American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
MQRGNFRNQRKIVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQAN It is an HIV retrovirus NC peptide with superior cell membrane penetration activity. Synonyms: HIV-NC peptide SEQ ID NO: 12. BOC Sciences 11
m-Quaterphenyl White powder. Synonym: 3,3'-Diphenylbiphenyl. CAS No. 1166-18-3. Pack Sizes: Typically in stock: 0.1g, 1g. Mole weight: 306.41. MP/BP: M.P. 82.5-84. Order No: FR-2035. Frinton Laboratories Inc
Frinton Laboratories
MR10 MR10. BOC Sciences 11
Mr 121 Mr 121. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 1-(3-carboxypropyl)-11-ethyl-1,2,3,4,8,9,10,11-octahydro-. Product Category: Heterocyclic Organic Compound. CAS No. 185308-24-1. Molecular formula: C24H28N3O3. Mole weight: 406.5. Purity: 0.96. IUPACName: MR 121 Cation. Canonical SMILES: CCN1CCCC2=CC3=C(C=C21)OC4=CC5=[N+](CCCC5=CC4=N3)CCCC(=O)O. Product ID: ACM185308241. Alfa Chemistry — ISO 9001:2015 Certified. Categories: MR-12. Alfa Chemistry. 5
MR 16728 hydrochloride MR 16728 hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 207403-36-9. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
MR304A MR304A is extracted from Trichoderma harzianum. It can inhibit the formation of melanin by Mushroom tyrosinase, Streptomyces bikiniensis and B16 melanoma cells, with IC50 (μg/L) of 7.5, 2.5 and 1.0, respectively. Synonyms: MR-304A; MR 304A. Molecular formula: C8H11NO4. Mole weight: 185.18. BOC Sciences 12
MR-387-A MR-387-A is an AP-N inhibitor produced by the strain of Streptomyces neyagawaensis SL-387. It is used to inhibit AP-N activity in cells derived from porcine kidney microsomes, human fibrosarcoma HT-1080 and human myeloid leukemia K562. Molecular formula: C25H36N4O7. Mole weight: 504.57. BOC Sciences 12
MR-387-B MR-387-B is an AP-N inhibitor produced by the strain of Streptomyces neyagawaensis SL-387. It is used to inhibit AP-N activity in cells derived from porcine kidney microsomes, human fibrosarcoma HT-1080 and human myeloid leukemia K562. Molecular formula: C25H36N4O6. Mole weight: 488.58. BOC Sciences 12
MR-566A It is produced by the strain of Trichoderma harzianus KCTC 0114BP. MR-566A inhibited mushroom enzyminase and melanin biosynthesis in B16 melanoma cells with IC50 (μmol/L) of 1.72 and 0.1, respectively. Synonyms: SCHEMBL20203773. Molecular formula: C8H10ClNO3. Mole weight: 203.62. BOC Sciences 12
MR-566B It is produced by the strain of Trichoderma harzianus KCTC 0114BP. MR-566B inhibited mushroom enzyminase and melanin biosynthesis in B16 melanoma cells with IC50 (μmol/L) of 47 and 2.2, respectively. Synonyms: SCHEMBL20203767. Molecular formula: C8H11NO4. Mole weight: 185.18. BOC Sciences 12
Mram 8 Mram 8 is isolated from Viola philippica which is a plant from the Violaceae family. BOC Sciences 11
MRCK? (1-473), active, GST tagged human recombinant, expressed in baculovirus infected Sf9 cells, ?70% (SDS-PAGE), buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
MRE 3008F20 MRE 3008F20. Group: Biochemicals. Grades: Purified. CAS No. 252979-43-4. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 5
Worldwide
MrgprX2 antagonist-1 MrgprX2 antagonist-1 is an MrgprX2 antagonist extracted from patent WO2021092264A1, example E23. MrgprX2 antagonist-1 can be used for the research of inflammatory disorders of the skin[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2642162-06-7. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-145191. MedChemExpress MCE
MrgprX2 antagonist-2 MrgprX2 antagonist-2 is an MrgprX2 antagonist extracted from patent WO2021092262A1, example E163. MrgprX2 antagonist-2 can be used for the research of inflammatory disorders of the skin[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2642346-30-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-145192. MedChemExpress MCE
MRK-560 MRK-560 is an orally active, brain barrier-penetrated ?-Secretase inhibitor, reducing A? peptide in rat brain and cerebrospinal fluid. MRK-560 decreases mutant NOTCH1 processing by selectively inhibiting PSEN1. MRK-560 can be used in studies of Alzheimer's disease and T-cell acute lymphoblastic leukaemia (T-ALL)[1][2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 677772-84-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-14174. MedChemExpress MCE
MRK-740 MRK-740 is a potent, selective and substrate-competitive PRDM9 histone methyltransferase inhibitor with an IC50 of 80?nM. MRK-740 is more selective for PRDM9 than other histone methyltransferases and other non-epigenetic targets. MRK-740 reduces PRDM9-dependent trimethylation of H3K4 (IC50?=?0.8?μM)[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2387510-80-5. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-114209. MedChemExpress MCE
MR-L2 MR-L2 is a reversible and noncompetitive allosteric activator of long-isoform phosphodiesterase-4 (PDE4), activates representative PDE4 long-isoform variants (PDE4A4, PDE4B1, PDE4C3, PDE4D5). MR-L2 suppresses PGE2-induced MDCK cell cyst formation with an EC50 of 1.2 ?M[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2374703-19-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg. Product ID: HY-128358. MedChemExpress MCE
MRL-494 hydrochloride MRL-494 hydrochloride, an antibacterial agent, is a inhibitor of β-barrel assembly machine A (BamA) impervious to efflux and the outer membrane permeability barrier. MRL-494 hydrochloride can inhibits Gram-positive (MIC of 12.5 μM for Staphylococcus aureus COL) and Gram-negative (MIC of 25 μM for E. coli JCM158) bacterias [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2699937-04-5. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-128773A. MedChemExpress MCE
mRNA (2'-O-methyladenosine-N6-)-methyltransferase This enzyme belongs to the family of transferases, specifically those transferring one-carbon group methyltransferases. Group: Enzymes. Synonyms: messenger ribonucleate 2'-O-methyladenosine NG-methyltransferase; S-adenosyl-L-methionine:mRNA (2'-O-methyladenosine-6-N-)-methyltransferase. Enzyme Commission Number: EC 2.1.1.62. CAS No. 68009-87-0. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1964; mRNA (2'-O-methyladenosine-N6-)-methyltransferase; EC 2.1.1.62; 68009-87-0; messenger ribonucleate 2'-O-methyladenosine NG-methyltransferase; S-adenosyl-L-methionine:mRNA (2'-O-methyladenosine-6-N-)-methyltransferase. Cat No: EXWM-1964. Creative Enzymes
mRNA(cytosine6666) deaminase The apolipoprotein B mRNA editing enzyme complex catalyses the editing of apolipoprotein B mRNA at cytidine6666 to uridine, thereby transforming the codon for glutamine-2153 to a termination codon. Editing results in translation of a truncated apolipoprotein B isoform (apoB-48) with distinct functions in lipid transport. The catalytic component (APOBEC-1) contains zinc at the active site. Group: Enzymes. Synonyms: APOBEC-1 (catalytic component of an RNA-editing complex); APOBEC1 (catalytic subunit); apolipoprotein B mRNA-editing enzyme 1 (catalytic component of an RNA-editing complex); apoB mRNA-editing enzyme catalytic polypeptide 1 (catalytic component of an RNA-editing complex); apoB mRNA editing complex; apolipoprotein B mRNA editing enzyme; REPR. Enzyme Commission Number: EC 3.5.4.36. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4564; mRNA(cytosine6666) deaminase; EC 3.5.4.36; APOBEC-1 (catalytic component of an RNA-editing complex); APOBEC1 (catalytic subunit); apolipoprotein B mRNA-editing enzyme 1 (catalytic component of an RNA-editing complex); apoB mRNA-editing enzyme catalytic polypeptide 1 (catalytic component of an RNA-editing complex); apoB mRNA editing complex; apolipoprotein B mRNA editing enzyme; REPR. Cat No: EXWM-4564. Creative Enzymes
mRNA (guanine-N7)-methyltransferase The nucleoside next to the terminal guanosine may be either guanosine or adenosine. Group: Enzymes. Synonyms: messenger ribonucleate guanine 7-methyltransferase; guanine-7-methyltransferase; messenger RNA guanine 7-methyltransferase; S-adenosyl-L-methionine:mRNA (guanine-7-N)-methyltransferase. Enzyme Commission Number: EC 2.1.1.56. CAS No. 56941-25-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1958; mRNA (guanine-N7)-methyltransferase; EC 2.1.1.56; 56941-25-4; messenger ribonucleate guanine 7-methyltransferase; guanine-7-methyltransferase; messenger RNA guanine 7-methyltransferase; S-adenosyl-L-methionine:mRNA (guanine-7-N)-methyltransferase. Cat No: EXWM-1958. Creative Enzymes
mRNA guanylyltransferase The enzyme can also modify synthetic poly(A) and poly(G) to form the structures m7G(5')pppAn and m7G(5')pppGn. Group: Enzymes. Synonyms: mRNA capping enzyme; messenger RNA guanylyltransferase; Protein λ2. Enzyme Commission Number: EC 2.7.7.50. CAS No. 56941-23-2. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3263; mRNA guanylyltransferase; EC 2.7.7.50; 56941-23-2; mRNA capping enzyme; messenger RNA guanylyltransferase; Protein λ2. Cat No: EXWM-3263. Creative Enzymes
mRNA N1-methyladenine demethylase Contains iron(II). Catalyses oxidative demethylation of mRNA N1-methyladenine. The enzyme is also involved in alkylation repair in DNA. Group: Enzymes. Synonyms: ALKBH3. Enzyme Commission Number: EC 1.14.11.54. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0673; mRNA N1-methyladenine demethylase; EC 1.14.11.54; ALKBH3. Cat No: EXWM-0673. Creative Enzymes
mRNA N6-methyladenine demethylase Contains iron(II). Catalyses oxidative demethylation of mRNA N6-methyladenine. The FTO enzyme from human can also demethylate N3-methylthymine from single stranded DNA and N3-methyluridine from single stranded RNA with low activity. Group: Enzymes. Synonyms: ALKBH5; FTO. Enzyme Commission Number: EC 1.14.11.53. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0672; mRNA N6-methyladenine demethylase; EC 1.14.11.53; ALKBH5; FTO. Cat No: EXWM-0672. Creative Enzymes
MroN I One unit of the enzyme is the amount required to hydrolyze 1 μg of Adenovirus-2 DNA in 1 hour at 37°C in a total reaction volume of 50 μl. Applications: After 5-fold overdigestion with enzyme more than 90% of the ad-2 dna fragments can be ligated and recut. Group: Restriction Enzymes. Purity: 500 U; 2500U. G↑CCGGC CGGCC↓G. Activity: 5000u.a./ml. Appearance: 10 X SE-buffer B. Storage: -20°C. Form: Liquid. Source: Micrococcus roseus N0. Pack: 10 mM Tris-HCl (pH 7.5); 250 mM NaCl; 0.1 mM EDTA; 7 mM 2-mercaptoethanol; 200 μg/ml BSA; 50% glycerol. Cat No: ET-1137RE. Creative Enzymes
MroX I One unit of the enzyme is the amount required to hydrolyze 1 μg of Lambda DNA in 1 hour at 37°C in a total reaction volume of 50 μl. Applications: After 5-fold overdigestion with enzyme more than 50% of the dna fragments can be ligated and recut. Group: Restriction Enzymes. Purity: 200U; 1000U. GAANN↑NNTTC CTTNN↓NNAAG. Activity: 5000u.a./ml. Appearance: 10 X SE-buffer W. Storage: -20°C. Form: Liquid. Source: Micrococcus roseus X. Pack: 10 mM Tris-HCl (pH 7.5); 200 mM NaCl; 0,1 mM EDTA; 7 mM 2-mercaptoethanol; 200 μg/ml BSA; 50% glycerol. Cat No: ET-1138RE. Creative Enzymes
Mrs 1065 Mrs 1065. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 4-Methoxy-7-(2-phenylethenyl)-5H-furo[3,2-g][1]benzopyran-5-one;MRS 1065;4-Methoxy-7-(2-phenylethenyl)-5H-furo[3,2-g][1]benzopyran-5-one. Product Category: Heterocyclic Organic Compound. CAS No. 138565-05-6. Molecular formula: C20H14O4. Mole weight: 318.327. Product ID: ACM138565056. Alfa Chemistry — ISO 9001:2015 Certified. Categories: MRS1065. Alfa Chemistry. 4
MRS 1191 solid. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
MRS1220 MRS1220. Group: Biochemicals. Alternative Names: N-[9-Chloro-2-(2-furanyl)[1,2,4]-triazolo[1,5-c]quinazolin-5-yl]benzene acetamide. Grades: Highly Purified. CAS No. 183721-15-5. Pack Sizes: 1mg, 2mg, 5mg, 10mg, 25mg. US Biological Life Sciences. USBiological 8
Worldwide
MRS1220 MRS1220, a highly potent and selective human A3 adenosine receptor (hA3AR) antagonist with a Ki of 0.59 nM, has therapeutic potential for the research of diseases of the central nervous system[1]. MRS1220 reduces glioblastoma tumor size and blood vessel formation in vivo[2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 183721-15-5. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-103190. MedChemExpress MCE
MRS 1220 solid. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
MRS 1523 >98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
MRS 1523 MRS 1523 is a potent and selective adenosine A3 receptor antagonist with Ki values of 18.9 nM and 113 nM for human and rat A3 receptors, respectively. In rat this corresponds to selectivities of 140- and 18-fold vs A1 and A2A receptors, respectively. MRS 1523 can exert antihyperalgesic effect through N-type Ca channel block and action potential inhibition in isolated rat dorsal root ganglion (DRG) neurons[1][2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 212329-37-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-121119. MedChemExpress MCE
MRS 1754 MRS 1754 is a selective antagonist radioligand for A2B adenosine receptor with very low affinity for A1 and A3 receptors of both humans and rats[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 264622-58-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-14121. MedChemExpress MCE
MRS 1754 hydrate ?98% (HPLC), solid. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
MRS 1845 MRS 1845. Group: Biochemicals. Grades: Purified. CAS No. 544478-19-5. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
MRS 1845 ?95% (HPLC), solid. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
MRS 2159 >98% (HPLC), solid. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
MRS 2179 ammonium salt hydrate ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
MRS2179 tetrasodium hydrate MRS2179 tetrasodium hydrate is a competitive P2Y1 receptor antagonist, with a Kb of 102 nM and a pA2 of 6.99 for turkey P2Y1 receptor. MRS2179 tetrasodium hydrate is selective for P2Y1 over P2X1 (IC50=1.15 μM), P2X3 (12.9 μM), P2X2, P2X4, P2Y2, P2Y4, and P2Y6 receptors[1][2]. MRS2179 tetrasodium hydrate inhibits platelet aggregation[3]. Uses: Scientific research. Group: Signaling pathways. Pack Sizes: 1 mg; 5 mg. Product ID: HY-101308A. MedChemExpress MCE
MRS 2211 MRS 2211. Group: Biochemicals. Grades: Purified. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
MRS 2211 (2-[(2-Chloro-5-nitrophenyl)azo]-5-hydroxy-6-methyl-3-[(phosphonooxy)methyl]-4-pyridinecarboxaldehyde Sodium Salt, P2Y13 Purinergic Receptor Antagonist, MRS2211, MRS 2211, MRS-2211) A highly selective and competitive antagonist of P2Y13 purinergic receptor (pIC50 = 5.97). Exhibits about 20-fold greater selectivity over P2Y1 and P2Y12 receptors. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 4
Worldwide
MRS 2219 MRS 2219. Group: Biochemicals. Grades: Purified. CAS No. 14141-47-0. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
MRS 2395 ?98% (HPLC), solid. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
MRS 2500 tetraammonium salt MRS 2500 tetraammonium salt. Group: Biochemicals. Alternative Names: (1R, 2S) -4-[2-[2-Iodo-6- (methylamino) -9H-purin-9-yl]-2- (phosphonooxy) bicyclo[3. 1. 0]hexane-1-methanol dihydrogen phosphate ester tetraammonium salt. Grades: Highly Purified. CAS No. 779323-43-2,630103-23-0. Pack Sizes: 1mg, 2mg, 5mg. Molecular Formula: C13H18N5O8P2I·4NH3. US Biological Life Sciences. USBiological 8
Worldwide
MRS 2578 ?95% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
MRS 2578 MRS 2578. Group: Biochemicals. Grades: Purified. CAS No. 711019-86-2. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
MRS 2690 MRS 2690. Group: Biochemicals. Grades: Purified. CAS No. 15039-58-4. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 5
Worldwide
MRS 2693 trisodium salt MRS 2693 trisodium salt. Group: Biochemicals. Grades: Purified. CAS No. 1448858-83-0. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 5
Worldwide
MRS 2768 tetrasodium salt MRS 2768 tetrasodium salt. Group: Biochemicals. Grades: Purified. CAS No. 1047980-83-5. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 5
Worldwide
MRS 2957 triethylammonium salt MRS 2957 triethylammonium salt. Group: Biochemicals. Grades: Purified. CAS No. 1228271-30-4. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 5
Worldwide
MRS 3777 hemioxalate MRS 3777 hemioxalate. Group: Biochemicals. Grades: Purified. CAS No. 1186195-57-2. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 5
Worldwide
MRS 4062 triethylammonium salt MRS 4062 triethylammonium salt. Group: Biochemicals. Grades: Purified. CAS No. 1309871-50-8. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 5
Worldwide
MRT 10 MRT 10. Group: Biochemicals. Grades: Purified. CAS No. 330829-30-6. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
MRT-10 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
MRT199665 MRT199665 is a potent and ATP-competitive, selective MARK/SIK/AMPK inhibitor with IC50s of 2/2/3/2 nM, 10/10 nM, and 110/12/43 nM for MARK1/MARK2/MARK3/MARK14, AMPK?1/AMPK?2, and SIK1/SIK2/SIK3, respectively[1]. MRT199665 causes apoptosis in MEF2C-activated human acute myeloid leukemias (AML) cells[2]. MRT199665 inhibits the phosphorylation of SIK substrate CRTC3 at S370[3]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1456858-57-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-120877. MedChemExpress MCE
MRT-2359 MRT-2359 is a potent, orally active and selective GSPT1 depressant (IC50: >30 nM and <300 nM) that specifically induces apoptosis dependent on protein translation. MRT-2359 exhibits significant and preferred anti-proliferative activity in a variety of cancer cell lines, especially MYC-driven cell lines, such as non-small cell lung cancer (NSCLC) and small cell lung cancer (SCLC) with high expression of N-Myc or L-Myc. MRT-2359 inhibits the growth of drug-resistant NSCLC and SCLC cells, making it suitable for cancer research[1][2][3][4][5]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2803881-11-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-153356. MedChemExpress MCE
MRT67307 MRT67307 is a dual inhibitor of the IKKε and TBK-1 with IC 50 s of 160 and 19 nM, respectively [1]. MRT67307 also inhibits ULK1 and ULK2 with IC 50 s of 45 and 38 nM, respectively. MRT67307 also blocks autophagy in cells [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1190378-57-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-13018. MedChemExpress MCE
MRT 67307 dihydrochloride MRT 67307 dihydrochloride. Group: Biochemicals. Grades: Purified. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
MRT67307 hydrochloride ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
MRT68921 MRT68921 is a potent inhibitor of ULK1 and ULK2, with IC50 values of 2.9 nM and 1.1 nM, respectively. Uses: Scientific research. Group: Signaling pathways. CAS No. 1190379-70-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-100006. MedChemExpress MCE
MRT68921 dihydrochloride ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
MRT68921 dihydrochloride MRT68921 dihydrochloride is a potent inhibitor of ULK1 and ULK2, with IC50 values of 2.9 nM and 1.1 nM, respectively[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2080306-21-2. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-100006A. MedChemExpress MCE
MRT-83 MRT-83 is a potent antagonist of Smo , with an IC 50 in the nanomolar range. MRT-83 also blocks Hedgehog (Hh) signaling. Uses: Scientific research. Group: Signaling pathways. CAS No. 1263131-92-5. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-18287. MedChemExpress MCE
MRT-83 hydrochloride MRT-83 (hydrochloride) is the potent antagonist of Smoothened ( Smo ) receptor. MRT-83 (hydrochloride) inhibits the Hedgehog (Hh) signaling pathway and BODIPY-cyclopamine binding to human Smo. MRT-83 (hydrochloride) has the potential for researching cancer disease [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1359944-60-7. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-18287A. MedChemExpress MCE
MRTX0902 MRTX0902 is a Potent, Selective, Brain-Penetrant, and Orally Bioavailable Inhibitor of the SOS1:KRAS Protein-Protein Interaction. Oral administration of MRTX0902 in combination with MRTX849 results in a significant increase in antitumor activity relative to that of either single agent, including tumor regressions in a subset of animals in the MIA PaCa-2 tumor mouse xenograft model. Uses: Designed for use in research and industrial production. Additional or Alternative Names: MRTX0902; MRTX-0902; MRTX 0902. Appearance: Solid powder. CAS No. 2654743-22-1. Molecular formula: C22H24N6O. Mole weight: 388.48. Purity: >98%. IUPACName: (R)-2-Methyl-3-(1-((4-methyl-7-morpholinopyrido-[3,4-d]pyridazin-1-yl)amino)ethyl)benzonitrile. Canonical SMILES: N#CC1=CC=CC([C@H](NC2=NN=C(C)C3=CN=C(N4CCOCC4)C=C32)C)=C1C. Product ID: ACM2654743221. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry.
MRTX0902 MRTX0902 is an orally active and potent SOS1 inhibitor with an IC 50 of 46 nM (WO2021127429A1; Example 12-10) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2654743-22-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-145926. MedChemExpress MCE
MRTX1133 MRTX1133 Inhibitor. Uses: Scientific use. Product Category: T9303. CAS No. 2621928-55-8. TARGETMOL CHEMICALS
MRTX1133 MRTX1133 is a potent and selective KRAS G12D inhibitor. MRTX1133 targets the KRAS G12D protein in both active and inactive states. In preclinical studies, MRTX1133 exhibited a long half-life, an ability to bind the KRAS G12D protein in both active and inactive states, and selective inhibition of KRAS G12D mutant cancer cells. In G12D mutant tumor models, MRTX1133 showed dose-dependent selective inhibition of the KRAS pathway and tumor regression. Uses: Designed for use in research and industrial production. Additional or Alternative Names: MRTX1133; MRTX-1133; MRTX 1133. Product Category: Inhibitors. Appearance: Solid powder. CAS No. 2621928-55-8. Molecular formula: C33H31F3N6O2. Mole weight: 600.65. Purity: >98%. IUPACName: 2-Naphthalenol, 4-[4-(3,8-diazabicyclo[3.2.1]oct-3-yl)-8-fluoro-2-[[(2R,7aS)-2-fluorotetrahydro-1H-pyrrolizin-7a(5H)-yl]methoxy]pyrido[4,3-d]pyrimidin-7-yl]-5-ethynyl-6-fluoro-. Canonical SMILES: OC1=CC(C2=C(F)C3=NC(OC[C@@]45CCCN4C[C@H](F)C5)=NC(N6CC(N7)CCC7C6)=C3C=N2)=C8C(C#C)=C(F)C=CC8=C1. Product ID: ACM2621928558. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry.

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products