American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
Maltol Natural Maltol Natural. CAS No. 118-71-8. FEMA No. 2656. Kosher: Y. VIGON Item # 504140. Categories: Speciality Ingrdients Suppliers, Flavors, Fragrances, Perfumers, Aromatherapy, Essetial Oils. Vigon
America & Internationally
Maltol Propionate Maltol Propionate. CAS No. 68555-63-5. FEMA No. 3941. Kosher: Y. VIGON Item # 500763. Categories: Speciality Ingrdients Suppliers, Flavors, Fragrances, Perfumers. Vigon
America & Internationally
Maltol USP Maltol USP. CAS No. 118-71-8. Molecular formula: C6H6O3. Categories: 118-71-8. American Molecules LLC
Maltooligosyl Trehalose Trehalohydrolase (Crude Enzyme) This product with the indicated enzyme activity was briefly purified from engineered E. coli. Applications: Synthesis; food industry. Group: Enzymes. Synonyms: malto-oligosyltrehalose trehalohydrolase. Enzyme Commission Number: EC 3.2.1.141. CAS No. 170780-50-4. Maltooligosyl trehalose trehalohydrolase. Activity: Undetermined. Appearance: Clear to translucent yellow solution. Storage: at -20 °C or lower, for at least 1 month. Source: E. coli. malto-oligosyltrehalose trehalohydrolase. Pack: 100ml. Cat No: NATE-1834. Creative Enzymes
Maltooligosyl trehalose trehalohydrolase from Bradyrhizobium sp., Recombinant 4-alpha-D-{(1->4)-alpha-D-glucano}trehalose trehalohydrolase (EC 3.2.1.141, malto-oligosyltrehalose trehalohydrolase) is an enzyme with system name 4-alpha-D-((1->4)-alpha-D-glucano)trehalose glucanohydrolase (trehalose-producing).This enzyme catalyses the following chemical reaction: hydrolysis of (1->4)-alpha-D-glucosidic linkage in 4-alpha-D-[(1->4)-alpha-D-glucanosyl]n trehalose to yield trehalose and (1->4)-alpha-D-glucan. Group: Enzymes. Synonyms: 4-α-D-{(1?4)-α-D-Glucano}trehalose trehalohydrolase; 4-α-D-(1,4-α-D-glucano)trehalose glucanohydrolase (trehalose-producing); 4-alpha-D. Enzyme Commission Number: EC 3.2.1.141. CAS No. 170780-50-4. Purity: > 95 % as judged by SDS-PAGE. Maltooligosyl trehalose trehalohydrolase. Mole weight: 69634.7 Da. Storage: Store at 4°C (shipped at room temperature). Form: Supplied in 3.2 M ammonium sulphate. Source: Bradyrhizobium sp. BTAi1. 4-α-D-{(1?4)-α-D-Glucano}trehalose trehalohydrolase; 4-α-D-(1,4-α-D-glucano)trehalose glucanohydrolase (trehalose-producing); 4-alpha-D-{(1?4)-alpha-D-glucano}trehalose trehalohydrolase; 4-alpha-D-(1,4-alpha-D-glucano)trehalose glucanohydrolase (trehalose-producing); Malto-oligosyltrehalose trehalohydrolase; EC 3.2.1.141; Maltooligosyl trehalose trehalohydrolase. Cat No: NATE-1215. Creative Enzymes
Maltopentaose Maltopentaose is the shortest chain oligosaccharide. Maltopentaose is a substrate for α-amylases. Maltopentaose can be classified as maltodextrin and is also used in a study to investigate glycation and phosphorylation of α-lactalbumin. Maltopentaose is used to study the inhibition kinetics of human pancreatic α-amylase by dehydrodieugenol B[1][2][3]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Maltopentose. CAS No. 34620-76-3. Pack Sizes: 10 mM * 1 mL in Water; 5 mg; 10 mg. Product ID: HY-N1495. MedChemExpress MCE
Maltopentaose-[UL-13C30] Labelled Maltopentaose. Maltopentaose is used in a study to investigate glycation and phosphorylation of α-lactalbumin. Molecular formula: [13C]30H52O26. Mole weight: 858.49. BOC Sciences 2
Maltophilin It is produced by the strain of Stenotrophomonas maltophilia. It is a broad-spectrum antifungal antibiotic that has no antibacterial effect against gram-positive and gram-negative bacteria. Molecular formula: C29H38N2O6. Mole weight: 510.62. BOC Sciences 12
Maltose Beta-maltose is a maltose that has beta-configuration at the reducing end anomeric centre. It has a role as a geroprotector. Category: Chemicals. Synonyms: beta-maltose. 133-99-3. D-Maltose. CAS No. 69-79-4. Product ID: CHE69794. Molecular formula: C12H22O11. Mole weight: 342.3. EINECS: 200-716-5. SMILES: C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)O)CO)O)O)O)O. Appearance: White odorless crystals. Protheragen
Maltose Maltose. CAS No. 69-79-4. Product ID: PE-0491. Category: Sweetening agent. Product Keywords: Pharmaceutical Excipients; Excipients for Solid Dosage Form; Maltose; Sweeteners Excipients; Sweetening agent; 69-79-4; 69-79-4. UNII: NA. Chemical Name: 4-O-α-D-Glucopyranosyl-β-D-Glucopyranose anhydrous; 4-O-α-D-Glucopyranosyl-β-D-Glucopyranose monohydrate. Administration route: Oral; Injection. Dosage Form: Oral solutions; Injections. Stability and Storage Conditions: Maltose should be stored in an airtight container in a cool, dry place. Source and Preparation: Maltose monohydrate was prepared by enzymic degradation of starch. Applications: Maltose is a disaccharide widely used in food and pharmaceutical preparations. In injectable products, maltose can be used as a sugar source, especially for diabetics. Maltose crystals can be used as direct tablet excipients for chewable tablets and non-chewable tablets. CD Formulation
Maltose Maltose is a disaccharide composed of two glucose molecules linked together. Maltose is an endogenous metabolic product in plants, yeast, or bacteria, and it participates in carbon source storage and metabolism. Maltose is a key core metabolite and main transport form in the temporary starch degradation, carbon output, and subsequent sucrose synthesis metabolism of the night chloroplast. In X. dendrorhous, maltose can act as a sugar donor and is converted into isomaltulose by α-glucosidase). Maltose can act as a osmotic agent, supporting continuous capillary ultrafiltration and preventing severe metabolic disorders[1][2][3]. Uses: Scientific research. Category: Signaling pathways. CAS No. 69-79-4. Pack Sizes: 10 mM * 1 mL in Water; 500 mg; 1 g; 5 g. Product ID: HY-N2024. MedChemExpress MCE
Maltose-[1-13C] Monohydrate Maltose-[1-13C] Monohydrate. Synonyms: [1'-13C]maltose monohydrate; D-(+)-Maltose-1-13C Monohydrate. Molecular formula: C11[13C]H24O12. Mole weight: 361.31. BOC Sciences 2
Maltose-[13C12] Monohydrate Maltose-[13C12] Monohydrate. Synonyms: D-(+)-Maltose Monohydrate-UL-13C12; [UL-13C12]maltose monohydrate; 4-O-α-D-[UL-13C6]glucopyranosyl-D-[UL-13C6]glucose. Grade: 98%. Molecular formula: [13C]12H24O12. Mole weight: 372.22. BOC Sciences 2
maltose-6'-phosphate glucosidase Hydrolyses a variety of 6-phospho-α-D-glucosides, including α-maltose 6'-phosphate, α,α-trehalose 6-phosphate, sucrose 6-phosphate and p-nitrophenyl-α-D-glucopyranoside 6-phosphate (as a chromogenic substrate). The enzyme is activated by FeII, MnII, CoII and NiII. It is rapidly inactivated in air. Group: Enzymes. Synonyms: phospho-α-glucosidase; maltose-6'-phosphate 6-phosphoglucohydrolase. Enzyme Commission Number: EC 3.2.1.122. CAS No. 98445-08-0. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3805; maltose-6'-phosphate glucosidase; EC 3.2.1.122; 98445-08-0; phospho-α-glucosidase; maltose-6'-phosphate 6-phosphoglucohydrolase. Cat No: EXWM-3805. Creative Enzymes
maltose 6'-phosphate phosphatase The enzyme from the bacterium Enterococcus faecalis also has activity with the sucrose isomer turanose 6'-phosphate (α-D-glucopyranosyl-(1?3)-D-fructose 6-phosphate). Group: Enzymes. Synonyms: maltose 6'-P phosphatase; mapP (gene name). Enzyme Commission Number: EC 3.1.3.90. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3697; maltose 6'-phosphate phosphatase; EC 3.1.3.90; maltose 6'-P phosphatase; mapP (gene name). Cat No: EXWM-3697. Creative Enzymes
maltose α-D-glucosyltransferase This enzyme belongs to the family of isomerases, specifically those intramolecular transferases transferring other groups. This enzyme participates in starch and sucrose metabolism. Group: Enzymes. Synonyms: trehalose synthase; maltose glucosylmutase. Enzyme Commission Number: EC 5.4.99.16. CAS No. 395644-91-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5555; maltose α-D-glucosyltransferase; EC 5.4.99.16; 395644-91-4; trehalose synthase; maltose glucosylmutase. Cat No: EXWM-5555. Creative Enzymes
Maltose Alpha-D-Glucosyltransferase (Crude Enzyme) This enzyme belongs to the family of isomerases, specifically those intramolecular transferases transferring other groups. This product with the indicated enzyme activity was briefly purified from engineered E.coli. Applications: Synthesis; medicine. Group: Enzymes. Synonyms: trehalose synthase; maltose glucosylmutase. Enzyme Commission Number: EC 5.4.99.16. CAS No. 147994-22-7. Activity: Undetermined. Appearance: Clear to translucent yellow solution. Storage: at -20 °C or lower, for at least 1 month. Source: E. coli. trehalose synthase; maltose glucosylmutase. Pack: 100ml. Cat No: NATE-1858. Creative Enzymes
maltose-[d14] monohydrate maltose-[d14] monohydrate. Synonyms: [UL-2H14]maltose monohydrate; 4-O-alpha-D-[UL-2H7]glucopyranosyl-D-[UL-2H7]glucose. Molecular formula: C12H10D14O12. Mole weight: 374.40. BOC Sciences 2
maltose epimerase The enzyme catalyses the interconversion of α and β anomers of maltose more effectively than those of disaccharides such as lactose and cellobiose. Group: Enzymes. Enzyme Commission Number: EC 5.1.3.21. CAS No. 166799-98-0. MER. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5407; maltose epimerase; EC 5.1.3.21; 166799-98-0. Cat No: EXWM-5407. Creative Enzymes
maltose O-acetyltransferase Not identical with EC 2.3.1.18, galactoside O-acetyltransferase. The acetyl group is added exclusively to the C6 position of glucose and to the C6 position of the non-reducing glucose residue of maltose. Other substrates of this enzyme are glucose, which is a better substrate than maltose, and mannose and frucose, which are poorer substrates than maltose. Isopropyl-β-thio-galactose, which is a good substrate for EC 2.3.1.118 is a poor substrate for this enzyme. Group: Enzymes. Synonyms: maltose transacetylase; maltose O-acetyltransferase; MAT. Enzyme Commission Number: EC 2.3.1.79. CAS No. 81295-47-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2259; maltose O-acetyltransferase; EC 2.3.1.79; 81295-47-8; maltose transacetylase; maltose O-acetyltransferase; MAT. Cat No: EXWM-2259. Creative Enzymes
maltose phosphorylase This enzyme belongs to the family of glycosyltransferases, specifically the hexosyltransferases. The systematic name of this enzyme class is maltose:phosphate 1-beta-D-glucosyltransferase. This enzyme participates in starch and sucrose metabolism. Group: Enzymes. Enzyme Commission Number: EC 2.4.1.8. CAS No. 9030-19-7. MP. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2620; maltose phosphorylase; EC 2.4.1.8; 9030-19-7. Cat No: EXWM-2620. Creative Enzymes
Maltose Phosphorylase from E. coli, Recombinant Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes maltose and inorganic phosphate into β-D-glucose-1-phosphate and glucose. Group: Enzymes. Synonyms: maltose phosphorylase; maltose:phosphate 1-β-D-glucosyltransferase; EC 2.4.1.8; 9030-19-7; MP. Enzyme Commission Number: EC 2.4.1.8. CAS No. 9030-19-7. MP. Mole weight: ca. 220 kDa. Activity: > 10 U/mg lyophilizate. Stability: Stability (liquid form) stable at 37°C for at least one week Stability (powder form) stable at 30°C for at least four weeks. Appearance: White lyophilizate. Storage: at -20°C. Source: E. coli. Species: E. coli. maltose phosphorylase; maltose:phosphate 1-β-D-glucosyltransferase; EC 2.4.1.8; 9030-19-7; MP. Cat No: NATE-1250. Creative Enzymes
Maltose Phosphorylase from Enterococcus sp., Recombinant Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes maltose and inorganic phosphate into β-D-glucose-1-phosphate and glucose. Maltose phosphorylase (mp) is a dimeric enzyme that catalyzes maltose and inorganic phosphate into β-d-glucose-1-phosphate and glucose. Applications: Maltose phosphorylase from enter oc occus has been used in a study to describe a new pathway for maltose utilization in lactic acid bacteria. it has also been used in a study to describe the transfer of glucosyl moiety of maltose to acceptors with alcoholic oh groups. Group: Enzymes. Synonyms: maltose phosphorylase; maltose:phosphate 1-β-D-glucosyltransferase; EC 2.4.1.8; 9030-19-7; MP. Enzyme Commission Number: EC 2.4.1.8. CAS No. 9030-19-7. MP. Mole weight: mol wt 90 kDa by SDS-PAGE. Storage: -20°C. Form: lyophilized powder. Source: E. coli. Species: Enterococcus sp. maltose phosphorylase; maltose:phosphate 1-β-D-glucosyltransferase; EC 2.4.1.8; 9030-19-7; MP. Cat No: NATE-0456. Creative Enzymes
maltose synthase Neither free phosphate nor maltose 1-phosphate is an intermediate in the reaction. Group: Enzymes. Enzyme Commission Number: EC 2.4.1.139. CAS No. 81669-74-1. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2364; maltose synthase; EC 2.4.1.139; 81669-74-1. Cat No: EXWM-2364. Creative Enzymes
maltose-transporting ATPase ABC-type (ATP-binding cassette-type) ATPase, characterized by the presence of two similar ATP-binding domains. Does not undergo phosphorylation during the transport process. Comprises bacterial enzymes that import maltose and maltose oligosaccharides. Group: Enzymes. Enzyme Commission Number: EC 7.5.2.1 (Formerly EC 3.6.3.19). Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4655; maltose-transporting ATPase; EC 3.6.3.19. Cat No: EXWM-4655. Creative Enzymes
Maltosine Maltosine. Group: Biochemicals. Alternative Names: (a-S)-a-Amino-3-hydroxy-2-methyl-4-oxo-1(4H)-pyridinehexanoic acid; (S)-a-amino-3-hydroxy-2-methyl-4-oxo-1(4H)-pyridinehexanoic acid. Grades: Highly Purified. CAS No. 121502-04-3. Pack Sizes: 10g. Molecular Formula: C12H18N2O4. US Biological Life Sciences. USBiological 11
Worldwide
Maltotetraose Maltotetraose can serve as a substrate for enzyme-linked assays to measure amylase activity in biological fluids. Maltotetraose has oral active, and reduces TNF-α-induced inflammatory responses by inhibiting NF-κB activity and decreasing ICAM-1 expression. Maltotetraose also inhibits PDGF-induced vascular smooth muscle cell migration and neovascularization. Additionally, Maltotetraose derivatives can function as probes for detecting bacterial infections by targeting the maltodextrin transporter. With good long-term safety, Maltotetraose holds promise for research in atherosclerosis-related diseases[1][2][3][4]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Amylotetraose; Fujioligo 450; α-1,4-Tetraglucose. CAS No. 34612-38-9. Pack Sizes: 10 mM * 1 mL in Water; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-N2464. MedChemExpress MCE
Maltotetraose-[UL-13C24] Maltotetraose-[UL-13C24] is a 13C labelled analogue of Maltotetraose, which is a maltooligosaccharide that is used for research and diagnostic purposes. Maltotetraose-[13C2] itself can be also used as a standard in diagnostic purposes. Molecular formula: [13C]24H42O21. Mole weight: 690.39. BOC Sciences 2
Maltotriitol Maltotriitol is a biochemical reagent that can be used as a biological material or organic compound for life science related research. Uses: Scientific research. Category: Signaling pathways. CAS No. 32860-62-1. Pack Sizes: 10 mM * 1 mL in Water; 10 mg; 25 mg. Product ID: HY-136656. MedChemExpress MCE
Maltotriose Maltotriose is a trisaccharide (three-part sugar) consisting of three glucose molecules linked with α-1,4 glycosidic bonds.It is most commonly produced by the digestive enzyme alpha-amylase (a common enzyme in human saliva) on amylose in starch. The creation of both maltotriose and maltose during this process is due to the random manner in which alpha amylase hydrolyses α-1,4 glycosidic bonds.It is the shortest chain oligosaccharide that can be classified as maltodextrin. Alternative Names: 4-O-[4-O-(α-D-Glucopyranosyl)-α-D-glucopyranosyl]-D-glucose. CAS No. 1109-28-0. Molecular formula: C18H32O16. Mole weight: 504.44. Purity: 98%. IUPAC Name: (2R,3R,4S,5S,6R)-2-[(2R,3S,4R,5R,6R)-4,5-Dihydroxy-2-(hydroxymethyl)-6-[(2R,3S,4R,5R)-4,5,6-trihydroxy-2-(hydroxymethyl)oxan-3-yl]oxyoxan-3-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol. SMILES: C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O. InChI: InChI=1S/C18H32O16/c19-1-4-7(22)8(23)12(27)17(31-4)34-15-6(3-21)32-18(13(28)10(15)25)33-14-5(2-20)30-16(29)11(26)9(14)24/h4-29H,1-3H2/t4-,5-,6-,7-,8+,9-,10-,11-,12-,13-,14-,15-,16?,17-,18-/m1/s1. Alfa Chemistry Materials
Maltotriose Maltotriose is a maltooligosaccharide and a specific inducer of the Escherichia coli maltose operon. The oligosaccharide structure of Maltotriose acts as a highly efficient drug delivery carrier, which significantly enhances the targeting ability and water solubility of photosensitizers in photodynamic therapy for pancreatic cancer[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1109-28-0. Pack Sizes: 10 mM * 1 mL in Water; 100 mg; 500 mg; 1 g; 5 g. Product ID: HY-113011. MedChemExpress MCE
Maltotriose Hydrate Maltotriose Hydrate. Alternative Names: D-(+)-Maltotriose Hydrate. CAS No. 207511-08-8. Purity: 95%. Product ID: ACM207511088. Molecular formula: C18H34O17. Mole weight: 522.50. Alfa Chemistry - ISO 9001:32057 Certified. Alfa Chemistry.
Maltotriose-[UL-13C18] Hydrate Maltotriose-[UL-13C18] Hydrate. Synonyms: [UL-13C18]Maltotriose hydrate; [UL-13C6]Glc(a1-4)[UL-13C6]Glc(a1-4)[UL-13C6]Glc hydrate. Molecular formula: [13C]18H32O16·(H2O)x. Mole weight: 522.30 (anydrous basis). BOC Sciences 2
Mal-va-mac-SN38 Mal-va-mac-SN38 is a drug-linker conjugate for ADC. Mal-va-mac-SN38 contains a ADC cytotoxin SN-38 (HY-13704) and a linker (HY-126364). Mal-va-mac-SN38 can rapidly and covalently bind with endogenous albumin in vivo, resulting in the formation of HSA-va-mac-SN38. Mal-va-mac-SN38 demonstrates exceptional stability in human plasma, and has anti-tumor and anti-metastasis effect[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2778229-31-3. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg. Product ID: HY-159563. MedChemExpress MCE
Mal-VC-PAB-DM1 Mal-VC-PAB-DM1 is a agent-linker conjugate for ADC with potent antitumor activity by using DM1 (a potent microtubule-disrupting agent), linked via the ADC linker Mal-VC-PAB [1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1464051-44-2. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-126682. MedChemExpress MCE
Mal-VC-PAB-DMEA-PNU-159682 Mal-VC-PAB-DMEA-PNU-159682 is a agent-linker conjugate for ADC with potent antitumor activity by using the anti-topoisomerase II agent, PNU-159682, linked via the lysosomally cleavable dipeptide, Mc-VC-PAB. Mal-VC-PAB-DMEA-PNU-159682 can be used in the synthesis of Anti-CD22-NMS249 (HY-164761)[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: SET0568. CAS No. 1178887-17-6. Pack Sizes: 5 mg; 10 mg; 25 mg. Product ID: HY-171138. MedChemExpress MCE
Mal-VC-PAB-PNP Mal-VC-PAB-PNP is a cleavable ADC linker. Mal-VC-PAB-PNP can be used in the synthesis of antibody-drug conjugates (ADCs)[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1096584-62-1. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-148461. MedChemExpress MCE
Malvidin 3,5-diglucoside chloride Malvidin 3,5-diglucoside chloride. Alternative Names: Malvin(chloride), Malvidin chloride 3,5-diglucoside, Malvidin-3,5-diglucoside, Malvoside. CAS No. 16727-30-3. Purity: >90.0%. Product ID: FFC-AR-16727303. Molecular formula: C29H35ClO17. Mole weight: 691.03. IUPAC Name: (2S,3R,4S,5S,6R)-2-[7-hydroxy-2-(4-hydroxy-3,5-dimethoxyphenyl)-3-[(2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxychromenylium-5-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol chloride. Alfa Chemistry - ISO 9001:32057 Certified. Alfa Chemistry.
Malvidin-3-galactoside chloride Malvidin-3-galactoside chloride. Alternative Names: Primulin. CAS No. 30113-37-2. Purity: >95.0%. Product ID: FFC-AR-30113372. Molecular formula: C23H25ClO12. Mole weight: 528.89. IUPAC Name: (2S,3R,4S,5R,6R)-2-[5,7-dihydroxy-2-(4-hydroxy-3,5-dimethoxyphenyl)chromenylium-3-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol chloride. Alfa Chemistry - ISO 9001:32057 Certified. Alfa Chemistry.
Malvidin-3-galactoside chloride Malvidin-3-galactoside chloride, an anthocyanin monomer, induces hepatocellular carcinoma (HCC) cells cycle arrest and apoptosis. Malvidin-3-galactoside chloride inhibits the production and accumulation of ROS. Malvidin-3-galactoside chloride has anti-tumor function[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 30113-37-2. Pack Sizes: 1 mg; 5 mg. Product ID: HY-N6623. MedChemExpress MCE
Malvidin-3-glucoside chloride Malvidin-3-glucoside (Malvidin-3-O-glucoside; Oenin) chloride is an orally active inhibitor of the NF-κB pathway, which blocks inflammatory responses induced by TNF-α, reduces IκB-α degradation and p65 nuclear translocation, and upregulates endothelial nitric oxide synthase eNOS to increase NO production. Malvidin-3-glucoside chloride exerts anti-inflammatory and antioxidant effects by inhibiting pro-inflammatory molecules such as MCP-1, ICAM-1, and IL-6, and regulating intestinal microorganisms and metabolites, while protecting endothelial cells and improving intestinal microecological dysbiosis under inflammatory conditions. Malvidin-3-glucoside chloride can be used to study chronic inflammatory-related diseases such as atherosclerosis and inflammatory bowel disease, and has the potential to prevent vascular inflammation and improve intestinal health[1][2][3]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Malvidin-3-O-glucoside chloride; Oenin chloride. CAS No. 7228-78-6. Pack Sizes: 1 mg; 5 mg. Product ID: HY-125740. MedChemExpress MCE
Malvidin-3-O-arabinoside chloride Malvidin-3-O-arabinoside chloride ameliorates ethyl carbamate-induced oxidative damage by stimulating AMPK-mediated autophagy[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 28500-04-1. Pack Sizes: 1 mg; 5 mg. Product ID: HY-N9349. MedChemExpress MCE
Malvidin chloride Malvidin chloride. Alternative Names: Syringidin chloride. CAS No. 643-84-5. Purity: >95.0%. Product ID: FFC-AR-643845. Molecular formula: C17H15ClO7. Mole weight: 366.75. IUPAC Name: 2-(4-hydroxy-3,5-dimethoxyphenyl)chromenylium-3,5,7-triol chloride. Alfa Chemistry - ISO 9001:32057 Certified. Alfa Chemistry.
Malvin chloride Malvin chloride. CAS No. 16727-30-3. Product ID: ACM16727303. Molecular formula: C29H35ClO17. Mole weight: 691.03. Alfa Chemistry - ISO 9001:32057 Certified. Alfa Chemistry. 4
malyl-CoA lyase The enzyme from the bacterium Chloroflexus aurantiacus, which participates in the 3-hydroxypropanoate cycle for carbon assimilation, also has the activity of EC 4.1.3.25, (3S)-citramalyl-CoA lyase. The enzymes from Rhodobacter species are part of acetate assimilation pathways. The reactions are reversible. Group: Enzymes. Synonyms: malyl-coenzyme A lyase; (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase; mclA (gene name); mcl1 (gene name); (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase (acetyl-CoA-forming); L-malyl-CoA lyase. Enzyme Commission Number: EC 4.1.3.24. CAS No. 37290-67-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4904; malyl-CoA lyase; EC 4.1.3.24; 37290-67-8; malyl-coenzyme A lyase; (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase; mclA (gene name); mcl1 (gene name); (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase (acetyl-CoA-forming); L-malyl-CoA lyase. Cat No: EXWM-4904. Creative Enzymes
MAM2201 4-Hydroxypentyl metabolite-[d5] (indole-[d5]) An isotope labelled of MAM2201 N-(4-hydroxypentyl). MAM2201 N-(4-hydroxypentyl) is a synthetic cannabinoid (CB) agonist that displays high affinity for CB receptors. Grade: 95% by HPLC; 98% atom D. Molecular formula: C25H19D5FNO2. Mole weight: 394.5. BOC Sciences 2
Mambalgin 1 Mambalgin 1, a toxin isolated from black mamba venom, is a disulfide-rich polypeptide consisting of 57 amino acids and belongs to the family of three-finger toxins. Mambalgin 1 is a selective ASIC1a inhibitor (IC50= 192 and 72 nM for human ASIC1a and ASIC1a/1b dimer, respectively), and binds to closed/inactive channel. Synonyms: LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK. Grade: >98%. CAS No. 1609937-15-6. Molecular formula: C272H429N85O84S10. Mole weight: 6554.51. BOC Sciences
m-Aminobenzoic acid m-Aminobenzoic acid. CAS No: 99-05-8 Sarchem Laboratories
Sarchem Laboratories New Jersey NJ
m-Aminophenol HCl m-Aminophenol HCl. Alternative Names: 3-Hydroxyaniliniumchloride. CAS No. 51-81-0. Purity: 0.98. Product ID: CI-HC-0264. Molecular formula: C6H8ClNO. Mole weight: 145.59 g/mol. IUPAC Name: 3-aminophenol;hydrochloride. Alfa Chemistry - ISO 9001:32057 Certified. Alfa Chemistry.
m-Aminophenol Sulfate m-Aminophenol Sulfate. Alternative Names: 3-Aminophenol hemisulfate. CAS No. 68239-81-6. Purity: 0.98. Product ID: CI-HC-0265. Molecular formula: C12H16N2O6S. Mole weight: 316.33 g/mol. IUPAC Name: 3-aminophenol;sulfuric acid. Alfa Chemistry - ISO 9001:32057 Certified. Alfa Chemistry.
m-Aminophenylboronic acid-Agarose m-Aminophenylboronic acid-Agarose. Alfa Chemistry Materials 3
Mammaglobin-A (23-31) Mammaglobin-A (23-31) is a truncated fragment of Mammaglobin-A. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. BOC Sciences 11
Mammaglobin-A precursor (2-10) A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. BOC Sciences 11
Mammaglobin-A precursor (32-40) A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. BOC Sciences 11
Mammaglobin-A precursor (4-12) A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. BOC Sciences 11
Mammaglobin-A precursor (66-74) A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. BOC Sciences 11
Mammaglobin-A precursor (83-92) A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. BOC Sciences 11
Mancozeb Mancozeb is a widely used fungicide that is effective against fungal diseases in most cereals, vegetables, fruits and ornamental plants. In addition, Mancozeb can cause liver damage in mice by activating the Keap1/Nrf2 signaling pathway. Mancozeb upregulates lactate dehydrogenase and cytochrome c to alter cell metabolism and induce cell death. Mancozeb has reproductive toxicity and can induce apoptosis in ovarian cells[1][2][3][4]. Uses: Scientific research. Category: Signaling pathways. CAS No. 8018-1-7. Pack Sizes: 100 mg; 500 mg; 1 g. Product ID: HY-B0854. MedChemExpress MCE
Mancozeb Mancozeb is a fungicide used to protect crops in agriculture. Synonyms: Manganese Zinc ethylenebis(dithiocarbamate). CAS No. 8018-1-7. Molecular formula: C8H12MnN4S8Zn. Mole weight: 541.1. BOC Sciences 12
Mancozeb Mancozeb. Group: Biochemicals. Alternative Names: [N- [2- [ (dithiocarboxy) amino] ethyl] carbamodithioato (2-) -κ S, κ S'] manganese mixture with [N- [2- [ (dithiocarboxy) amino] ethyl] carbamodithioato (2-) -κ S, κ S'] zinc; Zinc manganese ethylene bisdithiocarbamate; Agrox 16D. Grades: Highly Purified. CAS No. 8018-1-7. Pack Sizes: 500mg, 1g, 2g, 5g, 10g. Molecular Formula: C8H12MnN4S8Zn. US Biological Life Sciences. USBiological 11
Worldwide
Mandaril Mandaril. CAS No. 124358-45-8. VIGON Item # 502519. Categories: Speciality Ingrdients Suppliers, Fragrances, Perfumers. Vigon
America & Internationally
Mandarinal 32048 SAEF Mandarinal 32048 SAEF. CAS No. MIXTURE. VIGON Item # 502967. Categories: Speciality Ingrdients Suppliers, Fragrances, Perfumers. Vigon
America & Internationally
Mandarin Berry Fragrance Oil Blend of natural and synthetic high-quality scents. Phthalate-free. May cause cloudiness at high concentrations. Product ID: CI-HC-0165. Alfa Chemistry - ISO 9001:32057 Certified. Alfa Chemistry.
Mandarine Aldehyde 10 Mandarine Aldehyde 10. CAS No. MIXTURE. VIGON Item # 502810. Categories: Speciality Ingrdients Suppliers, Fragrances, Perfumers. Vigon
America & Internationally
Mandarin oil Mandarin oil. Product ID: CI-EO-0097. Alfa Chemistry - ISO 9001:32057 Certified. Alfa Chemistry.
Mandarin Terpenes Mandarin Terpenes. CAS No. 68953-04-8. Kosher: Y. VIGON Item # 501464. Categories: Speciality Ingrdients Suppliers, Flavors, Fragrances, Perfumers, Aromatherapy, Essetial Oils. Vigon
America & Internationally
mandelamide amidase This enzyme belongs to the family of hydrolases, those acting on carbon-nitrogen bonds other than peptide bonds, specifically in linear amides. The systematic name of this enzyme class is mandelamide hydrolase. This enzyme is also called Pseudomonas mandelamide hydrolase. Group: Enzymes. Synonyms: Pseudomonas mandelamide hydrolase. Enzyme Commission Number: EC 3.5.1.86. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4477; mandelamide amidase; EC 3.5.1.86; Pseudomonas mandelamide hydrolase. Cat No: EXWM-4477. Creative Enzymes
mandelate 4-monooxygenase Requires Fe2+. Group: Enzymes. Synonyms: L-mandelate 4-hydroxylase; mandelic acid 4-hydroxylase. Enzyme Commission Number: EC 1.14.16.6. CAS No. 39459-82-0. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0958; mandelate 4-monooxygenase; EC 1.14.16.6; 39459-82-0; L-mandelate 4-hydroxylase; mandelic acid 4-hydroxylase. Cat No: EXWM-0958. Creative Enzymes
mandelate racemase Mandelate racemase (EC 5.1.2.2) is a bacterial enzyme which catalyzes the interconversion of the enantiomers of mandelate via an enol intermediate. It is a member of the enolase superfamily of enzymes, along with muconate lactonizing enzyme and enolase. Group: Enzymes. Enzyme Commission Number: EC 5.1.2.2. CAS No. 9024-4-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5389; mandelate racemase; EC 5.1.2.2; 9024-04-8. Cat No: EXWM-5389. Creative Enzymes
Mandelic Acid Mandelic Acid is used as an antiseptic (urinary). It is also used as a short-term exposure biomarker in urine from styrene exposed workers. Group: Biochemicals. Grades: Highly Purified. CAS No. 90-64-2. Pack Sizes: 1g, 10g. Molecular Formula: C8H8O3. US Biological Life Sciences. USBiological 11
Worldwide

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products