A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| Garcinol | Garcinol. Group: Biochemicals. Grades: Purified. CAS No. 78824-30-3. Pack Sizes: 10mg. US Biological Life Sciences. |  Worldwide |
| Garcinol | Garcinol, a polyisoprenylated benzophenone harvested from Garcinia indica , exerts anti-cholinesterase properties towards acetyl cholinesterase (AChE) and butyrylcholinesterase (BChE) with IC 50 s of 0.66 μM and 7.39 μM, respectively [1]. Garcinol also inhibits histone acetyltransferases ( HATs , IC 50 = 7 μM) and p300/CPB-associated factor ( PCAF , IC 50 = 5 μM). Garcinol has anti-inflammatory and anti-cancer activity [2]. Uses: Scientific research. Group: Natural products. CAS No. 78824-30-3. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg. Product ID: HY-107569. |  |
| Garcinol | Garcinol is an inhibitor of PCAF and p300 histone acetyltransferase (HAT) activity (IC50 = 5 and 7 μM, respectively), which is isolated from Garcinia indica. It also inhibits the HAT GCN5 in Cryptococcus neoformans. Garcinol promotes expansion of human HSCs ex vivo. It induces apoptosis in some cancer cells thus can be used as a cancer therapy. Synonyms: Camboginol; (1R,5R,7R)-3-(3,4-Dihydroxybenzyol)-4-hydroxy-8,8-dimethyl-1,7-bis(3-methyl-2-buten-1-yl)-5-[(2S)-5-methyl-2-(1-methylethenyl)-4-hexen-1-yl]bicyclo[3.3.1]non-3-ene-2,9-dione. Grades: ≥98% by HPLC. CAS No. 78824-30-3. Molecular formula: C38H50O6. Mole weight: 602.8. |  |
| Garcinol (Camboginol, CCRIS 9029, CHEMBL502489) | Garcinol (Camboginol, CCRIS 9029, CHEMBL502489). Group: Biochemicals. Alternative Names: (1S, 3E, 5R, 7R)-3-[(3, 4-dihydroxyphenyl)-hydroxymethylidene]-6, 6-dimethyl-5, 7-bis(3-methylbut-2-enyl)-1-[(2S)-5-methyl-2-prop-1-en-2-ylhex-4-enyl]bicyclo[3. 3. 1]nonane-2, 4, 9-trione. Grades: Highly Purified. CAS No. 78824-30-3. Pack Sizes: 25mg. Molecular Formula: C38 H50 O6 , Molecular Weight: 602.8. US Biological Life Sciences. | Worldwide |
| GARCINOLIC ACID, trans- | Garcinia. Group: Quinones. CAS No. 7567-00-2. Mole weight: 646.77. Appearance: Yellow powder. Catalog: ACM7567002. |  |
| Garcinone C | Garcinone C. Group: Biochemicals. Grades: Plant Grade. CAS No. 76996-27-5. Pack Sizes: 10mg. Molecular Formula: C23H26O7, Molecular Weight: 414.45. US Biological Life Sciences. | Worldwide |
| Garcinone C | Garcinone C, a xanthone derivative, is a natural compound extracted from Garcinia oblongifolia that is used as an anti-inflammatory, astringency and granulation-promoting medicine, and has potential cytotoxic effects on certain cancers. Garcinone C stimulates the expression levels of ATR and 4E-BP1, while efficiently inhibiting the expression levels of cyclin B1, cyclin D1, cyclin E2, cdc2, Stat3 and CDK7. Garcinone C significantly inhibits cell viability of the human Nasopharyngeal carcinoma (NPC) cell lines CNE1, CNE2, HK1 and HONE1 in a time - and dose - dependent manner. Group: Inhibitors. Alternative Names: 1,3,6,7-Tetrahydroxy-8-(3-hydroxy-3-methylbutyl)-2-(3-methyl-2-buten-1-yl)-9H-xanthen-9-one. CAS No. 76996-27-5. Molecular formula: C23H26O7. Mole weight: 414.45. Appearance: Powder. Purity: 0.98. IUPACName: 1,3,6,7-Tetrahydroxy-8-(3-hydroxy-3-methylbutyl)-2-(3-methylbut-2-enyl)xanthen-9-one. Canonical SMILES: CC (=CCC1=C (C2=C (C=C1O)OC3=C (C2=O)C (=C (C (=C3)O)O)CCC (C) (C)O)O)C. Density: 1.367 g/ml. Catalog: ACM76996275. | |
| Garcinone D | Garcinone D. Group: Biochemicals. Grades: Plant Grade. CAS No. 107390-08-9. Pack Sizes: 10mg. Molecular Formula: C24H28O7, Molecular Weight: 428.48. US Biological Life Sciences. | Worldwide |
| Garcinone E | Flavonoids. CAS No. 112649-21-5. Molecular formula: C28H32O6. Mole weight: 464.6. Appearance: Yellow powder. Purity: 0.98. IUPACName: 2,3,6,8-tetrahydroxy-1,4,7-tris(3-methylbut-2-enyl)xanthen-9-one. Canonical SMILES: CC (=CCC1=C (C=C2C (=C1O)C (=O)C3=C (C (=C (C (=C3O2)CC=C (C)C)O)O)CC=C (C)C)O)C. Catalog: ACM112649215. | |
| Gardamide | Gardamide. CAS No. 84434-18-4. VIGON Item # 503221. Categories: Speciality Ingrdients Suppliers, Fragrances, Perfumers, gardenia amide. |  America & Internationally |
| Gardenia blue | Heterocyclic Organic Compound. CAS No. 106441-42-3. Catalog: ACM106441423. | |
| Gardenia Extract | Extract obtained from Gardenia Florida (Gardenia) flowers. Contains 20% extract dissolved in water and glycerin. Has excellent soothing and calming properties. Uses: Ointments, salves, hair care products and lotions. Group: Skin actives. CAS No. 7732-18-5 / 56-81-5 / 92457-01-7 / 122-99-6. Appearance: Light to medium yellow to amber liquid, characteristic odor. Catalog: CI-SC-0936. | |
| Gardenia Extract | Gardenia Extract. Applications: Used for health care products, dietary supplements, herb medecine and cosmetic industry. Group: Others. Synonyms: Gardenia Extract; 24512-63-8; Gardenia florida L. CAS No. 24512-63-8. Purity: 50% Geniposide by HPLC, 5-10:1 by TLC. Appearance: Yellow Brown fine powder. Storage: 2 years under well storage situation and stored away from direct sun light. Source: Flower. Species: Gardenia florida L. Gardenia Extract; 24512-63-8; Gardenia florida L.; plant extract. Pack: 25KG/Drum with double plastic bag of foodstuff inside. Cat No: EXTW-138. |  |
| Gardenia green | Heterocyclic Organic Compound. CAS No. 117148-27-3. Catalog: ACM117148273. | |
| Gardenia yellow | Gardenia yellow. Group: Biochemicals. Grades: Highly Purified. CAS No. 94238-00-3. Pack Sizes: 100mg, 250mg, 500mg, 1g. Molecular Formula: C44H64O24. US Biological Life Sciences. | Worldwide |
| Gardenia yellow | Gardenia yellow is an active member of crocin, increases mRNA expression of SIRT3 , and acts as an orally active antidepressant agent [1]. Uses: Scientific research. Group: Natural products. CAS No. 94238-00-3. Pack Sizes: 50 mg; 100 mg. Product ID: HY-N6675. | |
| Gardenia Yellow | Gardenia Yellow. Applications: Used as coloring in the production of beverage, food and supplement products. Group: Others. Synonyms: Gardenia Yellow; 94238-00-3; Gardenia jasminoides L. CAS No. 94238-00-3. Appearance: Yellow fine powder. Storage: 2 years under well storage situation and stored away from direct sun light. Source: Fruit. Species: Gardenia jasminoides L. Gardenia Yellow; 94238-00-3; Gardenia jasminoides L.; plant extract. Pack: 25KG/Drum with double plastic bag of foodstuff inside. Cat No: EXTW-115. | |
| Gardenin B | Gardenin B. Group: Biochemicals. Alternative Names: 5-Hydroxy-4',6,7,8-tetramethoxyflavone; 5-O-Demethyltangeretin; 5-Desmethyltangeretin. Grades: Plant Grade. CAS No. 2798-20-1. Pack Sizes: 20mg. Molecular Formula: C19H18O7, Molecular Weight: 358.341999999999. US Biological Life Sciences. | Worldwide |
| Gardenol | Gardenol (Styrallyl Acetate). CAS No. 93-92-5. FEMA No. 2684. Kosher: Y. VIGON Item # 500162. Categories: Speciality Ingrdients Suppliers, Flavors, Fragrances, Perfumers. | America & Internationally |
| Gardenolic Acid B | Terpenoids. CAS No. 108864-53-5. Molecular formula: C30H46O5. Mole weight: 486.69. Appearance: Powder. Purity: 0.98. IUPACName: (1S, 3S, 4S, 6S, 7S, 8R, 11S, 12S, 15R, 16R)-4, 6-dihydroxy-7, 12, 16-trimethyl-15-[(2R)-6-methyl-4-oxohept-5-en-2-yl]pentacyclo[9.7.0.01, 3.03, 8.012, 16]octadecane-7-carboxylic acid. Canonical SMILES: CC (CC (=O)C=C (C)C)C1CCC2 (C1 (CCC34C2CCC5C3 (C4)C (CC (C5 (C)C (=O)O)O)O)C)C. Catalog: ACM108864535. | |
| Gardenoside | Gardenoside. Group: Biochemicals. Grades: Plant Grade. CAS No. 24512-62-7. Pack Sizes: 10mg. Molecular Formula: C17H24O11, Molecular Weight: 404.37. US Biological Life Sciences. | Worldwide |
| Gardiquimod | Gardiquimod is a small-molecule agonist of TLR7. It induces the activation of NF-κB in HEK 293 cells expressing TLR7. Uses: Toll-like receptor agonists. Synonyms: 1H-Imidazo[4,5-c]quinoline-1-ethanol, 4-amino-2-[(ethylamino)methyl]-α,α-dimethyl-; 4-Amino-2-[(ethylamino)methyl]-α,α-dimethyl-1H-imidazo[4,5-c]quinoline-1-ethanol; 1-(4-amino-2-((ethylamino)methyl)-1H-imidazo[4,5-c]quinolin-1-yl)-2-methylpropan-2-ol. Grades: ≥98% (HPLC). CAS No. 1020412-43-4. Molecular formula: C17H23N5O. Mole weight: 313.40. | |
| Gardiquimod | Immune response modifier. Antiviral and antitumor compound. Selective ligand for human or mouse Toll-like receptor 7 (TLR7). Induces the activation of NF-kappaB in HEK 293 cells expressing TLR7 at 0.1ug/ml. 10 times more active than Imiquimod. At high concentrations (3ug/ml) slightly activates TLR8. Shows adjuvant activity to increase the effectiveness of vaccines. Group: Biochemicals. Alternative Names: 1- (4-Amino-2-ethylamino methyl imidazo [4, 5-c] quinolin-1-yl) -2- methyl propan-2-ol, 4-Amino-2-[(ethylamino)methyl]-?,?-dimethyl-1H-Imidazo[4,5-c]quinoline-1-ethanol. Grades: Highly Purified. CAS No. 1020412-43-4. Pack Sizes: 5mg, 25mg. Molecular Formula: C??H??N?O. US Biological Life Sciences. | Worldwide |
| Gardiquimod TFA | Gardiquimod is a chemical compound which acts selectively at both mouse and human forms of toll-like receptor 7 (TLR7). It functions as an immune response modifier. The core structure is 1H-imidazo[4,5-c]quinoline, as found in related drugs such as imiquimod and resiquimod. It is structurally very similar to resiquimod differing only by an oxygen for nitrogen switch. Group: Others. Alternative Names: Gardiquimod TFA salt; Gardiquimod. CAS No. 1159840-61-5. Molecular formula: C19H24F3N5O3. Mole weight: 427.43. Appearance: Solid powder. Purity: >98%. IUPACName: 1-(4-amino-2-((ethylamino)methyl)-1H-imidazo[4,5-c]quinolin-1-yl)-2-methylpropan-2-ol 2,2,2-trifluoroacetate. Canonical SMILES: CC (O) (C)CN1C (CNCC)=NC2=C1C3=CC=CC=C3N=C2N. O=C (O)C (F) (F)F. Catalog: ACM1159840615. | |
| Gardoside | Gardoside is found in the fruits of Gardenia jasminoides. Synonyms: Gardoside; 54835-76-6; (1S,4aS,6S,7aS)-6-hydroxy-7-methylidene-1-[(2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-4a,5,6,7a-tetrahydro-1H-cyclopenta[c]pyran-4-carboxylic acid; CHEMBL3622810; CHEBI:80827. Grades: > 95%. CAS No. 54835-76-6. Molecular formula: C16H22O10. Mole weight: 374.34. | |
| Garenoxacin | Garenoxacin, also called as BMS 284756, a new desfluoro(6)quinolone, is a topoisomerase II inhibitor with actibacterial activity to treat Gram-positive and Gram-negative bacterial infections. Uses: Des-f(6)-quinolone antibacterial; topoisomerase ii inhibitor. antibacterial. Synonyms: 1-cyclopropyl-8-(difluoromethoxy)-7-[(1R)-1-methyl-2,3-dihydro-1H-isoindol-5-yl]-4-oxoquinoline-3-carboxylic acid BMS 284756 BMS-284756 BMS284756 garenoxacin. CAS No. 194804-75-6. Molecular formula: C23H20F2N2O4. Mole weight: 426.41. | |
| Garenoxacin | Garenoxacin (BMS284756) is an orally active quinolone antibiotic and has a broad spectrum of activity against a wide array of gram-positive and gram-negative bacteria, anaerobes, and fastidious organisms. Group: Inhibitors. Alternative Names: GARENOXACIN HBR;Garenoxacin;1-Cyclopropyl-8-(difluoromethoxy)-7-[(1R)-1-methyl-2,3-dihydro-1H-isoindol-5-yl]-4-oxoquinoline-3-carboxylic acid;1-Cyclopropyl-8-(difluoromethoxy)-7-[(1R)-(1-methyl-2,3-dihydro-1H-5-isoindolyl)-4-oxo-1,4-dihydro-3-quinolineca. CAS No. 194804-75-6. Molecular formula: C23H20F2N2O4. Mole weight: 426.41. Catalog: ACM194804756. | |
| Garenoxacin | Garenoxacin. Group: Biochemicals. Alternative Names: 1-Cyclopropyl-8-(difluoromethoxy)-7-[(1R)-2,3-dihydro-1-methyl-1H-isoindol-5-yl]-1,4-dihydro-4-oxo-3-quinolinecarboxylic acid; Ganefloxacin. Grades: Highly Purified. CAS No. 194804-75-6. Pack Sizes: 1mg, 2mg, 5mg, 10mg, 25mg. Molecular Formula: C23H20F2N2O4. US Biological Life Sciences. | Worldwide |
| Garenoxacin mesylate | Garenoxacin mesylate is a novel oral des-fluoro quinolone with potent antimicrobial activity for the treatment of Gram-positive and Gram-negative bacterial infections. Synonyms: 1-cyclopropyl-8-(difluoromethoxy)-7-[(1R)-1-methyl-2,3-dihydro-1H-isoindol-5-yl]-4-oxoquinoline-3-carboxylic acid;methanesulfonic acid; 1-cyclopropyl-8-(difluoromethoxy)-7-(1-methyl-2,3-dihydro-1H-5-isoindolyl)-4-oxo-1,4-dihydro-3-quinolinecarboxylic acid methanesulfonate monohydrate; T 3811ME; BMS 284756; BM-284756; BMS284756; T-3811ME; T3811ME. Grades: >98%. CAS No. 223652-82-2. Molecular formula: C24H24F2N2O7S. Mole weight: 522.52. | |
| Garenoxacin Mesylate hydrate | Garenoxacin Mesylate hydrate is the Mesylate hydrate salt form of Garenoxacin. Garenoxacin, also called as BMS 284756, a new desfluoro(6)quinolone, is a topoisomerase II inhibitor with actibacterial activity to treat Gram-positive and Gram-negative bacter. Synonyms: 1-cyclopropyl-8-(difluoromethoxy)-7-[(1R)-1-methyl-2,3-dihydro-1H-isoindol-5-yl]-4-oxoquinoline-3-carboxylic acid;methanesulfonic acid;hydrate BMS 284756 BMS-284756 BMS284756 garenoxacin. CAS No. 223652-90-2. Molecular formula: C24H26F2N2O8S. Mole weight: 540.53. | |
| Garenoxacin Mesylate hydrate | Garenoxacin (BMS284756) Mesylate hydrate is an orally active quinolone antibiotic and has a broad spectrum of activity against a wide array of gram-positive and gram-negative bacteria, anaerobes, and fastidious organisms [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: BMS284756 Mesylate hydrate. CAS No. 223652-90-2. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-17460A. | |
| Garetosmab | Garetosmab (REGN 2477) is a fully human IgG4 monoclonal antibody that specifically inhibits activin A. Garetosmab can be used for fibrodysplasia ossificans progressiva (FOP) research [1]. Uses: Scientific research. Group: Inhibitory antibodies. Alternative Names: REGN 2477. CAS No. 2097125-54-5. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P99632. | |
| Garlic Extract (Ratio) | Garlic Extract (Ratio). Group: Others. Purity: 4:1~20:1. Garlic Extract (Ratio). Cat No: EXTW-024. | |
| Garlic Odorless Powder | Garlic Odorless Powder. |  CA, FL & NJ |
| Garlic oil | Garlic oil. CAS No: 8008-99-9 |  Sarchem Laboratories New Jersey NJ |
| Garlic Oil China FCC | Garlic Oil China FCC. CAS No. 8000-78-0. FEMA No. 2503. Kosher: Y. VIGON Item # 500164. Categories: Speciality Ingrdients Suppliers, Flavors, Fragrances, Perfumers. | America & Internationally |
| Garlic Oil Mexican | Garlic Oil Mexican. CAS No. 8000-78-0. FEMA No. 2503. Kosher: Y. VIGON Item # 500165. Categories: Speciality Ingrdients Suppliers, Flavors, Fragrances, Perfumers. | America & Internationally |
| Garlic P.E. 1% & 2% Allicin HPLC | Garlic P.E. 1% & 2% Allicin HPLC. | CA, FL & NJ |
| Garlic powder | Garlic powder | Sarchem Laboratories New Jersey NJ |
| Garlic Powder | Garlic powder is dehydrated and made from bulb of garlic. Garlic powder have its unique aroma, can be used as a flavor ingredients and seasoning. Besides garlic powder can stimulate the animals produce aroma formation of amino acids, increase the aroma components of meat and eggs, freshness meat and eggs. Add to feed it can improve livestock and poultry and fish and shrimp and disease-resistant ability, speed up the growth. Group: Others. Garlic Powder; Allium Sativum L. Cat No: EXTC-101. | |
| Garomefrine hydrochloride | Garomefrine hydrochloride is a Alpha 1A adrenergic receptor agonist under the development of Nippon Shinyaku. Phase II clinical trials for the treatment of Stress incontinence and Urinary incontinence was discontinued in USD in 2001. Uses: Stress incontinence; urinary incontinence. Synonyms: NS 49;ABT 232; PNO 49B;((R)-(-)-3'-(2-Amino-1-hydroxyethyl)-4'-fluoro-methanesulfonanilide hydrochloride. Grades: 98%. CAS No. 137431-04-0. Molecular formula: C9H14ClFN2O3S. Mole weight: 284.74. | |
| Gartanin | Gartanin is a natural xanthone of mangosteen, with antioxidant, anti-inflammatory, antifungal, neuroprotective and antineoplastic properties. Gartanin induces cell cycle arrest and autophagy and suppresses migration in human glioma cells. Group: Inhibitors. CAS No. 33390-42-0. Molecular formula: C23H24O6. Mole weight: 396.43. Appearance: Solid. Purity: 0.9993. Canonical SMILES: O=C1C2=C (OC3=C (O)C=CC (O)=C13)C (C/C=C (C)\C)=C (O)C (C/C=C (C)/C)=C2O. Catalog: ACM33390420. | |
| Gartanin | Gartanin. Group: Biochemicals. Alternative Names: 1,3,5,8-???-2,4-?(3-??-2-???)-9H-???-9-?. Grades: Plant Grade. CAS No. 33390-42-0. Pack Sizes: 10mg. Molecular Formula: C23H24O6, Molecular Weight: 396.432999999999. US Biological Life Sciences. | Worldwide |
| Gartisertib | Gartisertib is an orally available inhibitor of ataxia telangiectasia and Rad3 related (ATR) kinase, with potential antineoplastic activity. ATR, a serine/threonine protein kinase upregulated in a variety of cancer cell types, plays a key role in DNA repair, cell cycle progression and survival. Synonyms: ATR inhibitor 2; VX-803 (M4344); M-4344; 2-Amino-6-fluoro-N-[5-fluoro-4-(4-{[4-(3-oxetanyl)-1-piperazinyl]carbonyl}-1-piperidinyl)-3-pyridinyl]pyrazolo[1,5-a]pyrimidine-3-carboxamide. Grades: ≥95%. CAS No. 1613191-99-3. Molecular formula: C25H29F2N9O3. Mole weight: 541.55. | |
| Garvicin ML | Garvicin ML is a bacteriocin produced by Lactococcus garvieae DCC43, with a molecular mass of 6004.2 Da. Synonyms: GarML. | |
| Garvieacin Q | Garvieacin Q, a novel class II bacteriocin derived from Lactococcus garvieae BCC 43578, is particularly inhibitory against Listeria monocytogenes and other L. garvieae strains. | |
| GaS Crystal | Graphene-like Materials Series. CAS No. 12024-10-1. Purity: 0.99995. Catalog: ACM12024101. | |
| GaSe Crystal | Graphene-like Materials Series. CAS No. 12024-11-2. Purity: 0.99995. Catalog: ACM12024112. | |
| Gasketing Material | Gasketing Material. Group: Polymers. |  |
| GAS OIL (CFPP and CP) | GAS OIL (CFPP and CP). Uses: For analytical and research use. Group: Metallo-organic standards; petroleum physical test standards; petroleum reference materials. Catalog: APS008349. Format: Matrix Material. Shipping: Room Temperature. |  |
| Gassericin A | Gassericin A is a circular bacteriocin produced by lactic acid bacteria Lactobacillus gasseri. | |
| Gastric Inhibitory Peptide (human) trifluoroacetate salt | Gastric inhibitory peptide (GIP) is a biologically active 42-amino acid peptide and it acts as a GIP receptor agonist that binds to rat recombinant GIP receptors expressed in CHO-K1 cells (IC50 = 3.2 nM) and increases cAMP accumulation (EC50 = 377 pM). Synonyms: GIP (human); Glucose-dependent Insulinotropic Peptide (human). Grades: ≥95%. Molecular formula: C226H338N60O66S·xCF3COOH. Mole weight: 4983.53. | |
| Gastric Inhibitory Polypeptide (1-30) amide (porcine) | It is a fully glucose-dependent insulinotropic polypeptide (GIP) receptor agonist with high affinity equal to native GIP(1-42). It is a weak inhibitor of gastric acid secretion and a strong stimulator of insulin. The site responsible for insulinotropic activity is apparently located between residues 19 and 30 of GIP. Synonyms: Glucose-Dependent Insulinotropic Polypeptide (1-30) amide (porcine); H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2; L-tyrosyl-L-alanyl-L-alpha-glutamyl-glycyl-L-threonyl-L-phenylalanyl-L-isoleucyl-L-seryl-L-alpha-aspartyl-L-tyrosyl-L-seryl-L-isoleucyl-L-alanyl-L-methionyl-L-alpha-aspartyl-L-lysyl-L-isoleucyl-L-arginyl-L-glutaminyl-L-glutaminyl-L-alpha-aspartyl-L-phenylalanyl-L-valyl-L-asparagyl-L-tryptophyl-L-leucyl-L-leucyl-L-alanyl-L-glutaminyl-L-lysinamide; GIP (1-30) amide, porcine. Grades: ≥95%. CAS No. 134846-93-8. Molecular formula: C162H245N41O47S. Mole weight: 3551.04. | |
| Gastric Inhibitory Polypeptide (3-42) (human) | Gastric Inhibitory Polypeptide (3-42) (human), the main physiological degradation product of gastric inhibitory polypeptide (GIP), is produced by proteolytic processing of GIP by dipeptidyl peptidase IV (DPP IV). It is a glucose-dependent insulinotropic polypeptide (GIP) receptor antagonist that regulates insulin secretion and GIP metabolism in vivo. Synonyms: GIP (3-42) (human); H-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH; L-Glutamine, L-α-glutamylglycyl-L-threonyl-L-phenylalanyl-L-isoleucyl-L-seryl-L-α-aspartyl-L-tyrosyl-L-seryl-L-isoleucyl-L-alanyl-L-methionyl-L-α-aspartyl-L-lysyl-L-isoleucyl-L-histidyl-L-glutaminyl-L-glutaminyl-L-α-aspartyl-L-phenylalanyl-L-valyl-L-asparaginyl-L-tryptophyl-L-leucyl-L-leucyl-L-alanyl-L-glutaminyl-L-lysylglycyl-L-lysyl-L-lysyl-L-asparaginyl-L-α-aspartyl-L-tryptophyl-L-lysyl-L-histidyl-L-asparaginyl-L-isoleucyl-L-threonyl-. Grades: ≥95%. CAS No. 1802086-25-4. Molecular formula: C214H324N58O63S. Mole weight: 4749.35. | |
| Gastric Inhibitory Polypeptide (6-30) amide (human) | Gastric Inhibitory Polypeptide (6-30) amide (human), a porcine homolog, antagonizes the induction of cAMP production of gastric inhibitory polypeptide (human) (GIP human) in vitro. Competitive binding studies showed that it exhibited a receptor-binding affinity equivalent to the gastric inhibitory polypeptide (human) with an IC50 of 3.08±0.57 nM. Synonyms: GIP (6-30) amide (human); H-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2; L-phenylalanyl-L-isoleucyl-L-seryl-L-alpha-aspartyl-L-tyrosyl-L-seryl-L-isoleucyl-L-alanyl-L-methionyl-L-alpha-aspartyl-L-lysyl-L-isoleucyl-L-histidyl-L-glutaminyl-L-glutaminyl-L-alpha-aspartyl-L-phenylalanyl-L-valyl-L-asparagyl-L-tryptophyl-L-leucyl-L-leucyl-L-alanyl-L-glutaminyl-L-lysinamide; glucose-dependent insulinotropic polypeptide (6-30) amide (human). Grades: ≥95% by HPLC. CAS No. 1139691-72-7. Molecular formula: C139H209N35O38S. Mole weight: 3010.42. | |
| Gastric inhibitorypolypeptide(human)(9ci) | Heterocyclic Organic Compound. CAS No. 100040-31-1. Molecular formula: C226H338N60O66S. Mole weight: 4983.53. Purity: 0.96. Canonical SMILES: CCC (C)C (C (=O)NC (CC1=CNC=N1)C (=O)NC (CCC (=O)N)C (=O)NC (CCC (=O)N)C (=O)NC (CC (=O)O)C (=O)NC (CC2=CC=CC=C2)C (=O)NC (C (C)C)C (=O)NC (CC (=O)N)C (=O)NC (CC3=CNC4=CC=CC=C43)C (=O)NC (CC (C)C)C (=O)NC (CC (C)C)C (=O)NC (C)C (=O)NC (CCC (=O)N)C (=O)NC (CCCCN)C (=O)NCC (=O)NC (CCCCN)C (=O)NC (CCCCN)C (=O)NC (CC (=O)N)C (=O)NC (CC (=O)O)C (=O)NC (CC5=CNC6=CC=CC=C65)C (=O)NC (CCCCN)C (=O)NC (CC7=CNC=N7)C (=O)NC (CC (=O)N)C (=O)NC (C (C)CC)C (=O)NC (C (C)O)C (=O)NC (CCC (=O)N)C (=O)O)NC (=O)C (CCCCN)NC (=O)C (CC (=O)O)NC (=O)C (CCSC)NC (=O)C (C)NC (=O)C (C (C)CC)NC (=O)C (CO)NC (=O)C (CC8=CC=C (C=C8)O)NC (=O)C (CC (=O)O)NC (=O)C (CO)NC (=O)C (C (C)CC)NC (=O)C (CC9=CC=CC=C9)NC (=O)C (C (C)O)NC (=O)CNC (=O)C (CCC (=O)O)NC (=O)C (C)NC (=O)C (CC1=CC=C (C=C1)O)N. Catalog: ACM100040311. | |
| Gastric inhibitory polypeptide(porcine) | Heterocyclic Organic Compound. Alternative Names: YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDW KHNITQ; H-TYR-ALA-GLU-Gly -THR-PHE-ILE-SER-ASP-TYR-SER-ILE-ALA-MET-ASP-ly S-ILE-ARG-GLN-GLN-ASP-PHE-VAL-ASN-TRP-LEU-LEU-ALA-GLN-ly S-Gly -ly S-ly S-SER-ASP-TRP-ly S-HIS-ASN-ILE-THR-GLN-OH; GAStri C INHIBITORY PEPTIDE, PORCINE;GA. CAS No. 11063-17-5. Molecular formula: C225H342N60O66S. Mole weight: 4975.55. Catalog: ACM11063175. | |
| Gastric Inhibitory Polypeptide (porcine) | Synonyms: L-Tyrosyl-L-alanyl-L-α-glutamylglycyl-L-threonyl-L-phenylalanyl-L-isoleucyl-L-seryl-L-α-aspartyl-L-tyrosyl-L-seryl-L-isoleucyl-L-alanyl-L-methionyl-L-α-aspartyl-L-lysyl-L-isoleucyl-L-arginyl-L-glutaminyl-L-glutaminyl-L-α-aspartyl-L-phenylalanyl-L-valyl-L-asparaginyl-L-tryptophyl-L-leucyl-L-leucyl-L-alanyl-L-glutaminyl-L-lysylglycyl-L-lysyl-L-lysyl-L-seryl-L-α-aspartyl-L-tryptophyl-L-lysyl-L-histidyl-L-asparaginyl-L-isoleucyl-L-threonyl-L-glutamine; Gastric inhibitory polypeptide (pig major); Gastric inhibitory polypeptide (swine major); Gastric inhibitory polypeptide (pig); Pig gastric inhibitory polypeptide; Porcine gastric inhibitory peptide; Porcine gastric inhibitory polypeptide; H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH. CAS No. 11063-17-5. Molecular formula: C225H342N60O66S. Mole weight: 4975.55. | |
| Gastric Juice, Artificial, Laboratory Grade, 500 mL | Keep refrigerated; Shelf life is 3 months from date received. Storage Code: Green; general chemical storage. Reactivity: 0. Grades: chem-grade laboratory. Product ID: 864603. -- SOLD FOR EDUCATIONAL USE ONLY -- |  |
| Gastric mucin | Gastric mucin is a large glycoprotein that is thought to play an important role in protecting the gastrointestinal tract from acids, proteases, pathogenic microorganisms and mechanical damage. Synonyms: Gastron; Mucin type I; ucin type II; ucin type III; ucin type I-S; Gastric Mucin porcine. Grades: ≥97%. CAS No. 84082-64-4. | |
| Gastric mucin | Gastric mucin is a large glycoprotein which is thought to play a major role in the protection of the gastrointestinal tract from acid, proteases, pathogenic microorganisms, and mechanical trauma. Uses: Scientific research. Group: Biochemical assay reagents. CAS No. 84082-64-4. Pack Sizes: 500 mg; 10 g. Product ID: HY-B2196. | |
| Gastric Mucin powder | Gastric Mucin powder. | CA, FL & NJ |
| gastricsin | Formed from progastricsin, apparently in the gastric juice of most vertebrates. In addition to the fundus, progastricsin is also secreted in antrum and proximal duodenum. Seminal plasma contains a zymogen that is immunologically identical with progastricsin. In peptidase family A1 (pepsin A family). Group: Enzymes. Synonyms: pepsin C; pig parapepsin II; parapepsin II. Enzyme Commission Number: EC 3.4.23.3. CAS No. 9012-71-9. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4267; gastricsin; EC 3.4.23.3; 9012-71-9; pepsin C; pig parapepsin II; parapepsin II. Cat No: EXWM-4267. | |
| Gastrin/CCK antagonist 1 | An antagonist of gastrin/CCK. Synonyms: Urea, N-[1-cyclohexyl-2,3,4,5-tetrahydro-2,4-dioxo-5-[2-oxo-2-(1-pyrrolidinyl)ethyl]-1H-1,5-benzodiazepin-3-yl]-N'-(4-fluorophenyl)-. CAS No. 162271-52-5. Molecular formula: C28H32FN5O4. Mole weight: 521.58. | |
| Gastrin i(1-14)(human) | Heterocyclic Organic Compound. Alternative Names: GASTRIN I HUMAN FRAGMENT 1-14;GASTRIN I (1-14) (HUMAN);PGLU-GLY-PRO-TRP-LEU-GLU-GLU-GLU-GLU-GLU-ALA-TYR-GLY-TRP;PYR-GLY-PRO-TRP-LEU-GLU-GLU-GLU-GLU-GLU-ALA-TYR-GLY-TRP-OH;PYR-GLY-PRO-TRP-LEU-GLU-GLU-GLU-GLU-GLU-ALA-TYR-GLY-TRP;gastrin I fragment human 1-. CAS No. 100940-57-6. Molecular formula: C79H100N16O27. Mole weight: 1705.73. Purity: 0.96. Catalog: ACM100940576. | |
| Gastrin I (1-14), human | Gastrin I (1-14), human is the 1-14 fragment of human Gastrin I peptide. Gastrin I is an endogenous gastrointestinal peptide hormone. Synonyms: H-Pyr-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-OH; L-pyroglutamyl-glycyl-L-prolyl-L-tryptophyl-L-leucyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alanyl-L-tyrosyl-glycyl-L-tryptophan; gastrin I fragment human 1-14; 18-31-Gastrin I (swine), 18-(5-oxo-L-proline)-22-L-leucine-. Grades: 95%. CAS No. 100940-57-6. Molecular formula: C79H100N16O27. Mole weight: 1705.73. | |
| Gastrin I (human) | Gastrin I (human). Group: Biochemicals. Grades: Purified. CAS No. 10047-33-3. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| Gastrin I (human) | Gastrin I (human) is an endogenous peptide produced by stomach and it acts as a selective CCK2 receptor agonist. Gastrin I stimulates gastric acid secretion in vivo, and increases levels of cytosolic calcium in isolated rabbit stomach parietal cells (EC50 = 11 nM). Synonyms: Gastrin-17; Little gastrin I; Gastrin I human. Grades: 95%. CAS No. 10047-33-3. Molecular formula: C97H124N20O31S. Mole weight: 2098.2. | |
| Gastrin I, human | Gastrin I, human is the endogenous peptide produced in the stomach, and increases gastric acid secretion via cholecystokinin 2 (CCK2) receptor. Uses: Scientific research. Group: Peptides. CAS No. 10047-33-3. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P1097. | |
| Gastrin I Human | Heterocyclic Organic Compound. Alternative Names: pyroGlu-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH2; EINECS 233-157-0. CAS No. 10047-33-3. Molecular formula: C97H124N20O31S. Mole weight: 2098.2. Appearance: COA. Purity: 0.98. IUPACName: 10047-33-3. Catalog: ACM10047333. | |
Our database is helping our users find suppliers everyday.
