inhibitor of apoptosis signal-regulating kinase 1 (ASK1) with an IC50 of 32.8 nM. It can potentially be used as a therapeutic strategy for ulcerative colitis. Synonyms: ASK1-IN-2; 2541792-70-3; EX-A7533; AKOS040759790; MS-25802; HY-131969; CS-0145639. Grade: 98%. CAS No. 2541792-70-3. Molecular formula: C19H17FN6O. Mole weight: 364.38.
ASM-024
ASM-024 is a small synthetic compound and a potent nicotinic receptor agonist developed for airway inflammatory diseases as the primary target therapeutic indication. It acts as a dual anti-inflammatory and bronchodilating agent in preclinical models. Synonyms: 1H-1,4-Diazepinium, 1,1-diethylhexahydro-4-phenyl; di-ethyl-4-phenylhomopiperazinium. Grade: >98.0%. CAS No. 1609534-88-4. Molecular formula: C15H25N2. Mole weight: 233.37.
ASMC Transfection Reagent
Transfection Reagent for ASMC Human Aortic Smooth Muscle Cells. Optimized transfection protocol provided for transfection of siRNA, DNA, mRNA, and microRNA. Transfection Reagents. Transfection Enhancer. Complex Condenser. Uses: Transfection of DNA, RNA, protein and small molecules. Product ID: 1708.
ASN-002 (Gusacitinib) is a dual inhibitor of spleen tyrosine kinase (SYK) and janus kinase (JAK) with an IC50 value of 5-46 nM. It has anti-cancer activity. Synonyms: Gusacitinib. Grade: ≥98% by HPLC. CAS No. 1425381-60-7. Molecular formula: C24H28N8O2. Mole weight: 460.5.
ASN007
ASN007 (ERK-IN-3) is a potent and orally active inhibitor of ERK. ASN007 inhibits ERK1/2 with low single-digit nM IC 50 values. ASN007 can be used for the research of cancers driven by RAS mutations [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: ERK-IN-3. CAS No. 2055597-12-9. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-136579.
ASN007 benzenesulfonate
ASN007 (ERK-IN-3) benzenesulfonate is a potent and orally active inhibitor of ERK. ASN007 benzenesulfonate inhibits ERK1/2 with low single-digit nM IC 50 values. ASN007 benzenesulfonate can be used for the research of cancers driven by RAS mutations [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: ERK-IN-3 benzenesulfonate. CAS No. 2055597-39-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-136579A.
Asn(Acm)-Desmopressin is an impurity of Desmopressin, which is a synthetic octapeptide and an analog of the human hormone arginine vasopressin with antidiuretic and coagulant activities. Synonyms: Deamino-cysteinyl-L-tyrosyl-L-phenylalanyl-L-glutaminyl-L-asparagyl(Acm)-L-cysteinyl-L-prolyl-D-arginyl-glycinamide (1->6)-disulfide; deamino-Cys-Tyr-Phe-Gln-Asn(Acm)-Cys-Pro-D-Arg-Gly-NH2 (Disulfide bridge: Cys1-Cys6); Mpr-Tyr-Phe-Gln-Asn(Acm)-Cys-Pro-D-Arg-Gly-NH2 (Disulfide Bridge Mpr1-Cys6); [Asn(Acm)]5-Desmopressin; Asn5(Acm)-Desmopressin; N4.5-[(Acetylamino)methyl]desmopressin; Desmopressin EP Impurity F. Grade: ≥95%. Molecular formula: C49H69N15O13S2. Mole weight: 1140.30.
Asn-Ala-Intercellular Adhesion Molecule 1 (1-21) (human). Uses: Designed for use in research and industrial production. Additional or Alternative Names: INTERCELLULAR ADHESION MOLECULE 1 (1-23);ICAM 1 (1-23);H-ASN-ALA-GLN-THR-SER-VAL-SER-PRO-SER-LYS-VAL-ILE-LEU-PRO-ARG-GLY-GLY-SER-VAL-LEU-VAL-THR-CYS-OH;ASN-ALA-GLN-THR-SER-VAL-SER-PRO-SER-LYS-VAL-ILE-LEU-PRO-ARG-GLY-GLY-SER-VAL-LEU-VAL-THR-CYS;ASN-ALA-IC. Product Category: Heterocyclic Organic Compound. CAS No. 139227-42-2. Molecular formula: C99H173N29O32S. Mole weight: 2313.67. Product ID: ACM139227422. Alfa Chemistry ISO 9001:2015 Certified.
Asn-arg-val-tyr-val-his-pro-phe-asn-leu
Asn-arg-val-tyr-val-his-pro-phe-asn-leu. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ANTI-COAGULANT ENZYME;ANGIOTENSIN I (SALMON);ANGIOTENSIN I;ANGIOTENSIN I (BULLFROG) (VAL5, ASN8);(ASN1,VAL5,ASN9)-ANGIOTENSIN I;(ASN1,VAL5,ASN9) ANGIOTENSIN I SALMON;ASN-ARG-VAL-TYR-VAL-HIS-PRO-PHE-ASN-LEU;H-ASN-ARG-VAL-TYR-VAL-HIS-PRO-PHE-ASN-LEU-OH. Product Category: Heterocyclic Organic Compound. CAS No. 86879-15-4. Molecular formula: C59H87N17O14. Mole weight: 1258.43. Purity: 0.96. IUPACName: 2-[[4-amino-2-[[2-[[1-[2-[[2-[[2-[[2-[[5-(diaminomethylideneamino)-2-[(2,4-diamino-4-oxobutanoyl)amino]pentanoyl]amino]-3-methylbutanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-3-methylbutanoyl]amino]-3-(1H-imidazol-5-yl)propanoyl]pyrrolidine-2-carbony. Canonical SMILES: CC(C)CC(C(=O)O)NC(=O)C(CC(=O)N)NC(=O)C(CC1=CC=CC=C1)NC(=O)C2CCCN2C(=O)C(CC3=CN=CN3)NC(=O)C(C(C)C)NC(=O)C(CC4=CC=C(C=C4)O)NC(=O)C(C(C)C)NC(=O)C(CCCN=C(N)N)NC(=O)C(CC(=O)N)N. Product ID: ACM86879154. Alfa Chemistry ISO 9001:2015 Certified.
Asn-asp-asp-cys-glu-leu-cys-val-asn-val-ala-cys-thr-gly-cys-leu. Uses: Designed for use in research and industrial production. Additional or Alternative Names: asn-asp-asp-cys-glu-leu-cys-val-asn-val-ala-cys-thr-gly-cys-leu [disulfide bridges: 4-12,7-15]; UGN (HUMAN); Uroguanylin (huMan)UGN (huMan); UROGUANYLIN; Uroguanylin; UROGUANYLIN (HUMAN). Product Category: Heterocyclic Organic Compound. CAS No. 154525-25-4. Molecular formula: C64H102N18O26S4. Mole weight: 1667.86. Purity: 0.96. IUPACName: (2S)-2-[[(1R,4S,7S,10S,13S,16R,21R,27S,34R,37S,40S)-10-(2-amino-2-oxoethyl)-34-[[(2S)-3-carboxy-2-[[(2S)-3-carboxy-2-[[(2S)-2,4-diamino-4-oxobutanoyl]amino]propanoyl]amino]propanoyl]amino]-37-(2-carboxyethyl)-27-[(1R)-1-hydroxyethyl]-4-methyl-40-(2-methyl. Canonical SMILES: CC1C(=O)NC2CSSCC(C(=O)NC(C(=O)NC(C(=O)NC(CSSCC(NC(=O)CNC(=O)C(NC2=O)C(C)O)C(=O)NC(CC(C)C)C(=O)O)C(=O)NC(C(=O)NC(C(=O)NC(C(=O)N1)C(C)C)CC(=O)N)C(C)C)CC(C)C)CCC(=O)O)NC(=O)C(CC(=O)O)NC(=O)C(CC(=O)O)NC(=O)C(CC(=O)N)N. Product ID: ACM154525254. Alfa Chemistry ISO 9001:2015 Certified.
Asnuciclib
Asnuciclib (CDKI-73; LS-007) is an orally active and highly efficacious CDK9 inhibitor, with Ki values of 4 nM, 4 nM and 3 nM for CDK9, CDK1 and CDK2, respectively. Asnuciclib down-regulates the RNAPII phosphorylation. Asnuciclib is also a novel pharmacological inhibitor of Rab11 cargo delivery and innate immune secretion[1][2][3][4]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: CDKI-73; LS-007. CAS No. 1421693-22-2. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-12445.
ASO 556089 sodium
ASO 556089 sodium is a 16 nucleotide length gapmer (3-10-3) that targets the human and mouse long non-coding RNA MALAT1, with the sequence: 5-GmCATTmCTAATAGmCAGmC-3 [1]. Uses: Scientific research. Group: Signaling pathways. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-148688.
a-Solanine
a-Solanine, an organic compound existing naturally in potatoes and tomatoes, has garnered attention in the field of biomedicine. Its viability in combating specific forms of cancer has been extensively explored. Extensive research illustrates that a-Solanine showcases exceptional anticancer traits by restraining tumor proliferation and stimulating programmed cell death in malignant cells. Synonyms: (3β)-Solanid-5-en-3-yl O-6-deoxy-α-L-mannopyranosyl-(1→2)-O-[β-D-glucopyranosyl-(1→3)]-β-D-galactopyranoside; α-Solanine; α-Solanin. CAS No. 20562-02-1. Molecular formula: C45H73NO15. Mole weight: 868.06.
Asomate
Asomate. Group: Biochemicals. Alternative Names: N, N-Di methyl carbamodithioic Acid Anhydrosulfide with Arsenotrithious Acid; Thioarsenious Acid (H3AsS3), Tris(anhydrosulfide) with Dimethyldithiocarbamic Acid (8CI); Asomate; TDDA; TTCA; Tris (di methyl dithiocarbamato) arsenic; Tris (di methyl dithiocarbamoyl) arsine. Grades: Highly Purified. CAS No. 3586-60-5. Pack Sizes: 1g. Molecular Formula: C9H18AsN3S6, Molecular Weight: 435.57. US Biological Life Sciences.
Worldwide
Asoprisnil
Asoprisnil is a selective progesterone receptor (PR) modulator developed for the treatment of progesterone sensitive myomata. Synonyms: J867; J-867; J 867; Asoprisnil; Asoprisnilum. 11beta-(4-((E)-(Hydroxyimino)methyl)phenyl)-17beta-methoxy-17-(methoxymethyl)estra-4,9-dien-3-one; (8S,11R,13S,14S,17S)-11-[4-[(E)-hydroxyiminomethyl]phenyl]-17-methoxy-17-(methoxymethyl)-13-methyl-1,2,6,7,8,11,12,14,15,16-decahydrocyclopenta[a]phenanthren-3-one. Grade: 98%. CAS No. 199396-76-4. Molecular formula: C28H35NO4. Mole weight: 449.58.
Asoprisnil
Asoprisnil (J867), a selective progesterone receptor modulator, exhibits mixed progesterone agonist and antagonist effects on various progesterone targeted tissues in animal and human [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: J867. CAS No. 199396-76-4. Pack Sizes: 1 mg; 5 mg. Product ID: HY-119433.
Asoprisnil ecamate
Asoprisnil ecamate is a selective progesterone receptor modulator potentially for the treatment of endometriosis. Synonyms: Benzaldehyde, 4-[(11β,17β)-17-methoxy-17-(methoxymethyl)-3-oxoestra-4,9-dien-11-yl]-, 1-[O-[(ethylamino)carbonyl]oxime], [C(E)]-; J 956; (E)-4-((8S,11R,13S,14S,17S)-17-methoxy-17-(methoxymethyl)-13-methyl-3-oxo-2,3,6,7,8,11,12,13,14,15,16,17-dodecahydro-1H-cyclopenta[a]phenanthren-11-yl)benzaldehyde O-ethylcarbamoyl oxime; (11β,17β)-11-{4-[(E)-{[(Ethylcarbamoyl)oxy]imino}methyl]phenyl}-17-methoxy-17-(methoxymethyl)estra-4,9-dien-3-one. Grade: ≥95%. CAS No. 222732-94-7. Molecular formula: C31H40N2O5. Mole weight: 520.67.
Asoxime chloride
Asoxime chloride. Uses: Designed for use in research and industrial production. Additional or Alternative Names: (((4-(iminocarbonyl)pyridinio)methoxy)methyl)-2-((hydroxyimino)methyl)pyridi;4'-carbamoyl-2-formyl-1,1'-(oxydimethylene)di-pyridinium-dichloride-2-oxime;hi6;hi-6;hi-6dichloride;hj6;pyridinium,1-(((4-(aminocarbonyl)pyridinio)methoxy)methyl)-2-((hydroxyimino);pyridinium,4'-carbamoyl-2-formyl-1,1'-(oxydimethylene)di-,dichloride,2-oxi. Appearance: Off-White Solid. CAS No. 34433-31-3. Molecular formula: C14H16Cl2N4O3. Mole weight: 359.21. Purity: 0.98. IUPACName: ASOXIME CHLORIDE. Product ID: ACM34433313. Alfa Chemistry ISO 9001:2015 Certified.
Asoxime chloride
Asoxime chloride. Group: Biochemicals. Alternative Names: 1 [ [ [4- (Aminocarbonyl) pyridinio] methoxy] methyl] -2- [ (hydroxyimino) methyl] pyridinium dichloride; HI 6 chloride; HJ 6. Grades: Highly Purified. CAS No. 34433-31-3. Pack Sizes: 25mg, 50mg, 100mg, 250mg, 500mg. Molecular Formula: C14H16Cl2N4O3. US Biological Life Sciences.
Worldwide
Asoxime Chloride
Cholinesterase reactivator. A potential antidote for organophosphate poisoning. Synonyms: 1[[[4-(Aminocarbonyl)pyridinio]methoxy]methyl]-2-[(hydroxyimino)methyl]pyridinium Dichloride. Grade: > 95%. CAS No. 34433-31-3. Molecular formula: C14H16N4O3.2 Cl. Mole weight: 359.21.
Cholinesterase reactivator. A potential antidote for organophosphate poisoning. Group: Biochemicals. Alternative Names: 1 [ [ [4- (Aminocarbonyl) pyridinio] methoxy] methyl] -2- [ (hydroxyimino) methyl] pyridinium Dichloride. Grades: Highly Purified. Pack Sizes: 10mg. US Biological Life Sciences.
Worldwide
Asoxime-d4 Chloride
Asoxime-d4 Chloride is a labelled Asoxime Chloride. Asoxime Chloride is a cholinesterase reactivator used in the treatment of organophosphate poisoning. Synonyms: 1[[[4-(Aminocarbonyl)pyridinio-d4]methoxy]methyl]-2-[(hydroxyimino)methyl]pyridinium Dichloride; HI 6-d4 Chloride; HJ 6-d4. Grade: > 95%. Molecular formula: C14H12N4O3D4·2Cl. Mole weight: 363.23.
ASP1126
ASP1126 is a selective and orally active agonist of sphingosine-1-phosphate (S1P), with EC50s of 7.12 and 517 nM for hS1P1 and hS1P3, respectively. ASP1126 can reduce the number of peripheral lymphocytes, naive T cells, central memory T cells and effector memory T cells in the peripheral blood, and has the potential to be used in clinical transplantation to improve safety profile. Synonyms: 1-[(7-{[4-(2,2,2-Trifluoroethoxy)-3-(trifluoromethyl)benzyl]oxy}-2H-chromen-3-yl)methyl]-4-piperidinecarboxylic acid hydrochloride (1:1); 4-Piperidinecarboxylic acid, 1-[[7-[[4-(2,2,2-trifluoroethoxy)-3-(trifluoromethyl)phenyl]methoxy]-2H-1-benzopyran-3-yl]methyl]-, hydrochloride (1:1). Grade: ≥95%. CAS No. 1228580-11-7. Molecular formula: C26H26ClF6NO5. Mole weight: 581.93.
ASP-1645
ASP-1645 is a novel P2Y12 receptor antagonist using as an antiplatelet agent. Uses: An antiplatelet agent. Synonyms: ASP-1645; ASP 1645; ASP1645; UNII-M5SN288R8N; (2S)-2-((7-(cyclohexylamino)-1-cyclopentyl-6-fluoro-1,4-dihydro-4-oxo-3-quinolinyl)oxy)-Propanoic acid. Grade: 98%. CAS No. 1347392-70-4. Molecular formula: C23H29FN2O4. Mole weight: 416.49.
ASP2535
ASP2535 is a potent, orally bioavailable, selective, brain permeable and centrally-active glycine transporter-1 (GlyT1) inhibitor. ASP2535 can improve cognitive impairment in animal models of schizophrenia and Alzheimer's disease [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 374886-51-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg. Product ID: HY-110176.
ASP 2535
ASP-2535 has been found to be a GlyT1 inhibitor and brain penetrant. Synonyms: ASP-2535; ASP 2535; ASP2535; 4-[3-(1-Methylethyl)-5-(6-phenyl-3-pyridinyl)-4H-1,2,4-triazol-4-yl]-2,1,3-benzoxadiazole. Grade: ≥98% by HPLC. CAS No. 374886-51-8. Molecular formula: C22H18N6O. Mole weight: 382.42.
ASP 2535
ASP 2535. Group: Biochemicals. Grades: Purified. CAS No. 374886-51-8. Pack Sizes: 10mg. US Biological Life Sciences.
Worldwide
Asp-26-Calcitonin
Asp-26-Calcitonin is an impurity of Calcitonin salmon, which is a calcium regulating hormone used to be an effective alternative for the treatment of postmenopausal osteoporosis. Synonyms: H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bond between Cys1 and Cys7); L-cysteinyl-L-seryl-L-asparagyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-α-aspartyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolinamide (1->7)-disulfide. Molecular formula: C145H239N43O49S2. Mole weight: 3432.88.
ASP 2905
ASP 2905 is a potent and selective potassium channel KCNH3 (Kv12.2) inhibitor with an IC50 of 9.0 nM. KCNH3 is concentrated in the forebrain, and its overexpression in mice leads to cognitive deficits. ASP 2905 has been identified as a candidate for the treatment of attention deficit/hyperactivity disorder. Synonyms: N2-(4-Fluorophenyl)-N4-phenyl-N6-(pyrimidin-2-ylmethyl)-1,3,5-triazine-2,4,6-triamine. Grade: 98%. CAS No. 792184-90-8. Molecular formula: C20H17FN8. Mole weight: 388.40.
ASP 3026
ASP 3026. Group: Biochemicals. Grades: Purified. CAS No. 1097917-15-1. Pack Sizes: 10mg, 50mg. US Biological Life Sciences.
Worldwide
ASP-3026
ASP3026 is a novel and selective inhibitor for the ALK kinase. ASP3026 potently inhibited ALK kinase activity and was more selective than crizotinib in a Tyr-kinase panel. In an anchorage independent in vitro cell growth assay, ASP3026 inhibited the growth of NCI-H2228, a human NSCLC tumor cell line endogenously expressing EML4-ALK variant 3 and that of 3T3 cells expressing EML4-ALK variant 1, 2 and 3. Synonyms: ASP3026; ASP 3026. Grade: 0.98. CAS No. 1097917-15-1. Molecular formula: C29H40N8O3S. Mole weight: 580.74.
Asp371,tyrosinase(369-377),human
Asp371,tyrosinase(369-377),human. Uses: Designed for use in research and industrial production. Additional or Alternative Names: CHEMBL1893277, CA-1602, NCGC00167161-01, (Asp371)-Tyrosinase (369-377) (human), 168650-46-2. Product Category: Heterocyclic Organic Compound. CAS No. 168650-46-2. Molecular formula: C42H66N10O16S2. Mole weight: 1031.16. Purity: 0.96. IUPACName: (2S)-2-[[(2S)-5-amino-2-[[(2S)-2-[[(2S)-2-[[(2S,3R)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-amino-3-(4-hydroxyphenyl)propanoyl]amino]-4-methylsulfanylbutanoyl]amino]-3-carboxypropanoyl]amino]acetyl]amino]-3-hydroxybutanoyl]amino]-4-methylsulfanylbutanoyl]amino]-. Canonical SMILES: CC(C)C(C(=O)O)NC(=O)C(CCC(=O)N)NC(=O)C(CO)NC(=O)C(CCSC)NC(=O)C(C(C)O)NC(=O)CNC(=O)C(CC(=O)O)NC(=O)C(CCSC)NC(=O)C(CC1=CC=C(C=C1)O)N. Product ID: ACM168650462. Alfa Chemistry ISO 9001:2015 Certified.
Asp(3)-Calcitonin (salmon)
Asp(3)-Calcitonin is an impurity of Calcitonin salmon, which is a calcium regulating hormone used to be an effective alternative for the treatment of postmenopausal osteoporosis. Synonyms: Cys-Ser-Asp-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2(Cys1&Cys7 bridge); Asp3-Calcitonin(salmon); [Asp3]-Calcitonin (salmon); Calcitonin C; H-Cys-Ser-Asp-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2; CSDLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2(Cys1&Cys7 bridge); L-Cysteinyl-L-seryl-L-alpha-aspartyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-asparagyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolinamide (1->7)-disulfide; Asp(3)-Calcitonin. Grade: >90%. Molecular formula: C145H239N43O49S2. Mole weight: 3432.88.
ASP-4000
ASP-4000 is a dipeptidyl peptidase 4 (DPP) inhibitor with antihyperglycemic activity. Uses: Hyperlipidaemia;hyperlipoproteinaemia type iia;primary biliary cirrhosis. Synonyms: ASP4000; ASP-4000 free base; 2-Pyrrolidinecarbonitrile, 1-(((1R,3S,4S,6R)-6-hydroxy-2-azabicyclo(2.2.1)hept-3-yl)carbonyl)-, (2S)-. Grade: 98%. CAS No. 851510-67-3. Molecular formula: C12H17N3O2. Mole weight: 235.28.
ASP-4000 hydrochoride
ASP-4000 is a dipeptidyl peptidase 4 (DPP) inhibitor. It has antihyperglycemic activity. Uses: Antihyperglycemic agent. Synonyms: ASP-4000 hydrochoride; ASP 4000 hydrochoride; ASP4000 hydrochoride; UNII-7393JFE67B; (2S)-1-(((1R,3S,4S,6R)-6-Hydroxy-2-azabicyclo(2.2.1)hept-3-yl)carbonyl)-2-pyrrolidinecarbonitrile hydrochloride. Grade: 98%. CAS No. 851389-35-0. Molecular formula: C12H18ClN3O2. Mole weight: 271.74.
ASP-4058
ASP-4058 is a selective, next-generation and orally active Sphingosine 1-Phosphate receptors 1 and 5 (S1P1 and S1P5) agonist. It ameliorates experimental autoimmune encephalomyelitis in rodent with a favorable safety profile. Synonyms: 1H-Benzimidazole, 5-[5-[3-(trifluoromethyl)-4-[(1S)-2,2,2-trifluoro-1-methylethoxy]phenyl]-1,2,4-oxadiazol-3-yl]-; 5-{5-[3-(Trifluoromethyl)-4-{[(2S)-1,1,1-trifluoro-2-propanyl]oxy}phenyl]-1,2,4-oxadiazol-3-yl}-1H-benzimidazole. Grade: ≥95%. CAS No. 952565-91-2. Molecular formula: C19H12F6N4O2. Mole weight: 442.31.
ASP-4058 hydrochloride
ASP-4058 hydrochloride is a selective, next-generation and orally active Sphingosine 1-Phosphate receptors 1 and 5 (S1P1 and S1P5) agonist. It ameliorates experimental autoimmune encephalomyelitis in rodent with a favorable safety profile. Synonyms: 5-(5-(3-(Trifluoromethyl)-4-(((2S)-1,1,1-trifluoropropan-2-yl)oxy)phenyl)-1,2,4-oxadiazol-3-yl)-1H-benzimidazole hydrochloride; 1H-Benzimidazole, 6-(5-(3-(trifluoromethyl)-4-((1S)-2,2,2-trifluoro-1-methylethoxy)phenyl)-1,2,4-oxadiazol-3-yl)-, hydrochloride (1:1). Grade: ≥95%. CAS No. 952510-14-4. Molecular formula: C19H13ClF6N4O2. Mole weight: 478.78.
ASP4132
ASP4132 is an orally active activator of adenosine monophosphate-activated protein kinase (AMPK) with EC50 of 0.018 μM. CAS No. 1640294-30-9. Molecular formula: C46H51F3N6O8S2. Mole weight: 937.06.
ASP-5854
ASP-5854 is an adenosine A1 and A2A receptor antagonist receptor. It has therapeutic potential for the treatment of Parkinson's disease to ameliorate motor deficiencies. Uses: Parkinson's disease. Synonyms: ASP-5854; ASP 5854; ASP5854; UNII-BJS8Y4IC5V; C524699; 5-(5-amino-3-(4-fluorophenyl)-2-pyrazinyl)-1-(1-methylethyl)-2(1H)-Pyridinone. Grade: 98%. CAS No. 851087-60-0. Molecular formula: C18H17FN4O. Mole weight: 324.35.
ASP5878
ASP5878 is a potent and selective inhibitor of fibroblast growth factor receptor (FGFR). Synonyms: ASP-5878; ASP 5878. CAS No. 1453208-66-6. Molecular formula: C18H19F2N5O4. Mole weight: 407.37.
ASP5878
ASP5878 is an oral active inhibitor of FGFR 1, 2, 3, and 4 , with IC 50 values of 0.47 nM, 0.6 nM, 0.74 nM and 3.5 nM for FGFR 1, 2, 3, and 4 kinase activity. ASP5878 has potential antineoplastic activity [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1453208-66-6. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-19983.
Asp5-Atosiban
An impurity of Atosiban. Atosiban is a synthetic peptide that acts as a selective oxytocin receptor antagonist, primarily used to delay preterm labor in pregnant women. Synonyms: Mpr-DTyr(Et)-Ile-Thr-Asp-Cys-Pro-Orn-Gly-NH2(Mpr1&Cys6 bridge); deamino-Cys-D-Tyr(Et)-Ile-Thr-Asp-Cys-Pro-Orn-Gly-NH2 (Disulfide bridge: Cys1-Cys6); Deamino-cysteinyl-O4-ethyl-D-tyrosyl-L-isoleucyl-L-threonyl-L-alpha-aspartyl-L-cysteinyl-L-prolyl-L-ornithyl-glycinamide (1->6)-disulfide; [Asp5]-Atosiban; Asp(5)-Atosiban. Grade: ≥95%. CAS No. 2014351-16-5. Molecular formula: C43H66N10O13S2. Mole weight: 995.18.
Asp(5)-AVP
Asp(5)-AVP is an impurity of Vasopressin, which is an antidiuretic hormone secreted from the posterior pituitary. Synonyms: Asp5-AVP; Asp(5)-Arg-Vasopressin; Asp(5)-Vasopressin; Vasopressin, 5-L-aspartic acid-8-L-arginine-; H-Cys-Tyr-Phe-Gln-Asp-Cys-Pro-Arg-Gly-NH2 (Disulfide bridge: Cys1-Cys6); L-cysteinyl-L-tyrosyl-L-phenylalanyl-L-glutaminyl-L-aspartyl-L-cysteinyl-L-prolyl-L-arginyl-glycinamide (1->6)-disulfide. CAS No. 78031-79-5. Molecular formula: C46H64N14O13S2. Mole weight: 1085.22.
Asp 5-Oxytocin
Asp 5-Oxytocin is an impurity of Oxytocin, which is a mammalian neurohypophysial hormone used as a vasodilator agent. Synonyms: [5-Aspartic acid]oxytocin; L-Cystyl-L-tyrosyl-L-isoleucyl-L-glutaminyl-L-aspartyl-L-cystyl-L-leucyl-L-prolyl-L-glycinamide (disulfide bridge between cysteines); H-Cys-Tyr-Ile-Gln-Asp-Cys-Pro-Leu-Gly-NH2 (Disulfide bridge: Cys1-Cys6); Oxytocin, 5-L-aspartic acid-; [5-Aspartic acid]-oxytocin; L-Cysteinyl-L-tyrosyl-L-isoleucyl-L-glutaminyl-L-alpha-aspartyl-L-cysteinyl-L-prolyl-L-leucyl-glycinamide (1->6)-disulfide; [Asp5]-Oxytocin; Oxytocin EP Impurity I; 5-L-Aspartic acid-oxytocin; 5-Asp-oxytocin; Asp5-Oxytocin; Asp5-Oxytocin; CYIQDCPLG-NH2(Cys1&Cys6 bridge); Cys-Tyr-Ile-Gln-Asp-Cys-Pro-Leu-Gly-NH2(Cys1&Cys6 bridge). Grade: ≥95%. CAS No. 65907-78-0. Molecular formula: C43H65N11O13S2. Mole weight: 1008.18.
ASP-7657
ASP-7657 is an analgesic and anti-inflammatory agent for the treatment of diabetic neuropathies developed by Astellas Pharma. A phase I clinical trial to evaluate the safety and tolerability of single and multiple ascending oral doses of ASP7657 in healthy subjects was started in 2014 but discontinued in 2015. Uses: An analgesics and anti-inflammatories for the treatment of diabetic neuropathies. Synonyms: ASP 7657; ASP7657; trans-4-[[[[1-(2-quinolinylmethyl)-5-(trifluoromethyl)-1H-indol-7-yl]carbonyl]amino]methyl]-cyclohexanecarboxylic acid. Grade: ≥98%. CAS No. 1196045-28-9. Molecular formula: C28H26F3N3O3. Mole weight: 509.52.
ASP7663
ASP7663 is an orally active and selective TRPA1 agonist. ASP7663 exerts both anti-constipation and anti-abdominal pain actions [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1190217-35-6. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-101907.
ASP 7663. Group: Biochemicals. Grades: Purified. CAS No. 1190217-35-6. Pack Sizes: 10mg, 50mg. US Biological Life Sciences.
Worldwide
ASP 7663
ASP 7663 has been found to be a TRPA1 activator and could show abdominal analgesic activities. Synonyms: ASP7663; ASP-7663; ASP 7663; (2E)-2-[7-Fluoro-1,2-dihydro-1-(2-methylpropyl)-2-oxo-3H-indol-3-ylidene]acetic acid. Grade: ≥98% by HPLC. CAS No. 1190217-35-6. Molecular formula: C14H14FNO3. Mole weight: 263.26.
Asp(7)-Linaclotide
Asp(7)-Linaclotde is an impurity of Linaclotide, which is a peptide agonist of guanylate cyclase 2C used for the treatment of abdominal pain in patients with irritable bowel syndrome (IBS) associated with constipation. Synonyms: L-cysteinyl-L-cysteinyl-L-alpha-glutamyl-L-tyrosyl-L-cysteinyl-L-cysteinyl-L-α-aspartyl-L-prolyl-L-alanyl-L-cysteinyl-L-threonyl-glycyl-L-cysteinyl-L-tyrosine (1-6),(2-10),(5-13)-tris(disulfide); H-Cys-Cys-Glu-Tyr-Cys-Cys-Asp-Pro-Ala-Cys-Thr-Gly-Cys-Tyr-OH (Disulfide bridge: Cys1-Cys6, Cys2-Cys10, Cys5-Cys13); [7-Asp]-linaclotide; L-Tyrosine, L-cysteinyl-L-cysteinyl-L-α-glutamyl-L-tyrosyl-L-cysteinyl-L-cysteinyl-L-α-aspartyl-L-prolyl-L-alanyl-L-cysteinyl-L-threonylglycyl-L-cysteinyl-, cyclic (1→6),(2→10),(5→13)-tris(disulfide). CAS No. 1207977-38-5. Molecular formula: C59H78N14O22S6. Mole weight: 1527.71.
ASP-8497
ASP8497 is a long-acting and potent DPP-IV inhibitor. It improves glucose tolerance through glucose-dependent insulinotropic action via elevation of the GLP-1 level. It is used as a therapeutic agent for impaired glucose tolerance and type 2 diabetes. Uses: Asp8497 is used as a therapeutic agent for impaired glucose tolerance and type 2 diabetes. Synonyms: 2-Pyrrolidinecarbonitrile, 4-fluoro-1-(((4-methyl-1-(methylsulfonyl)-4-piperidinyl)amino)acetyl)-, (2S,4S)-(2E)-2-butenedioate (1:1); ASP8497; ASP 8497; (E)-but-2-enedioic acid (2S,4S)-4-fluoro-1-[2-[(4-methyl-1-methylsulfonylpiperidin-4-yl)amino]acetyl]pyrrolidine-2. Grade: 98%. CAS No. 651055-26-4. Molecular formula: C18H27FN4O7S. Mole weight: 462.49.
ASP-8497 free base
ASP-8497 free base is a long-acting and potent DPP-IV inhibitor. It improves glucose tolerance through glucose-dependent insulinotropic action via elevation of the GLP-1 level. It is used as a therapeutic agent for impaired glucose tolerance and type 2 diabetes. Uses: Asp-8497 free base is used as a therapeutic agent for impaired glucose tolerance and type 2 diabetes. Synonyms: 2-Pyrrolidinecarbonitrile, 4-fluoro-1-(((4-methyl-1-(methylsulfonyl)-4-piperidinyl)amino)acetyl)-, (2S,4S)-; (2S,4S)-4-fluoro-1-[2-[(4-methyl-1-methylsulfonylpiperidin-4-yl)amino]acetyl]pyrrolidine-2-carbonitrile; ASP8497; ASP 8497 free base. Grade: 98%. CAS No. 651055-25-3. Molecular formula: C14H23FN4O3S. Mole weight: 346.42.
Asp8,Gly12-Terlipressin
An impurity of Terlipressin. Terlipressin is a synthetic vasopressin analogue primarily used to improve kidney function in adults with hepatorenal syndrome (HRS), a condition that causes kidney problems in individuals with severe liver disease. It acts as a vasoconstrictor, predominantly in the splanchnic circulation, which helps increase arterial pressure and reduce portal venous pressure. Synonyms: Gly-Gly-Gly-Cys-Tyr-Phe-Gln-Asp-Cys-Pro-Lys-Gly(Cys4&Cys9 bridge); [8-L-aspartic acid,12-glycine]terlipressin; Terlipressin EP Impurity L; H-Gly-Gly-Gly-Cys-Tyr-Phe-Gln-Asp-Cys-Pro-Lys-Gly-OH (Disulfide bridge: Cys4-Cys9); Glycyl-glycyl-glycyl-L-cysteinyl-L-tyrosyl-L-phenylalanyl-L-α-aspartyl-L-asparagyl-L-cysteinyl-L-prolyl-L-lysyl-glycine (4->9)-disulfide; GGGCYFQDCPKG(Cys4&Cys9 bridge); [Asp8, Gly12]-Terlipressin; Terlipressin Impurity L; [Asp(8), Gly(12)]-Terlipressin [Asp(8)-TLY-COOH]. Grade: ≥95%. Molecular formula: C52H72N14O17S2. Mole weight: 1229.35.
Asp8-Terlipressin
An impurity of Terlipressin. Terlipressin is a synthetic vasopressin analogue primarily used to improve kidney function in adults with hepatorenal syndrome (HRS), a condition that causes kidney problems in individuals with severe liver disease. It acts as a vasoconstrictor, predominantly in the splanchnic circulation, which helps increase arterial pressure and reduce portal venous pressure. Synonyms: Gly-Gly-Gly-Cys-Tyr-Phe-Gln-Asp-Cys-Pro-Lys-Gly-NH2(Cys4&Cys9 bridge); α-Asp(8)-Terlipressin; GGGCYFQDCPKG-NH2(Cys4&Cys9 bridge); N-[N-(N-Glycylglycyl)glycyl]-5-L-aspartic acid-8-L-lysine-vasopressin; Terlipressin EP Impurity H; [8-L-α-aspartic acid]terlipressin; H-Gly-Gly-Gly-Cys-Tyr-Phe-Gln-Asp-Cys-Pro-Lys-Gly-NH2 (Disulfide bridge: Cys4-Cys9); Glycyl-glycyl-glycyl-L-cysteinyl-L-tyrosyl-L-phenylalanyl-L-glutaminyl-L-α-aspartyl-L-cysteinyl-L-prolyl-L-lysyl-glycinamide (4->9)-disulfide; [Asp8]-Terlipressin; Asp(8)-Terlipressin. Grade: ≥95%. CAS No. 159594-68-0. Molecular formula: C52H73N15O16S2. Mole weight: 1228.37.
ASP-9521
ASP-9521 is a potent, selective and orally available AKR1C3 inhibitor with an IC50 of 11 nM for human AKR1C3. Uses: Scientific research. Group: Signaling pathways. CAS No. 1126084-37-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg; 200 mg. Product ID: HY-19903.
ASP-9521
ASP9521 is a novel, selective, orally bioavailable inhibitor of 17β-hydroxysteroid dehydrogenase type 5 (17βHSD5; AKR1C3). ASP9521 has demonstrated anti-tumour activity in in vitro and in vivo preclinical models. ASP9521 inhibited conversion of androstenedione (AD) into testosterone (T) by recombinant human or cynomolgus monkey AKR1C3 in a concentration-dependent manner. Synonyms: ASP9521; ASP-9521; ASP 9521. AKR1C3 inhibitor ; 17HSD5 inhibitor; 4-(2-Hydroxy-2-methylpropyl)piperidino(5-methoxy-1H-indole-2-yl)methanone; 1-[1-[(5-Methoxy-1H-indol-2-yl)carbonyl]piperidin-4-yl]-2-methylpropan-2-ol. Grade: 98%. CAS No. 1126084-37-4. Molecular formula: C19H26N2O3. Mole weight: 330.428.
Asp9-Bivalirudin
Asp9-Bivalirudin is a modified analog of the anticoagulant peptide Bivalirudin, with an aspartic acid residue at the 9th position. Bivalirudin is a direct thrombin inhibitor used as an anticoagulant to prevent blood clots in patients undergoing certain medical procedures or with specific conditions. Synonyms: H-D-Phe-Pro-Arg-Pro-Gly-Gly-Gly-Gly-Asp-Gly-Asp-Phe-Glu-Glu-Ile-Pro-Glu-Glu-Tyr-Leu-OH; D-Phenylalanyl-L-prolyl-L-arginyl-L-prolylglycylglycylglycylglycyl-L-α-aspartylglycyl-L-α-aspartyl-L-phenylalanyl-L-α-glutamyl-L-α-glutamyl-L-isoleucyl-L-prolyl-L-α-glutamyl-L-α-glutamyl-L-tyrosyl-L-leucine; [Asp9]-Bivalirudin; DPhe-PRPGGGGDGDFEEIPEEYL; DPhe-Pro-Arg-Pro-Gly-Gly-Gly-Gly-Asp-Gly-Asp-Phe-Glu-Glu-Ile-Pro-Glu-Glu-Tyr-Leu. Grade: ≥95%. CAS No. 1182140-65-3. Molecular formula: C98H137N23O34. Mole weight: 2181.27.
AspA2 I
One unit of the enzyme is the amount required to hydrolyze 1 μg of Lambda DNA (HindIII-digest) in 1 hour at 37°C in a total reaction volume of 50 μl. Applications: After 10-fold overdigestion with enzyme more than 90% of the dna fragments can be ligated and recut. Group: Restriction Enzymes. Purity: 500U; 2500U. C↑CTAGG GGATC↓C. Activity: 10000u.a./ml. Storage: -20°C. Form: Liquid. Source: Arthrobacter species A2. Pack: 10 mM Tris-HCl (pH 7.5); 100 mM NaCl; 0.1 mM EDTA; 7 mM 2-mercaptoethanol; 100 μg/ml BSA; 50% glycerol. Cat No: RE-1024EN.
Asparaginase, also known as crisantaspase, is an enzyme that is used as a medication and in food manufacturing. As a medication it is used to treat acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), and non-Hodgkin's lymphoma. It is given by injection into a vein, muscle, or under the skin. A pegylated version is also available. In food manufacturing it is used to decrease the acrylamide. Group: Enzymes. Synonyms: asparaginase II; L-asparaginase; colaspase; elspar; leunase; crasnitin; α-asparaginase. Enzyme Commission Number: EC 3.5.1.1. CAS No. 9015-68-3. Asparaginase. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4377; asparaginase; EC 3.5.1.1; 9015-68-3; asparaginase II; L-asparaginase; colaspase; elspar; leunase; crasnitin; α-asparaginase. Cat No: EXWM-4377.
Asparaginase from E. coli, Recombinant
Asparaginase (EC 3.5.1.1, USAN) or Colaspase (BAN) is an enzyme that catalyzes the hydrolysis of asparagine to aspartic acid. Asparaginases are enzymes expressed and produced by microorganisms. Group: Enzymes. Synonyms: EC 3.5.1.1; Asparaginase; Colaspase; L-asparaginase; L-asparagine amidohydrolase. Enzyme Commission Number: EC 3.5.1.1. CAS No. 9015-68-3. Asparaginase. Mole weight: ~ 37,900. Activity: ~ 15 U/mg. Stability: > 4 years at 4°C. Storage: 4°C. Form: In 2.5 M lithium sulphate. Source: E. coli. EC 3.5.1.1; Asparaginase; Colaspase; L-asparaginase; L-asparagine amidohydrolase. Cat No: NATE-1932.
Asparaginase?polyethylene glycol from Escherichia coli
United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards.
Asparagine monohydrate
United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standardseuropean pharmacopoeia (ph. eur.)pharmacopoeial standards. Alternative Names: Asparagine monohydrate, (2S)-2,4-Diamino-4-oxobutanoic acid monohydrate.
Asparagine Monohydrate
Asparagine Monohydrate. Group: Biochemicals. Alternative Names: (±)-Asparagine; 2-Aminosuccinamic Acid; NSC 206243; NSC 7891; DL-Aspartamine. Grades: Highly Purified. CAS No. 3130-87-8. Pack Sizes: 10g. Molecular Formula: C4H10N2O4, Molecular Weight: 150.13. US Biological Life Sciences.
Worldwide
asparagine-oxo-acid transaminase
A pyridoxal-phosphate protein. Group: Enzymes. Synonyms: asparagine-keto acid aminotransferase. Enzyme Commission Number: EC 2.6.1.14. CAS No. 9030-43-7. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2854; asparagine-oxo-acid transaminase; EC 2.6.1.14; 9030-43-7; asparagine-keto acid aminotransferase. Cat No: EXWM-2854.
asparagine synthase (glutamine-hydrolysing)
The enzyme from Escherichia coli has two active sites that are connected by an intramolecular ammonia tunnel. The enzyme catalyses three distinct chemical reactions: glutamine hydrolysis to yield ammonia takes place in the N-terminal domain. The C-terminal active site mediates both the synthesis of a β-aspartyl-AMP intermediate and its subsequent reaction with ammonia. The ammonia released is channeled to the other active site to yield asparagine. Group: Enzymes. Synonyms: asparagine synthetase (glutamine-hydrolysing); glutamine-dependent asparagine synthetase; asparagine synthetase B; AS; AS-B. Enzyme Commission Number: EC 6.3.5.4. CAS No. 37318-72-2. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5807; asparagine synthase (glutamine-hydrolysing); EC 6.3.5.4; 37318-72-2; asparagine synthetase (glutamine-hydrolysing); glutamine-dependent asparagine synthetase; asparagine synthetase B; AS; AS-B. Cat No: EXWM-5807.