American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
Maltose Monohydrate Pharmaceutical Secondary Standard; Certified Reference Material. Group: Pharmacopeia & metrological institutes standards. Alfa Chemistry Analytical Products 2
Maltose Monohydrate United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standardsapi standards. Alternative Names: 5,6-Dimethoxy-1-indanone,Maltose Monohydrate. Alfa Chemistry Analytical Products
Maltose Monohydrate United States Pharmacopeia (USP) Reference Standard. Uses: For analytical and research use. Group: Pharmacopeia & metrological institutes standards; api standards. Alternative Names: 5,6-Dimethoxy-1-indanone,Maltose Monohydrate. CAS No. 6363-53-7. Pack Sizes: 500MG. IUPAC Name: (2R,3R,4R,5R)-2,3,5,6-tetrahydroxy-4-[(2R,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyhexanal;hydrate. Molecular formula: C12H22O11.H2O. Mole weight: 360.31. Catalog: APS6363537. SMILES: O.OC[C@@H](O)[C@@H](O[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O)[C@H](O)[C@@H](O)C=O. Format: Neat. Shipping: Room Temperature. Alfa Chemistry Analytical Products 4
Maltose monohydrate (Standard) Maltose monohydrate (Standard) is the analytical standard of Maltose monohydrate. This product is intended for research and analytical applications. Maltose monohydrate is the energy source for bacteria. Uses: Scientific research. Group: Natural products. CAS No. 6363-53-7. Pack Sizes: 25 mg; 50 mg; 100 mg; 250 mg. Product ID: HY-N2024AR. MedChemExpress MCE
maltose O-acetyltransferase Not identical with EC 2.3.1.18, galactoside O-acetyltransferase. The acetyl group is added exclusively to the C6 position of glucose and to the C6 position of the non-reducing glucose residue of maltose. Other substrates of this enzyme are glucose, which is a better substrate than maltose, and mannose and frucose, which are poorer substrates than maltose. Isopropyl-β-thio-galactose, which is a good substrate for EC 2.3.1.118 is a poor substrate for this enzyme. Group: Enzymes. Synonyms: maltose transacetylase; maltose O-acetyltransferase; MAT. Enzyme Commission Number: EC 2.3.1.79. CAS No. 81295-47-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2259; maltose O-acetyltransferase; EC 2.3.1.79; 81295-47-8; maltose transacetylase; maltose O-acetyltransferase; MAT. Cat No: EXWM-2259. Creative Enzymes
maltose phosphorylase This enzyme belongs to the family of glycosyltransferases, specifically the hexosyltransferases. The systematic name of this enzyme class is maltose:phosphate 1-beta-D-glucosyltransferase. This enzyme participates in starch and sucrose metabolism. Group: Enzymes. Enzyme Commission Number: EC 2.4.1.8. CAS No. 9030-19-7. MP. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2620; maltose phosphorylase; EC 2.4.1.8; 9030-19-7. Cat No: EXWM-2620. Creative Enzymes
Maltose phosphorylase Maltose phosphorylase is a dimerase which catalyzes the transformation of maltose and inorganic phosphate into β-D-glucose-1-phosphate and glucose. Maltose phosphorylases have been classified in family 65 of the glycoside hydrolases [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: E.C. 2.4.1.8. CAS No. 9030-19-7. Pack Sizes: 50 U; 250 U. Product ID: HY-P2741. MedChemExpress MCE
Maltose Phosphorylase from E. coli, Recombinant Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes maltose and inorganic phosphate into β-D-glucose-1-phosphate and glucose. Group: Enzymes. Synonyms: maltose phosphorylase; maltose:phosphate 1-β-D-glucosyltransferase; EC 2.4.1.8; 9030-19-7; MP. Enzyme Commission Number: EC 2.4.1.8. CAS No. 9030-19-7. MP. Mole weight: ca. 220 kDa. Activity: > 10 U/mg lyophilizate. Stability: Stability (liquid form) stable at 37°C for at least one week Stability (powder form) stable at 30°C for at least four weeks. Appearance: White lyophilizate. Storage: at -20°C. Source: E. coli. Species: E. coli. maltose phosphorylase; maltose:phosphate 1-β-D-glucosyltransferase; EC 2.4.1.8; 9030-19-7; MP. Cat No: NATE-1250. Creative Enzymes
Maltose Phosphorylase from Enterococcus sp., Recombinant Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes maltose and inorganic phosphate into β-D-glucose-1-phosphate and glucose. Maltose phosphorylase (mp) is a dimeric enzyme that catalyzes maltose and inorganic phosphate into β-d-glucose-1-phosphate and glucose. Applications: Maltose phosphorylase from enter oc occus has been used in a study to describe a new pathway for maltose utilization in lactic acid bacteria. it has also been used in a study to describe the transfer of glucosyl moiety of maltose to acceptors with alcoholic oh groups. Group: Enzymes. Synonyms: maltose phosphorylase; maltose:phosphate 1-β-D-glucosyltransferase; EC 2.4.1.8; 9030-19-7; MP. Enzyme Commission Number: EC 2.4.1.8. CAS No. 9030-19-7. MP. Mole weight: mol wt 90 kDa by SDS-PAGE. Storage: -20°C. Form: lyophilized powder. Source: E. coli. Species: Enterococcus sp. maltose phosphorylase; maltose:phosphate 1-β-D-glucosyltransferase; EC 2.4.1.8; 9030-19-7; MP. Cat No: NATE-0456. Creative Enzymes
maltose synthase Neither free phosphate nor maltose 1-phosphate is an intermediate in the reaction. Group: Enzymes. Enzyme Commission Number: EC 2.4.1.139. CAS No. 81669-74-1. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2364; maltose synthase; EC 2.4.1.139; 81669-74-1. Cat No: EXWM-2364. Creative Enzymes
maltose-transporting ATPase ABC-type (ATP-binding cassette-type) ATPase, characterized by the presence of two similar ATP-binding domains. Does not undergo phosphorylation during the transport process. Comprises bacterial enzymes that import maltose and maltose oligosaccharides. Group: Enzymes. Enzyme Commission Number: EC 7.5.2.1 (Formerly EC 3.6.3.19). Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4655; maltose-transporting ATPase; EC 3.6.3.19. Cat No: EXWM-4655. Creative Enzymes
Maltosine Maltosine. Group: Biochemicals. Alternative Names: (a-S)-a-Amino-3-hydroxy-2-methyl-4-oxo-1(4H)-pyridinehexanoic acid; (S)-a-amino-3-hydroxy-2-methyl-4-oxo-1(4H)-pyridinehexanoic acid. Grades: Highly Purified. CAS No. 121502-04-3. Pack Sizes: 10g. Molecular Formula: C12H18N2O4. US Biological Life Sciences. USBiological 7
Worldwide
Maltotetraose Maltotetraose can serve as a substrate for enzyme-linked assays to measure amylase activity in biological fluids. Maltotetraose has oral active, and reduces TNF-α -induced inflammatory responses by inhibiting NF-κB activity and decreasing ICAM-1 expression. Maltotetraose also inhibits PDGF -induced vascular smooth muscle cell migration and neovascularization. Additionally, Maltotetraose derivatives can function as probes for detecting bacterial infections by targeting the maltodextrin transporter. With good long-term safety, Maltotetraose holds promise for research in atherosclerosis-related diseases [1] [2] [3] [4]. Uses: Scientific research. Group: Natural products. Alternative Names: Amylotetraose; Fujioligo 450; α-1,4-Tetraglucose. CAS No. 34612-38-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-N2464. MedChemExpress MCE
Maltotetraose-[UL-13C24] Maltotetraose-[UL-13C24] is a 13C labelled analogue of Maltotetraose, which is a maltooligosaccharide that is used for research and diagnostic purposes. Maltotetraose-[13C2] itself can be also used as a standard in diagnostic purposes. Molecular formula: [13C]24H42O21. Mole weight: 690.39. BOC Sciences 2
Maltotriose ?90% (HPLC). Group: Polysaccharide. Alfa Chemistry Analytical Products 4
Maltotriose Maltotriose, the second most abundant sugar present in brewing, is an inducer of the maltose regulon of Escherichia coli. Maltotriose can induce beta-galactosidase synthesis [1] [2]. Uses: Scientific research. Group: Natural products. CAS No. 1109-28-0. Pack Sizes: 10 mM * 1 mL; 100 mg. Product ID: HY-113011. MedChemExpress MCE
Maltotriose Maltotriose is a trisaccharide (three-part sugar) consisting of three glucose molecules linked with α-1,4 glycosidic bonds.It is most commonly produced by the digestive enzyme alpha-amylase (a common enzyme in human saliva) on amylose in starch. The creation of both maltotriose and maltose during this process is due to the random manner in which alpha amylase hydrolyses α-1,4 glycosidic bonds.It is the shortest chain oligosaccharide that can be classified as maltodextrin. Group: Polysaccharide. Alternative Names: 4-O-[4-O-(α-D-Glucopyranosyl)-α-D-glucopyranosyl]-D-glucose. CAS No. 1109-28-0. Product ID: (2R,3R,4S,5S,6R)-2-[(2R,3S,4R,5R,6R)-4,5-Dihydroxy-2-(hydroxymethyl)-6-[(2R,3S,4R,5R)-4,5,6-trihydroxy-2-(hydroxymethyl)oxan-3-yl]oxyoxan-3-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol. Molecular formula: 504.44. Mole weight: C18H32O16. C (C1C (C (C (C (O1)OC2C (OC (C (C2O)O)OC3C (OC (C (C3O)O)O)CO)CO)O)O)O)O. InChI=1S/C18H32O16/c19-1-4-7 (22)8 (23)12 (27)17 (31-4)34-15-6 (3-21)32-18 (13 (28)10 (15)25)33-14-5 (2-20)30-16 (29)11 (26)9 (14)24/h4-29H, 1-3H2/t4-, 5-, 6-, 7-, 8+, 9-, 10-, 11-, 12-, 13-, 14-, 15-, 16?, 17-, 18-/m1/s1. FYGDTMLNYKFZSV-DZOUCCHMSA-N. 98%. Alfa Chemistry Materials 7
Maltotriose United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards. Alfa Chemistry Analytical Products 2
Maltotriose Hydrate Maltotriose Hydrate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: D-(+)-Maltotriose Hydrate. Appearance: White to off-white crystalline powder. CAS No. 207511-08-8. Molecular formula: C18H34O17. Mole weight: 522.5. Purity: 0.95. Product ID: ACM207511088. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 2
Maltotriose-[UL-13C18] Hydrate Maltotriose-[UL-13C18] Hydrate. Synonyms: [UL-13C18]Maltotriose hydrate; [UL-13C6]Glc(a1-4)[UL-13C6]Glc(a1-4)[UL-13C6]Glc hydrate. Molecular formula: [13C]18H32O16·(H2O)x. Mole weight: 522.30 (anydrous basis). BOC Sciences 2
Maltulose monohydrate Maltulose monohydrate (4-O-α-D-Glucopyranosyl-D-fructose monohydrate) can be used as an energy source for bacteria. Maltulose monohydrate is a biomaterial or organic compound that can be used in life science research [1]. Uses: Scientific research. Group: Biochemical assay reagents. Alternative Names: 4-O-α-D-Glucopyranosyl-D-fructose monohydrate. CAS No. 207511-09-9. Pack Sizes: 50 mg; 100 mg. Product ID: HY-W415909. MedChemExpress MCE
Mal-Val-Ala-PAB-N(SO2Me)-Exatecan Mal-Val-Ala-PAB-N(SO2Me)-Exatecan (Compound LE14) is a conjugate of an ADC toxin Exatecan (HY-13631) and a linker Mal-Val-Ala-PAB-N(SO2Me). Mal-Val-Ala-PAB-N(SO2Me)-Exatecan can be used for synthesis of ADC FZ-AD005. FZ-AD005 is a delta-like ligand 3 (DLL3, KD=58.3 pM) targeting ADC, that exhibits antitumor efficacy against SCLC cancer[1][2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2575682-08-3. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-159072. MedChemExpress MCE
Mal-VC-PAB-DM1 Mal-VC-PAB-DM1 is a agent-linker conjugate for ADC with potent antitumor activity by using DM1 (a potent microtubule-disrupting agent), linked via the ADC linker Mal-VC-PAB [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1464051-44-2. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-126682. MedChemExpress MCE
Malvidin-3-galactoside chloride analytical standard. Group: Chemical class. Alfa Chemistry Analytical Products
Malvidin-3-galactoside chloride Malvidin-3-galactoside chloride, an anthocyanin monomer, induces hepatocellular carcinoma (HCC) cells cycle arrest and apoptosis. Malvidin-3-galactoside chloride inhibits the production and accumulation of ROS. Malvidin-3-galactoside chloride has anti-tumor function [1]. Uses: Scientific research. Group: Natural products. CAS No. 30113-37-2. Pack Sizes: 1 mg; 5 mg. Product ID: HY-N6623. MedChemExpress MCE
Malvidin-3-glucoside chloride Malvidin-3-glucoside chloride (Malvidin-3-O-glucoside chloride), a major wine anthocyanin, is effective in promoting resilience against stress by modulating brain synaptic plasticity and peripheral inflammation [1]. Uses: Scientific research. Group: Natural products. Alternative Names: Malvidin-3-O-glucoside chloride; Oenin chloride. CAS No. 7228-78-6. Pack Sizes: 1 mg; 5 mg. Product ID: HY-125740. MedChemExpress MCE
Malvidin chloride Malvidin (chloride) is a bioactive compound isolated from grape. Malvidin shows cytotoxicity through the arrest of the G 2 /M phase of cell cycle and induction of apoptosis. Malvidin can be used for the research of cancer [1]. Uses: Scientific research. Group: Natural products. Alternative Names: Syringidin. CAS No. 643-84-5. Pack Sizes: 5 mg; 10 mg. Product ID: HY-122496. MedChemExpress MCE
Malvin(chloride) ?90% (HPLC). Group: Chemical class. Alfa Chemistry Analytical Products
malyl-CoA lyase The enzyme from the bacterium Chloroflexus aurantiacus, which participates in the 3-hydroxypropanoate cycle for carbon assimilation, also has the activity of EC 4.1.3.25, (3S)-citramalyl-CoA lyase. The enzymes from Rhodobacter species are part of acetate assimilation pathways. The reactions are reversible. Group: Enzymes. Synonyms: malyl-coenzyme A lyase; (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase; mclA (gene name); mcl1 (gene name); (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase (acetyl-CoA-forming); L-malyl-CoA lyase. Enzyme Commission Number: EC 4.1.3.24. CAS No. 37290-67-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4904; malyl-CoA lyase; EC 4.1.3.24; 37290-67-8; malyl-coenzyme A lyase; (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase; mclA (gene name); mcl1 (gene name); (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase (acetyl-CoA-forming); L-malyl-CoA lyase. Cat No: EXWM-4904. Creative Enzymes
MAM2201 4-Hydroxypentyl metabolite-[d5] (indole-[d5]) An isotope labelled of MAM2201 N-(4-hydroxypentyl). MAM2201 N-(4-hydroxypentyl) is a synthetic cannabinoid (CB) agonist that displays high affinity for CB receptors. Grade: 95% by HPLC; 98% atom D. Molecular formula: C25H19D5FNO2. Mole weight: 394.5. BOC Sciences 2
Mambalgin 1 Mambalgin 1, a toxin isolated from black mamba venom, is a disulfide-rich polypeptide consisting of 57 amino acids and belongs to the family of three-finger toxins. Mambalgin 1 is a selective ASIC1a inhibitor (IC50= 192 and 72 nM for human ASIC1a and ASIC1a/1b dimer, respectively), and binds to closed/inactive channel. Synonyms: LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK. Grade: >98%. CAS No. 1609937-15-6. Molecular formula: C272H429N85O84S10. Mole weight: 6554.51. BOC Sciences
m-Aminobenzoic acid m-Aminobenzoic acid. CAS No: 99-05-8 Sarchem Laboratories
Sarchem Laboratories New Jersey NJ
M-AMINOBENZYL CYANIDE M-AMINOBENZYL CYANIDE. Uses: Designed for use in research and industrial production. Additional or Alternative Names: M-AMINOBENZYL CYANIDE;3-AMINOBENZYL CYANIDE;2-(3-Aminophenyl)acetonitrile. Product Category: Heterocyclic Organic Compound. CAS No. 4623-24-9. Molecular formula: C8H8N2. Mole weight: 132.16. Product ID: ACM4623249. Alfa Chemistry — ISO 9001:2015 Certified. Categories: (3-AMINO-PHENYL)-ACETONITRILE. Alfa Chemistry. 5
m-Aminoglutethimide United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards. Alfa Chemistry Analytical Products 2
m-Aminophenylboronic acid-Agarose m-Aminophenylboronic acid-Agarose. Group: Salt. Alfa Chemistry Materials 6
Mammaglobin-A (23-31) Mammaglobin-A (23-31) is a truncated fragment of Mammaglobin-A. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. BOC Sciences 11
Mammaglobin-A precursor (2-10) A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. BOC Sciences 11
Mammaglobin-A precursor (32-40) A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. BOC Sciences 11
Mammaglobin-A precursor (4-12) A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. BOC Sciences 11
Mammaglobin-A precursor (66-74) A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. BOC Sciences 11
Mammaglobin-A precursor (83-92) A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. BOC Sciences 11
MAN-9 Glycan ?80%. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Mancozeb Mancozeb is a widely used fungicide that is effective against fungal diseases in most cereals, vegetables, fruits and ornamental plants. In addition, Mancozeb can cause liver damage in mice by activating the Keap1/Nrf2 signaling pathway. Mancozeb upregulates lactate dehydrogenase and cytochrome c to alter cell metabolism and induce cell death. Mancozeb has reproductive toxicity and can induce apoptosis in ovarian cells [1] [2] [3] [4]. Uses: Scientific research. Group: Signaling pathways. CAS No. 8018-1-7. Pack Sizes: 500 mg; 1 g. Product ID: HY-B0854. MedChemExpress MCE
Mancozeb Mancozeb. Group: Biochemicals. Alternative Names: [N- [2- [ (dithiocarboxy) amino] ethyl] carbamodithioato (2-) -κ S, κ S'] manganese mixture with [N- [2- [ (dithiocarboxy) amino] ethyl] carbamodithioato (2-) -κ S, κ S'] zinc; Zinc manganese ethylene bisdithiocarbamate; Agrox 16D. Grades: Highly Purified. CAS No. 8018-1-7. Pack Sizes: 500mg, 1g, 2g, 5g, 10g. Molecular Formula: C8H12MnN4S8Zn. US Biological Life Sciences. USBiological 7
Worldwide
Mancozeb Mancozeb is a fungicide used to protect crops in agriculture. Synonyms: Manganese Zinc ethylenebis(dithiocarbamate). CAS No. 8018-1-7. Molecular formula: C8H12MnN4S8Zn. Mole weight: 541.1. BOC Sciences 12
Mandaril Mandaril. CAS No. 124358-45-8. VIGON Item # 502519. Categories: Speciality Ingrdients Suppliers, Fragrances, Perfumers. Vigon
America & Internationally
Mandarinal 32048 SAEF Mandarinal 32048 SAEF. CAS No. MIXTURE. VIGON Item # 502967. Categories: Speciality Ingrdients Suppliers, Fragrances, Perfumers. Vigon
America & Internationally
Mandarine Aldehyde 10 Mandarine Aldehyde 10. CAS No. MIXTURE. VIGON Item # 502810. Categories: Speciality Ingrdients Suppliers, Fragrances, Perfumers. Vigon
America & Internationally
Mandarin oil Mandarin oil. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Citrus nobilis oil. Product Category: Heterocyclic Organic Compound. CAS No. 8008-31-9. Molecular formula: CAS: 8008-31-9. Density: 0.846 g/mL at 25 °C. Product ID: ACM8008319. Alfa Chemistry — ISO 9001:2015 Certified. Categories: Mandarin Films Distribution Co. Ltd. Alfa Chemistry. 5
Mandarin Terpenes Mandarin Terpenes. CAS No. 68953-04-8. Kosher: Y. VIGON Item # 501464. Categories: Speciality Ingrdients Suppliers, Flavors, Fragrances, Perfumers, Aromatherapy, Essetial Oils. Vigon
America & Internationally
mandelamide amidase This enzyme belongs to the family of hydrolases, those acting on carbon-nitrogen bonds other than peptide bonds, specifically in linear amides. The systematic name of this enzyme class is mandelamide hydrolase. This enzyme is also called Pseudomonas mandelamide hydrolase. Group: Enzymes. Synonyms: Pseudomonas mandelamide hydrolase. Enzyme Commission Number: EC 3.5.1.86. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4477; mandelamide amidase; EC 3.5.1.86; Pseudomonas mandelamide hydrolase. Cat No: EXWM-4477. Creative Enzymes
mandelate 4-monooxygenase Requires Fe2+. Group: Enzymes. Synonyms: L-mandelate 4-hydroxylase; mandelic acid 4-hydroxylase. Enzyme Commission Number: EC 1.14.16.6. CAS No. 39459-82-0. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0958; mandelate 4-monooxygenase; EC 1.14.16.6; 39459-82-0; L-mandelate 4-hydroxylase; mandelic acid 4-hydroxylase. Cat No: EXWM-0958. Creative Enzymes
mandelate racemase Mandelate racemase (EC 5.1.2.2) is a bacterial enzyme which catalyzes the interconversion of the enantiomers of mandelate via an enol intermediate. It is a member of the enolase superfamily of enzymes, along with muconate lactonizing enzyme and enolase. Group: Enzymes. Enzyme Commission Number: EC 5.1.2.2. CAS No. 9024-4-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5389; mandelate racemase; EC 5.1.2.2; 9024-04-8. Cat No: EXWM-5389. Creative Enzymes
Mandelic acid Mandelic acid ((±)-Mandelic acid), an alpha-hydroxycarboxylic acid, has been widely used as an intermediate of pharmaceutical and fine chemicals. Mandelic acid shows antimicrobial activity and has been used for the research of urinary tract infections and vaginal trichomoniasis. Mandelic acid exhibits high sperm-immobilizing activity and low vaginal irritation [1] [2]. Uses: Scientific research. Group: Natural products. Alternative Names: (±)-Mandelic acid; DL-Mandelic acid. CAS No. 90-64-2. Pack Sizes: 10 mM * 1 mL; 500 mg; 1 g. Product ID: HY-W015591. MedChemExpress MCE
Mandelic Acid Mandelic acid is extracted from the bitter almond and is an alpha hydroxyl acid (AHA). Alpha hydroxy acids speed up the cellular turnover rate, ridding the skin of dead skill cells that enhance the natural creases in skin and dull the complexion. Uses: Anti-acne, Exfoliation. Group: Skin Care Active Ingredients. INCI Name: Mandelic Acid. CAS Number: 90-64-2. Mckinley Resources Inc
United States and all of its trading partners..
Mandelic Acid Mandelic Acid is used as an antiseptic (urinary). It is also used as a short-term exposure biomarker in urine from styrene exposed workers. Group: Biochemicals. Grades: Highly Purified. CAS No. 90-64-2. Pack Sizes: 1g, 10g. Molecular Formula: C8H8O3. US Biological Life Sciences. USBiological 5
Worldwide
Mandelic Acid-13C6 Mandelic Acid-13C6 is the labeled version of M162525 which is used as an antiseptic (urinary). It is also used as a short-term exposure biomarker in urine from styrene exposed workers. Group: Biochemicals. Grades: Highly Purified. CAS No. 153489-15-7. Pack Sizes: 1mg, 5mg. Molecular Formula: C213C6H8O3, Molecular Weight: 158.1. US Biological Life Sciences. USBiological 4
Worldwide
Mandelic Acid-13C8 Mandelic Acid-13C8 is C13 labelled Mandelic Acid which is used as an antiseptic (urinary). It is also used as a short-term exposure biomarker in urine from styrene exposed workers. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 1mg, 5mg. Molecular Formula: 13C8H8O3, Molecular Weight: 160.09. US Biological Life Sciences. USBiological 3
Worldwide
Mandelic acid 3,3,5-trimethylcyclohexyl ester Mandelic acid 3,3,5-trimethylcyclohexyl ester. Group: Biochemicals. Grades: Reagent Grade. CAS No. 456-59-7. Pack Sizes: 25g, 100g, 250g. US Biological Life Sciences. USBiological 5
Worldwide
Mandelic acid diethylamide Mandelic acid diethylamide. Uses: Designed for use in research and industrial production. Additional or Alternative Names: MANDELIC ACID DIETHYLAMIDE;ai3-20784-gc;n,n-diethyl-alpha-hydroxy-benzeneacetamid;n,n-diethyl-alpha-hydroxybenzeneacetamide;n,n-diethyl-mandelamid;2-hydroxy-2-phenyl-N,N-diethylacetamide. Product Category: Heterocyclic Organic Compound. CAS No. 2019-69-4. Molecular formula: C12H17NO2. Mole weight: 207.27. Product ID: ACM2019694. Alfa Chemistry — ISO 9001:2015 Certified. Categories: N,N-Diethyl-2-hydroxy-2-phenylacetamide. Alfa Chemistry. 5
Mandelic hydrazide Crystallne, 98%. CAS No. 2443-66-5. Pack Sizes: Typically in stock: 10g, 25g. Mole weight: 166.18. MP/BP: M.P. 134-137. Order No: FR-0207. Frinton Laboratories Inc
Frinton Laboratories
Mandelonitrile Mandelonitrile. CAS No: 532-28-5 Sarchem Laboratories
Sarchem Laboratories New Jersey NJ
Mandipropamid analytical standard. Group: Pesticides & metabolites standardspesticides & metabolitespesticides & metabolites. Alfa Chemistry Analytical Products
Mandipropamid Mandipropamid displays outstanding activity against late blight diseases of potato and tomato, combined with excellent efficacy on downy mildew diseases of grape and cucumber [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 374726-62-2. Pack Sizes: 5 mg; 10 mg. Product ID: HY-W744966. MedChemExpress MCE
Manduca Sexta Moricin Manduca Sexta Moricin exhibited potent antimicrobial activities against a broad spectrum of Gram-positive and Gram-negative bacteria with a minimum inhibitory concentration of 1.4 μm. BOC Sciences 11
Maneb Maneb. Group: Biochemicals. Alternative Names: [N- [2- [ (dithiocarboxy) amino] ethyl] carbamodithioato (2-) -κ S, κ S'] manganese; [Ethylenebis [dithiocarbamato] ] manganese; Dithane M 22. Grades: Highly Purified. CAS No. 12427-38-2. Pack Sizes: 500mg, 1g, 2g, 5g, 10g. Molecular Formula: C4H6MnN2S4. US Biological Life Sciences. USBiological 7
Worldwide
Mangafodipir Related Compound A United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards. Alfa Chemistry Analytical Products
Mangafodipir Related Compound B United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards. Alfa Chemistry Analytical Products
Mangafodipir Related Compound C United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards. Alfa Chemistry Analytical Products
Mangafodipir trisodium Mangafodipir trisodium (MnDPDP), hepatocellular-specific contrast agent, is an efficacious inhibitor of CIPN (chemotherapy-induced peripheral neuropath) and other conditions caused by cellular oxidative stress. Mangafodipir trisodium shows no negative interference with the tumoricidal activity of chemotherapy [1] [2]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: MnDPDP. CAS No. 140678-14-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-B0993. MedChemExpress MCE

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products