A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| mPEG-AA | According to public information, mPEG-AA (mPEG-CM) is one of the excipients of Pfizer's and Moderna's COVID-19 vaccine. Product ID: PE-0343. Category: Excipients. Product Keywords: Pharmaceutical Excipients; Excipients; mPEG-AA; PE-0343. Sample Provided: Yes. Standard: In-house standard. Grade: Pharmaceutical grade. |  |
| mPEG-alginate | mPEG-alginate,methoxypolyethylene glycol-alginate is an AB block copolymer,Chitosan is a Natural polysaccharide can be used for drug delivery systems. Synonyms: methoxy polyethylene glycol-alginate. Product ID: MSMN-054. Category: Raw Materials. | |
| mPEG-Amine, MW 350-40k | The amino terminus of mPEG-Amine is more reactive than the hydroxyl group for the acylating agent, and it is easy to carry out the reductive amination reaction. The reactivity of the amino group can be linked to other molecules by generating stable chemical bonds such as an amide bond, a urethane bond, a urea bond and a secondary amine bond. They can be used to prepare ligands with biologically active compounds, carriers for peptide synthesis, preparation of polymer grafts and PEG coatings, and preparation of PEG glycoprotein ligands. Alternative Names: mPEG-Amine. Molecular formula: C25H53NO12. Mole weight: Customizable. |  |
| mPEG-Ammonium Phosphonate | Augment your research on Biodegradable Polymers with the reliable mPEG-Ammonium Phosphonate from CD Bioparticles Drug Delivery. Group: Monofunctional linear pegs. |  |
| mPEG-b-PLA (2k-5k) | mPEG-b-PLA is a biodegradable diblock copolymer. Synonyms: Methoxy poly(ethylene glycol)-b-poly(D,L-lactide). Product ID: MSMN-087. Category: Raw Materials. | |
| mPEG-b-PLA (2k-5k) | mPEG-b-PLA is a biodegradable diblock copolymer. Uses: Msmn-087. Synonyms: Methoxy poly(ethylene glycol)-b-poly(D,L-lactide). Grades: Raw Materials. | |
| mPEG-b-PLGA (PEG Mn 2,000, PLGA Mn 10,000) | mPEG-b-PLGA (PEG Mn 2,000, PLGA Mn 10,000). Synonyms: Poly(ethylene glycol) methyl ether-block-poly(lactide-co-glycolide). Product ID: MSMN-039. Category: Raw Materials. | |
| mPEG-b-PLGA (PEG Mn 2,000, PLGA Mn 11,500) | Amphiphilic block copolymers (AmBC) are made up of two chemically different homopolymer blocks. One of the block is hydrophilic and the other one is hydrophobic. These macromolecules have the properties to self-assemble when dissolved in an aqueous media. PEG-PLGA is one the most commonly used biodegradable amphiphilic block copolymers for drug delivery applications. PEG is the hydrophilic part and PLGA is the hydrophobic part. Synonyms: Poly(ethylene glycol) methyl ether-block-poly(lactide-co-glycolide). Product ID: MSMN-036. Category: Raw Materials. | |
| mPEG-b-PLGA (PEG Mn 2,000, PLGA Mn 3,000) | mPEG-b-PLGA (PEG Mn 2,000, PLGA Mn 3,000). Synonyms: Poly(ethylene glycol) methyl ether-block-poly(lactide-co-glycolide). Product ID: MSMN-040. Category: Raw Materials. | |
| mPEG-b-PLGA (PEG Mn 2,000; PLGA Mn 4,500) | Amphiphilic block copolymers (AmBC) are made up of two chemically different homopolymer blocks. One of the block is hydrophilic and the other one is hydrophobic. These macromolecules have the properties to self-assemble when dissolved in an aqueous media. PEG-PLGA is one the most commonly used biodegradable amphiphilic block copolymers for drug delivery applications. PEG is the hydrophilic part and PLGA is the hydrophobic part. Synonyms: Poly(ethylene glycol) methyl ether-block-poly(lactide-co-glycolide). Product ID: MSMN-034. Category: Raw Materials. | |
| mPEG-b-PLGA (PEG Mn 5,000, PLGA Mn 10,000) | Contains ≤500 ppm impurities by GC, including trace monomer and residual organics. Synonyms: Poly(ethylene glycol) methyl ether-block-poly(lactide-co-glycolide). Product ID: MSMN-042. Category: Raw Materials. | |
| mPEG-b-PLGA (PEG Mn 5,000, PLGA Mn 15,000) | Contains ≤500 ppm impurities by GC, including trace monomer and residual organics. Synonyms: Poly(ethylene glycol) methyl ether-block-poly(lactide-co-glycolide). Product ID: MSMN-041. Category: Raw Materials. | |
| mPEG-b-PLGA (PEG Mn 5,000, PLGA Mn 20,000) | Contains ≤500 ppm impurities by GC, including trace monomer and residual organics. Synonyms: Poly(ethylene glycol) methyl ether-block-poly(lactide-co-glycolide). Product ID: MSMN-035. Category: Raw Materials. | |
| mPEG-b-PLGA (PEG Mn 5,000, PLGA Mn 5,000) | Contains ≤500 ppm impurities by GC, including trace monomer and residual organics. Synonyms: Poly(ethylene glycol) methyl ether-block-poly(lactide-co-glycolide). Product ID: MSMN-038. Category: Raw Materials. | |
| mPEG-b-PLGA (PEG Mn 5,000, PLGA Mn 7,000) | Amphiphilic block copolymers (AmBC) are made up of two chemically different homopolymer blocks. One of the block is hydrophilic and the other one is hydrophobic. These macromolecules have the properties to self-assemble when dissolved in an aqueous media. PEG-PLGA is one the most commonly used biodegradable amphiphilic block copolymers for drug delivery applications. PEG is the hydrophilic part and PLGA is the hydrophobic part. Synonyms: Poly(ethylene glycol) methyl ether-block-poly(lactide-co-glycolide). Product ID: MSMN-037. Category: Raw Materials. | |
| Mpeg bromoisobutyrate | Mpeg bromoisobutyrate. Alternative Names: ATRP initiator;mPEG bromoisobutyrate;PEG methyl ether bromoisobutyrate;Poly(ethylene glycol) methyl ether 2-bromoisobutyrate;mPEG bromoisobutyrate 1000;PEG methyl ether bromoisobutyrate 1000;methoxyPolyethylene glycol bromoisobutyryl;mPEG ATRP. CAS No. 245070-97-7. |  |
| mPEG-Chitosan | mPEG-Chitosan,methoxypolyethylene glycol-Chitosan is an AB block copolymer,Chitosan is a Medicinal polysaccharide polymer can be used for drug delivery systems. Synonyms: methoxy polyethylene glycol-Chitosan. Product ID: MSMN-053. Category: Raw Materials. | |
| mPEG-DMG | mPEG-DMG. Product ID: PE-0344. Category: Excipients. Product Keywords: Pharmaceutical Excipients; Excipients; mPEG-DMG; PE-0344. Sample Provided: Yes. Standard: In-house standard. Grade: Pharmaceutical grade. | |
| m-PEG-DMG (MW 2000) | m-PEG-DMG (MW 2000) is a PEG lipid for the preparation of liposomes and can be used in drug delivery studies[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1019000-64-6. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-W440821. |  |
| mPEG-Epoxide | mPEG-Epoxide. CAS No. 40349-67-5. | |
| MPEG-maleimide | MPEG-maleimide. CAS No. 99126-64-4. Molecular formula: CH3O(C2H4O)n+1-CH2CH2 -C4H2NO2. Mole weight: ~5000. | |
| mPEG-PCL-PPEEA | PCL has good compatibility and good solvent solubility,especially in aromatic compounds,ketones and polar solvents.It is widely used in controlled release drug carrier,cell and tissue culture medium. Synonyms: methoxy polyethylene glycol-Poly(ε-caprolactone)-PPEEA. Product ID: MSMN-063. Category: Raw Materials. | |
| mPEG-PLA-PPEEA | Polylactic acid (PLA) is a kind of non-toxic,non irritating synthetic polymer material with excellent biodegradability,compatibility and absorbability.It can be used as drug transport material and tissue engineering scaffold material. Synonyms: methoxy polyethylene glycol-Poly(D,L-lactide)-PPEEA. Product ID: MSMN-064. Category: Raw Materials. | |
| mPEG-RhB | Revolutionize your Fluorescent Monofunctional Linear PEGs research with Methoxy PEG-Rhodamine B, a high-quality Fluorescent Polymers obtainable from CD Bioparticles Drug Delivery. Group: Fluorescent monofunctional linear pegs. | |
| MPEP | MPEP is a potent, selective, noncompetitive, orally active and systemically active mGlu5 receptor antagonist, with an IC50 of 36 nM for completely inhibiting quisqualate-stimulated phosphoinositide (PI) hydrolysis. MPEP has anxiolytic-or antidepressant-like effects[1][2]. MPEP is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Category: Signaling pathways. CAS No. 96206-92-7. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-14609A. | |
| MPEP hydrochloride | MPEP hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 219911-35-0. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. |  Worldwide |
| MPEP Hydrochloride | MPEP Hydrochloride is a potent, selective, noncompetitive, orally active and systemically active mGlu5 receptor antagonist, with an IC50 of 36 nM for completely inhibiting quisqualate-stimulated phosphoinositide (PI) hydrolysis. MPEP Hydrochloride has anxiolytic-or antidepressant-like effects[1][2]. MPEP (Hydrochloride) is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Category: Signaling pathways. CAS No. 219911-35-0. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-14609. | |
| MPEP Hydrochloride (6-Methyl-2- (phenylethynyl) pyridine Hydrochloride) | A non-competitive, highly potent antagonist selective for mGlu5 receptors (IC50 = 36nM). Also a positive allosteric modulator of mGlu4 and weak anatagonist of nMDA receptors. Biologically active admitted systematically. Widely used in assessing the functional roles of mGlu5 receptors in a variety of research areas, such as learning and memory, sleep, neuroprotection, depression, addiction, anxiety and stress related disorders, analgesia, locomotion, neural plasticity, and Parkinson's disease. Group: Biochemicals. Grades: Highly Purified. CAS No. 96206-92-7. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| MPGΔNLS, HIV related | It is a 27-residue peptide derived from the hydrophobic fusion peptide of HIV-1 gp41 (for efficient crossing of the cell membrane) and the hydrophilic nuclear localization sequence of SV40 large T antigen (for the nuclear addressing of the peptide). It contains a single mutation in which the second lysine in NLS has mutated to serine. Alternative Names: H-Gly-Ala-Leu-Phe-Leu-Gly-Phe-Leu-Gly-Ala-Ala-Gly-Ser-Thr-Met-Gly-Ala-Trp-Ser-Gln-Pro-Lys-Ser-Lys-Arg-Lys-Val-OH. Grades: 97%. Molecular formula: C126H201N35O33S. Mole weight: 2766.27. | |
| MPG, HIV related | MPG, a 27-AA peptide derived from the nucleotide localization sequence of SV40 large T antigen and the fusion peptide domain of HIV-1 gp41, is an effective nucleic acid and oligonucleotide carrier for wide delivery into cultured cells. Alternative Names: Gly-Ala-Leu-Phe-Leu-Gly-Phe-Leu-Gly-Ala-Ala-Gly-Ser-Thr-Met-Gly-Ala-Trp-Ser-Gln-Pro-Lys-Ser-Lys-Arg-Lys-Val; L-Valine, glycyl-L-alanyl-L-leucyl-L-phenylalanyl-L-leucylglycyl-L-phenylalanyl-L-leucylglycyl-L-alanyl-L-alanylglycyl-L-seryl-L-threonyl-L-methionylglycyl-L-alanyl-L-tryptophyl-L-seryl-L-glutaminyl-L-prolyl-L-lysyl-L-seryl-L-lysyl-L-arginyl-L-lysyl-. Grades: ≥95%. CAS No. 395069-92-8. Molecular formula: C126H201N35O33S. Mole weight: 2766.22. | |
| MPH | MPH. Pack Sizes: Milligram Quantities: 50 mg. Order Number: CL230. |  www.prochemonline.com |
| MPH-220 | MPH-220 is a selective and orally active inhibitor of skeletal muscle myosin-2. MPH-220 enables muscle relaxation. MPH-220 is anti-spastic agent that can be used in the research of spasticity and muscle stiffness[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2649776-79-2. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-148516. | |
| m-Phenoxyanisole | m-Phenoxyanisole. CAS No. 1655-68-1. Molecular formula: C13H12O2. Mole weight: 200.233. | |
| m-Phenylenediamine | 1,3-phenylenediamine appears as colorless or white colored needles that turn red or purple in air. Melting point 64-66 C. Density 1.14 g / cm³. Flash point 280 F. May irritate skin and eyes. Toxic by skin absorption, inhalation or ingestion. Used in aramid fiber manufacture, as a polymer additive, dye manufacturing, as a laboratory reagent, and in photography.;DryPowder; OtherSolid; PelletsLargeCrystals, Liquid;WHITE CRYSTALS. TURNS RED ON EXPOSURE TO AIR.;Colorless or white colored needles that turn red or purple in air. Molecular formula: C6H8N2;C6H4(NH2)2;C6H8N2. Mole weight: 108.14g/mol. IUPAC Name: benzene-1,3-diamine. SMILES: C1=CC(=CC(=C1)N)N. InChI: InChI=1S/C6H8N2/c7-5-2-1-3-6(8)4-5/h1-4H,7-8H2. | |
| m-Phenylenediamine | 1,3-phenylenediamine appears as colorless or white colored needles that turn red or purple in air. Melting point 64-66 C. Density 1.14 g / cm³. Flash point 280 F. May irritate skin and eyes. Toxic by skin absorption, inhalation or ingestion. Used in aramid fiber manufacture, as a polymer additive, dye manufacturing, as a laboratory reagent, and in photography.;DryPowder; OtherSolid; PelletsLargeCrystals, Liquid;WHITE CRYSTALS. TURNS RED ON EXPOSURE TO AIR.;Colorless or white colored needles that turn red or purple in air. CAS No. 108-45-2. Molecular formula: C6H8N2;C6H4(NH2)2;C6H8N2. Mole weight: 108.14g/mol. IUPAC Name: benzene-1,3-diamine. SMILES: C1=CC(=CC(=C1)N)N. InChI: InChI=1S/C6H8N2/c7-5-2-1-3-6(8)4-5/h1-4H,7-8H2. | |
| m-Phenylenediamine | m-Phenylenediamine. Group: Biochemicals. Alternative Names: 1,3-Diaminobenzene. Grades: Highly Purified. CAS No. 108-45-2. Pack Sizes: 5kg. US Biological Life Sciences. | Worldwide |
| m-Phenylenediamine | 1kg Pack Size. Group: Amines, Building Blocks, Organics. Formula: C6H8N2. CAS No. 108-45-2. Prepack ID 13219509-1kg. Molecular Weight 108.14. See USA prepack pricing. |  |
| m-Phenylenediamine 99+.9% | m-Phenylenediamine 99+.9%. Group: Biochemicals. Grades: Reagent Grade. CAS No. 108-45-2. Pack Sizes: 25Kg, 100Kg. US Biological Life Sciences. | Worldwide |
| M-Phisyl-chloride | M-Phisyl-chloride. Alternative Names: 2-Methoxy-5-(N-phthalimidinyl)benzenesulfonylchloride. CAS No. 126565-42-2. Purity: 97%+. Product ID: ACM126565422-2. Molecular formula: C15H12ClNO4S. Mole weight: 337.78. IUPAC Name: 2-methoxy-5-(3-oxo-1H-isoindol-2-yl)benzenesulfonylchloride. Alfa Chemistry - ISO 9001:32057 Certified. |  |
| MPI-0479605 | MPI-0479605 is a potent and selective ATP-competitive inhibitor of Mps1, with an IC50 of 1.8 nM. Uses: Scientific research. Category: Signaling pathways. CAS No. 1246529-32-7. Pack Sizes: 10 mM * 1 mL in DMSO; 2 mg; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-12660. | |
| Mp_mastoparan MP | Mp_mastoparan MP was found in Venom, wasps, Mischocyttarusphthisicus. Mp_mastoparan MP has antimicrobial activity. | |
| MPO-IN-28 | MPO-IN-28 is a myeloperoxidase (MPO) inhibitor with IC50 of 44 nM. Alternative Names: GNF-Pf-3346; 1-(7-methoxy-4-methylquinazolin-2-yl)guanidine; (7-methoxy-4-methyl-quinazolin-2-yl)-guanidine. CAS No. 37836-90-1. Molecular formula: C11H13N5O. Mole weight: 231.25. | |
| MPP+-d3iodide | MPP+-d3 (iodide) is deuterium labeled MPP+ (iodide). MPP+ iodide, a toxic metabolite of the neurotoxin MPTP, causes symptom of Parkinson's disease in animal models by selectively destroying dopaminergic neurons in substantia nigra. MPP+ iodide is taken up by the dopamine transporter into dopaminergic neurons where it exerts its neurotoxic action on mitochondria by affecting complex I of the respiratory chain. MPP+ iodide is also a high affinity substrate for the serotonin transporter (SERT)[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 207556-07-8. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-W008719S. | |
| MPP dihydrochloride | MPP dihydrochloride is a selective, high affinity silent antagonist at ERα receptors, with > 200-fold selectivity for ERα over Erβ (Ki= 2.7 and 1800 nM at ERα and ERβ receptors respectively). It cannot block EE2 induced luciferase activity with any isoform of zebrafish estrogen receptor. Alternative Names: 1,3-Bis(4-hydroxyphenyl)-4-methyl-5-[4-(2-piperidinylethoxy)phenol]-1H-pyrazole dihydrochloride. Grades: ≥98% by HPLC. CAS No. 911295-24-4. Molecular formula: C29H31N3O3.2HCl. Mole weight: 542.5. | |
| MPP dihydrochloride | MPP dihydrochloride is a potent and selective ER (estrogen receptor) modulator. MPP dihydrochloride induces significant apoptosis in the endometrial cancer and oLE cell lines. MPP dihydrochloride reverses the positive effects of beta-estradiol. MPP dihydrochloride has mixed agonist/antagonist action on murine uterine ERalpha in vivo[1][2][3]. Uses: Scientific research. Category: Signaling pathways. CAS No. 911295-24-4. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-103454. | |
| MPPG | MPPG. Group: Biochemicals. Grades: Purified. CAS No. 169209-65-8. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| MPP hydrochloride | MPP hydrochloride is a potent and selective ER (estrogen receptor) modulator. MPP hydrochloride induces significant apoptosis in the endometrial cancer and oLE cell lines. MPP hydrochloride reverses the the positive effects of beta-estradiol. MPP hydrochloride has mixed agonist/antagonist action on murine uterine ERalpha in vivo[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2863676-89-3. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-103454B. | |
| MPP+ iodide | MPP+ iodide, a toxic metabolite of the neurotoxin MPTP, causes symptom of Parkinson's disease in animal models by selectively destroying dopaminergic neurons in substantia nigra. MPP+ iodide is taken up by the dopamine transporter into dopaminergic neurons where it exerts its neurotoxic action on mitochondria by affecting complex I of the respiratory chain. MPP+ iodide is also a high affinity substrate for the serotonin transporter (SERT)[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 36913-39-0. Pack Sizes: 10 mM * 1 mL in DMSO; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-W008719. | |
| MPP+ iodide | MPP+ iodide is the metabolite of a neurotoxin MPTP, which causes permanent symptoms of Parkinson's disease by killing certain neurons in the substantia nigra of the brain. Alternative Names: N-Methyl-4-Phenylpyridinium Iodide. CAS No. 36913-39-0. Molecular formula: C12H12IN. Mole weight: 297.13. | |
| Mpr-JR11 | Mpr-JR11. Alternative Names: Mpr-Cpa-(D-Cys)-[Aph(Hor)]-[D-Aph(Cbm)]-Lys-Thr-Cys-(D-Tyr)-NH2 [Disulfide bond Cys2/Cys7]; Mpr-Cpa-D-Cys-Aph(Hor)-D-Aph(Cbm)-Lys-Thr-Cys-D-Tyr-NH2 [Disulfide bond Cys2/Cys7]. Mole weight: 1391.96. | |
| MPS | MPS. CAS No. 55750-62-4. Pack Sizes: Milligram Quantities: 100 mg. Order Number: CL228. | www.prochemonline.com |
| Mps1-IN-1 | Mps1-IN-1 is a potent, selective and ATP-competitive Mps1 kinase inhibitor, with an IC50 and a Kd of 367 nM and 27 nM[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1125593-20-5. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-13298. | |
| Mps1-IN-1 dihydrochloride | Mps1-IN-1 dihydrochloride. Group: Biochemicals. Grades: Purified. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| Mps1-IN-3 | Mps1-IN-3 is a potent and selective MPS1 kinase inhibitor, with an IC50 of 50 nM. Uses: Scientific research. Category: Signaling pathways. CAS No. 1609584-72-6. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-12401. | |
| MPS-Gαi3 | It is a cell penetrating peptide. Alternative Names: H-Ala-Ala-Val-Ala-Leu-Leu-Pro-Ala-Val-Leu-Leu-Ala-Leu-Leu-Ala-Lys-Asn-Asn-Leu-Lys-Glu-Cys-Gly-Leu-Tyr-OH. Grades: >95%. Molecular formula: C120H205N29O31S. Mole weight: 2582.19. | |
| MPT0G211 | MPT0G211 is a potent, orally active and selective HDAC6 inhibitor (IC50=0.291 nM). MPT0G211 displays >1000-fold selective for HDAC6 over other HDAC isoforms. MPT0G211 can penetrate the blood-brain barrier. MPT0G211 ameliorates tau phosphorylation and cognitive deficits in an Alzheimers disease model. MPT0G211 has anti-metastatic and neuroprotective effects. Anticancer activities[1][2][3]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2151853-97-1. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-123976. | |
| MPTP | MPTP (1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine) is a brain penetrant dopamine neurotoxin. MPTP can be used to induce Parkinsons Disease model. MPTP, a precusor of MPP+, induces apoptosis[1][2][3]. Uses: Scientific research. Category: Signaling pathways. CAS No. 28289-54-5. Pack Sizes: 10 mM * 1 mL in DMSO; 50 mg; 100 mg; 250 mg; 500 mg; 1 g. Product ID: HY-W114750. | |
| MPTP hydrochloride | MPTP hydrochloride is a brain penetrant dopaminergic neurotoxin. MPTP hydrochloride can be used to induce Parkinsons Disease model. MPTP hydrochloride, a precusor of MPP+, induces apoptosis[1][2][3]. MPTP hydrochloride has been verified by MCE with professional biological experiments. Uses: Scientific research. Category: Induced disease models products. CAS No. 23007-85-4. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 200 mg; 500 mg; 1 g. Product ID: HY-15608. | |
| MPTP hydrochloride | MPTP hydrochloride Inhibitor. Uses: Scientific use. Product Category: T4081. CAS No. 23007-85-4. |  |
| MPTP Hydrochloride | MPTP hydrochloride is a dopaminergic neurotoxin and cause selective destruction of dopaminergic neurons in animal models of parkinsonism. MPTP hydrochloride induces apoptosis.MPTP hydrochloride can be used to induce animal models of Parkinsons disease. Group: Inhibitors. CAS No. 23007-85-4. Pack Sizes: 20mg. Product ID: S4732. Formula: C12H15N·HCl. Smiles: CN1CCC(=CC1)C2=CC=CC=C2.Cl. Storage Conditions: 2 years -80 in solvent. |  United States; Europe |
| MPTP Hydrochloride (Dopaminergic Neurotoxin, MPTP) | A neurotoxin that is a precusor of MPP+ which is toxic to dopaminergic neurons and causes Parkinsonism. Widely used in research to induce Parkinson's disease models in primates. Group: Biochemicals. Grades: Highly Purified. CAS No. 23007-85-4. Pack Sizes: 10mg. Molecular Formula: C??H??N·HCl. US Biological Life Sciences. | Worldwide |
| mPTP-IN-1 | mPTP-IN-1 (Compound 14e) is a mitochondrial permeability transition pore (mPTP) inhibitor. mPTP-IN-1 blocks calcium-induced mPTP opening by targeting the C subunit of ATP synthase. mPTP-IN-1 can be used to study myocardial ischemia/reperfusion injury (IRI)[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 554414-59-4. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-172959. | |
| MP-VB1 | MP-VB1 showed strong antimicrobial activities against bacteria and fungi and induced mast cell degranulation, but displayed almost no hemolytic activity towards human blood red cells. | |
| MPX-007 | MPX-007 is a GluN2A antagonist (IC50: 27 nM). MPX-007 is a tools to probe GluN2A physiology, and to study neuropsychiatric and developmental disorders[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1688685-29-1. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg. Product ID: HY-116483. | |
| MQAE | MQAE is a chloride ion (Cl-) fluorescent probe that can be used to measure chloride concentrations. The fluorescence intensity of MQAE decreases proportionally as Cl- ions increase. MQAE has high cell permeability and is suitable for fluorescence detection such as confocal microscopy and flow cytometry (Ex/Em=350/460 nm)[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 162558-52-3. Pack Sizes: 50 mg; 100 mg; 200 mg; 500 mg. Product ID: HY-D0090. | |
| MQRGNFRNQRKIVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQAN | It is an HIV retrovirus NC peptide with superior cell membrane penetration activity. Alternative Names: HIV-NC peptide SEQ ID NO: 12. | |
| m-Quaterphenyl | White powder. Synonym: 3,3'-Diphenylbiphenyl. CAS No. 1166-18-3. Pack Sizes: Typically in stock: 0.1g, 1g. Mole weight: 306.41. MP/BP: M.P. 82.5-84. Order No: FR-2035. |  Frinton Laboratories |
| MR10 | MR10. | |
| Mr 16728 hydrochloride | Mr 16728 hydrochloride. Alternative Names: MR 16728 HYDROCHLORIDE;N-[3-(1-HEXAHYDROAZAPINYL)PROPYL]-ALPHA-CYCLOHEXYL-BENZENEACETAMIDE HYDROCHLORIDE;MR16728HCl;N-[3-(1-Hexahydroazapinyl)propyl]-a-cyclohexyl-benzeneacetamidehydrochloride;MR 16728. CAS No. 147614-21-9. Purity: 96%. Product ID: ACM147614219. Molecular formula: C23H36N2O.HCl. Mole weight: 393.01. IUPAC Name: N-[3-(azepan-1-yl)propyl]-2-cyclohexyl-2-phenylacetamide. Alfa Chemistry - ISO 9001:32057 Certified. | |
| MR 16728 hydrochloride | MR 16728 hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 207403-36-9. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
Our database is helping our users find suppliers everyday.
