A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| Maltohexaose | Maltohexaose. Alternative Names: α-Maltohexaose. CAS No. 34620-77-4. Molecular formula: C36H62O31. Mole weight: 990.86. Purity: 98%. IUPAC Name: (2R,3R,4S,5S,6R)-2-[(2R,3S,4R,5R,6R)-6-[(2R,3S,4R,5R,6R)-6-[(2R,3S,4R,5R,6R)-6-[(2R,3S,4R,5R,6R)-4,5-dihydroxy-2-(hydroxymethyl)-6-[(2R,3S,4R,5R)-4,5,6-trihydroxy-2-(hydroxymethyl)oxan-3-yl]oxyoxan-3-yl]oxy-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl]oxy-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl]oxy-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol. SMILES: C([C@@H]1[C@H]([C@@H]([C@H]([C@H](O1)O[C@@H]2[C@H](O[C@@H]([C@@H]([C@H]2O)O)O[C@@H]3[C@H](O[C@@H]([C@@H]([C@H]3O)O)O[C@@H]4[C@H](O[C@@H]([C@@H]([C@H]4O)O)O[C@@H]5[C@H](O[C@@H]([C@@H]([C@H]5O)O)O[C@@H]6[C@H](OC([C@@H]([C@H]6O)O)O)CO)CO)CO)CO)CO)O)O)O)O. InChI: InChI=1S/C36H62O31/c37-1-7-13(43)14(44)21(51)32(58-7)64-27-9(3-39)60-34(23(53)16(27)46)66-29-11(5-41)62-36(25(55)18(29)48)67-30-12(6-42)61-35(24(54)19(30)49)65-28-10(4-40)59-33(22(52)17(28)47)63-26-8(2-38)57-31(56)20(50)15(26)45/h7-56H,1-6H2/t7-,8-,9-,10-,11-,12-,13-,14+,15-,16-,17-,18-,19-,20-,21-,22-,23-,24-,25-,26-,27-,28-,29-,30-,31?,32-,33-,34-,35-,36-/m1/s1. |  |
| Maltohexaose | Maltohexaose (Amylohexaose) is a linear oligosaccharide containing 6 glucose units, which can be produced from amylose, amylopectin, and whole starch. Maltohexaose can inhibit the proliferation of P-815 cells[1][2]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Amylohexaose. CAS No. 34620-77-4. Pack Sizes: 10 mM * 1 mL in Water; 1 mg; 5 mg; 10 mg; 25 mg. Product ID: HY-N2559. |  |
| maltohexaose sulfate | maltohexaose sulfate. Product ID: ACMA00004913. Alfa Chemistry - ISO 9001:32057 Certified. |  |
| Maltohexaose-[UL-13C36] | Labelled Maltohexaose. Maltohexaose has been used in a study to investigate the production of a thermophilic maltooligosyl-trehalose synthase. Molecular formula: [13C]36H62O31. Mole weight: 1026.58. |  |
| maltokinase | Requires Mg2+ for activity. Group: Enzymes. Enzyme Commission Number: EC 2.7.1.175. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3006; maltokinase; EC 2.7.1.175. Cat No: EXWM-3006. |  |
| Maltol | A fragrance molecule used in flavor enhancers and fragrances. Group: Biochemicals. Alternative Names: 3-Hydroxy-2-methyl-4H-pyran-4-one; 2-Methyl-3-hydroxy-4-pyrone; 2-Methyl-3-hydroxypyran-4-one; 2-Methyl-3-hydroxypyrone; 3-Hydroxy-2-methyl-1,4-pyrone; Larixic Acid; Larixin; NSC 2829; NSC 404458; Palatone; Veltol. Grades: Highly Purified. CAS No. 118-71-8. Pack Sizes: 5g. US Biological Life Sciences. |  Worldwide |
| Maltol | Maltol, a type of aromatic compound, is an antioxidant agent. Maltol enhances neural function by mitigating oxidative stress and cell apoptosis. Maltol is an inhibitor of oxidative damage in nerve cells and is effective in preventing diabetic peripheral neuropathy (DPN). Maltol is used extensively as a safe flavoring agent and food preservative. Maltol is a metal ion chelator that can be used in the field of catalysis, cosmetics, and medicine[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 118-71-8. Pack Sizes: 10 mM * 1 mL in DMSO; 100 mg; 1 g; 5 g; 10 g; 25 g; 50 g; 100 g. Product ID: HY-W012788. | |
| Maltol | Maltol. Group: Biochemicals. Grades: Plant Grade. CAS No. 118-71-8. Pack Sizes: 20mg. US Biological Life Sciences. | Worldwide |
| Maltol | Maltol is a fragrance molecule used in flavor enhancers and fragrances. Uses: Antioxidant. Synonyms: 3-Hydroxy-2-methyl-4H-pyran-4-one; 2-Methyl-3-hydroxy-4-pyrone; 2-Methyl-3-hydroxypyran-4-one; 3-Hydroxy-2-methyl-1,4-pyrone; Larixic Acid; Larixin; Palatone; Veltol. Grade: 98%. CAS No. 118-71-8. Molecular formula: C6H6O3. Mole weight: 126.11. | |
| Maltol FCC | Maltol FCC. CAS No. 118-71-8. FEMA No. 2656. Kosher: Y. VIGON Item # 500413. Categories: Speciality Ingrdients Suppliers, Flavors, Fragrances, Perfumers. |  America & Internationally |
| Maltol Isobutyrate | Maltol Isobutyrate. CAS No. 65416-14-0. FEMA No. 3462. Kosher: Y. VIGON Item # 500224. Categories: Speciality Ingrdients Suppliers, Flavors, Fragrances, Perfumers. | America & Internationally |
| Maltol Natural | Maltol Natural. CAS No. 118-71-8. FEMA No. 2656. Kosher: Y. VIGON Item # 504140. Categories: Speciality Ingrdients Suppliers, Flavors, Fragrances, Perfumers, Aromatherapy, Essetial Oils. | America & Internationally |
| Maltol Propionate | Maltol Propionate. CAS No. 68555-63-5. FEMA No. 3941. Kosher: Y. VIGON Item # 500763. Categories: Speciality Ingrdients Suppliers, Flavors, Fragrances, Perfumers. | America & Internationally |
| Maltol USP | Maltol USP. CAS No. 118-71-8. Molecular formula: C6H6O3. Categories: 118-71-8. |  |
| Maltooligosyl Trehalose Trehalohydrolase (Crude Enzyme) | This product with the indicated enzyme activity was briefly purified from engineered E. coli. Applications: Synthesis; food industry. Group: Enzymes. Synonyms: malto-oligosyltrehalose trehalohydrolase. Enzyme Commission Number: EC 3.2.1.141. CAS No. 170780-50-4. Maltooligosyl trehalose trehalohydrolase. Activity: Undetermined. Appearance: Clear to translucent yellow solution. Storage: at -20 °C or lower, for at least 1 month. Source: E. coli. malto-oligosyltrehalose trehalohydrolase. Pack: 100ml. Cat No: NATE-1834. | |
| Maltooligosyl trehalose trehalohydrolase from Bradyrhizobium sp., Recombinant | 4-alpha-D-{(1->4)-alpha-D-glucano}trehalose trehalohydrolase (EC 3.2.1.141, malto-oligosyltrehalose trehalohydrolase) is an enzyme with system name 4-alpha-D-((1->4)-alpha-D-glucano)trehalose glucanohydrolase (trehalose-producing).This enzyme catalyses the following chemical reaction: hydrolysis of (1->4)-alpha-D-glucosidic linkage in 4-alpha-D-[(1->4)-alpha-D-glucanosyl]n trehalose to yield trehalose and (1->4)-alpha-D-glucan. Group: Enzymes. Synonyms: 4-α-D-{(1?4)-α-D-Glucano}trehalose trehalohydrolase; 4-α-D-(1,4-α-D-glucano)trehalose glucanohydrolase (trehalose-producing); 4-alpha-D. Enzyme Commission Number: EC 3.2.1.141. CAS No. 170780-50-4. Purity: > 95 % as judged by SDS-PAGE. Maltooligosyl trehalose trehalohydrolase. Mole weight: 69634.7 Da. Storage: Store at 4°C (shipped at room temperature). Form: Supplied in 3.2 M ammonium sulphate. Source: Bradyrhizobium sp. BTAi1. 4-α-D-{(1?4)-α-D-Glucano}trehalose trehalohydrolase; 4-α-D-(1,4-α-D-glucano)trehalose glucanohydrolase (trehalose-producing); 4-alpha-D-{(1?4)-alpha-D-glucano}trehalose trehalohydrolase; 4-alpha-D-(1,4-alpha-D-glucano)trehalose glucanohydrolase (trehalose-producing); Malto-oligosyltrehalose trehalohydrolase; EC 3.2.1.141; Maltooligosyl trehalose trehalohydrolase. Cat No: NATE-1215. | |
| Maltopentaose | Maltopentaose is the shortest chain oligosaccharide. Maltopentaose is a substrate for α-amylases. Maltopentaose can be classified as maltodextrin and is also used in a study to investigate glycation and phosphorylation of α-lactalbumin. Maltopentaose is used to study the inhibition kinetics of human pancreatic α-amylase by dehydrodieugenol B[1][2][3]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Maltopentose. CAS No. 34620-76-3. Pack Sizes: 10 mM * 1 mL in Water; 5 mg; 10 mg. Product ID: HY-N1495. | |
| Maltopentaose-[UL-13C30] | Labelled Maltopentaose. Maltopentaose is used in a study to investigate glycation and phosphorylation of α-lactalbumin. Molecular formula: [13C]30H52O26. Mole weight: 858.49. | |
| Maltophilin | It is produced by the strain of Stenotrophomonas maltophilia. It is a broad-spectrum antifungal antibiotic that has no antibacterial effect against gram-positive and gram-negative bacteria. Molecular formula: C29H38N2O6. Mole weight: 510.62. | |
| Maltose | Beta-maltose is a maltose that has beta-configuration at the reducing end anomeric centre. It has a role as a geroprotector. Category: Chemicals. Synonyms: beta-maltose. 133-99-3. D-Maltose. CAS No. 69-79-4. Product ID: CHE69794. Molecular formula: C12H22O11. Mole weight: 342.3. EINECS: 200-716-5. SMILES: C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)O)CO)O)O)O)O. Appearance: White odorless crystals. |  |
| Maltose | Maltose. CAS No. 69-79-4. Product ID: PE-0491. Category: Sweetening agent. Product Keywords: Pharmaceutical Excipients; Excipients for Solid Dosage Form; Maltose; Sweeteners Excipients; Sweetening agent; 69-79-4; 69-79-4. UNII: NA. Chemical Name: 4-O-α-D-Glucopyranosyl-β-D-Glucopyranose anhydrous; 4-O-α-D-Glucopyranosyl-β-D-Glucopyranose monohydrate. Administration route: Oral; Injection. Dosage Form: Oral solutions; Injections. Stability and Storage Conditions: Maltose should be stored in an airtight container in a cool, dry place. Source and Preparation: Maltose monohydrate was prepared by enzymic degradation of starch. Applications: Maltose is a disaccharide widely used in food and pharmaceutical preparations. In injectable products, maltose can be used as a sugar source, especially for diabetics. Maltose crystals can be used as direct tablet excipients for chewable tablets and non-chewable tablets. |  |
| Maltose | Maltose is a disaccharide composed of two glucose molecules linked together. Maltose is an endogenous metabolic product in plants, yeast, or bacteria, and it participates in carbon source storage and metabolism. Maltose is a key core metabolite and main transport form in the temporary starch degradation, carbon output, and subsequent sucrose synthesis metabolism of the night chloroplast. In X. dendrorhous, maltose can act as a sugar donor and is converted into isomaltulose by α-glucosidase). Maltose can act as a osmotic agent, supporting continuous capillary ultrafiltration and preventing severe metabolic disorders[1][2][3]. Uses: Scientific research. Category: Signaling pathways. CAS No. 69-79-4. Pack Sizes: 10 mM * 1 mL in Water; 500 mg; 1 g; 5 g. Product ID: HY-N2024. | |
| Maltose-[1-13C] Monohydrate | Maltose-[1-13C] Monohydrate. Synonyms: [1'-13C]maltose monohydrate; D-(+)-Maltose-1-13C Monohydrate. Molecular formula: C11[13C]H24O12. Mole weight: 361.31. | |
| Maltose-[13C12] Monohydrate | Maltose-[13C12] Monohydrate. Synonyms: D-(+)-Maltose Monohydrate-UL-13C12; [UL-13C12]maltose monohydrate; 4-O-α-D-[UL-13C6]glucopyranosyl-D-[UL-13C6]glucose. Grade: 98%. Molecular formula: [13C]12H24O12. Mole weight: 372.22. | |
| maltose-6'-phosphate glucosidase | Hydrolyses a variety of 6-phospho-α-D-glucosides, including α-maltose 6'-phosphate, α,α-trehalose 6-phosphate, sucrose 6-phosphate and p-nitrophenyl-α-D-glucopyranoside 6-phosphate (as a chromogenic substrate). The enzyme is activated by FeII, MnII, CoII and NiII. It is rapidly inactivated in air. Group: Enzymes. Synonyms: phospho-α-glucosidase; maltose-6'-phosphate 6-phosphoglucohydrolase. Enzyme Commission Number: EC 3.2.1.122. CAS No. 98445-08-0. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3805; maltose-6'-phosphate glucosidase; EC 3.2.1.122; 98445-08-0; phospho-α-glucosidase; maltose-6'-phosphate 6-phosphoglucohydrolase. Cat No: EXWM-3805. | |
| maltose 6'-phosphate phosphatase | The enzyme from the bacterium Enterococcus faecalis also has activity with the sucrose isomer turanose 6'-phosphate (α-D-glucopyranosyl-(1?3)-D-fructose 6-phosphate). Group: Enzymes. Synonyms: maltose 6'-P phosphatase; mapP (gene name). Enzyme Commission Number: EC 3.1.3.90. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3697; maltose 6'-phosphate phosphatase; EC 3.1.3.90; maltose 6'-P phosphatase; mapP (gene name). Cat No: EXWM-3697. | |
| maltose α-D-glucosyltransferase | This enzyme belongs to the family of isomerases, specifically those intramolecular transferases transferring other groups. This enzyme participates in starch and sucrose metabolism. Group: Enzymes. Synonyms: trehalose synthase; maltose glucosylmutase. Enzyme Commission Number: EC 5.4.99.16. CAS No. 395644-91-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5555; maltose α-D-glucosyltransferase; EC 5.4.99.16; 395644-91-4; trehalose synthase; maltose glucosylmutase. Cat No: EXWM-5555. | |
| Maltose Alpha-D-Glucosyltransferase (Crude Enzyme) | This enzyme belongs to the family of isomerases, specifically those intramolecular transferases transferring other groups. This product with the indicated enzyme activity was briefly purified from engineered E.coli. Applications: Synthesis; medicine. Group: Enzymes. Synonyms: trehalose synthase; maltose glucosylmutase. Enzyme Commission Number: EC 5.4.99.16. CAS No. 147994-22-7. Activity: Undetermined. Appearance: Clear to translucent yellow solution. Storage: at -20 °C or lower, for at least 1 month. Source: E. coli. trehalose synthase; maltose glucosylmutase. Pack: 100ml. Cat No: NATE-1858. | |
| maltose-[d14] monohydrate | maltose-[d14] monohydrate. Synonyms: [UL-2H14]maltose monohydrate; 4-O-alpha-D-[UL-2H7]glucopyranosyl-D-[UL-2H7]glucose. Molecular formula: C12H10D14O12. Mole weight: 374.40. | |
| maltose epimerase | The enzyme catalyses the interconversion of α and β anomers of maltose more effectively than those of disaccharides such as lactose and cellobiose. Group: Enzymes. Enzyme Commission Number: EC 5.1.3.21. CAS No. 166799-98-0. MER. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5407; maltose epimerase; EC 5.1.3.21; 166799-98-0. Cat No: EXWM-5407. | |
| maltose O-acetyltransferase | Not identical with EC 2.3.1.18, galactoside O-acetyltransferase. The acetyl group is added exclusively to the C6 position of glucose and to the C6 position of the non-reducing glucose residue of maltose. Other substrates of this enzyme are glucose, which is a better substrate than maltose, and mannose and frucose, which are poorer substrates than maltose. Isopropyl-β-thio-galactose, which is a good substrate for EC 2.3.1.118 is a poor substrate for this enzyme. Group: Enzymes. Synonyms: maltose transacetylase; maltose O-acetyltransferase; MAT. Enzyme Commission Number: EC 2.3.1.79. CAS No. 81295-47-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2259; maltose O-acetyltransferase; EC 2.3.1.79; 81295-47-8; maltose transacetylase; maltose O-acetyltransferase; MAT. Cat No: EXWM-2259. | |
| maltose phosphorylase | This enzyme belongs to the family of glycosyltransferases, specifically the hexosyltransferases. The systematic name of this enzyme class is maltose:phosphate 1-beta-D-glucosyltransferase. This enzyme participates in starch and sucrose metabolism. Group: Enzymes. Enzyme Commission Number: EC 2.4.1.8. CAS No. 9030-19-7. MP. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2620; maltose phosphorylase; EC 2.4.1.8; 9030-19-7. Cat No: EXWM-2620. | |
| Maltose Phosphorylase from E. coli, Recombinant | Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes maltose and inorganic phosphate into β-D-glucose-1-phosphate and glucose. Group: Enzymes. Synonyms: maltose phosphorylase; maltose:phosphate 1-β-D-glucosyltransferase; EC 2.4.1.8; 9030-19-7; MP. Enzyme Commission Number: EC 2.4.1.8. CAS No. 9030-19-7. MP. Mole weight: ca. 220 kDa. Activity: > 10 U/mg lyophilizate. Stability: Stability (liquid form) stable at 37°C for at least one week Stability (powder form) stable at 30°C for at least four weeks. Appearance: White lyophilizate. Storage: at -20°C. Source: E. coli. Species: E. coli. maltose phosphorylase; maltose:phosphate 1-β-D-glucosyltransferase; EC 2.4.1.8; 9030-19-7; MP. Cat No: NATE-1250. | |
| Maltose Phosphorylase from Enterococcus sp., Recombinant | Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes maltose and inorganic phosphate into β-D-glucose-1-phosphate and glucose. Maltose phosphorylase (mp) is a dimeric enzyme that catalyzes maltose and inorganic phosphate into β-d-glucose-1-phosphate and glucose. Applications: Maltose phosphorylase from enter oc occus has been used in a study to describe a new pathway for maltose utilization in lactic acid bacteria. it has also been used in a study to describe the transfer of glucosyl moiety of maltose to acceptors with alcoholic oh groups. Group: Enzymes. Synonyms: maltose phosphorylase; maltose:phosphate 1-β-D-glucosyltransferase; EC 2.4.1.8; 9030-19-7; MP. Enzyme Commission Number: EC 2.4.1.8. CAS No. 9030-19-7. MP. Mole weight: mol wt 90 kDa by SDS-PAGE. Storage: -20°C. Form: lyophilized powder. Source: E. coli. Species: Enterococcus sp. maltose phosphorylase; maltose:phosphate 1-β-D-glucosyltransferase; EC 2.4.1.8; 9030-19-7; MP. Cat No: NATE-0456. | |
| maltose synthase | Neither free phosphate nor maltose 1-phosphate is an intermediate in the reaction. Group: Enzymes. Enzyme Commission Number: EC 2.4.1.139. CAS No. 81669-74-1. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2364; maltose synthase; EC 2.4.1.139; 81669-74-1. Cat No: EXWM-2364. | |
| maltose-transporting ATPase | ABC-type (ATP-binding cassette-type) ATPase, characterized by the presence of two similar ATP-binding domains. Does not undergo phosphorylation during the transport process. Comprises bacterial enzymes that import maltose and maltose oligosaccharides. Group: Enzymes. Enzyme Commission Number: EC 7.5.2.1 (Formerly EC 3.6.3.19). Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4655; maltose-transporting ATPase; EC 3.6.3.19. Cat No: EXWM-4655. | |
| Maltosine | Maltosine. Group: Biochemicals. Alternative Names: (a-S)-a-Amino-3-hydroxy-2-methyl-4-oxo-1(4H)-pyridinehexanoic acid; (S)-a-amino-3-hydroxy-2-methyl-4-oxo-1(4H)-pyridinehexanoic acid. Grades: Highly Purified. CAS No. 121502-04-3. Pack Sizes: 10g. Molecular Formula: C12H18N2O4. US Biological Life Sciences. | Worldwide |
| Maltotetraose | Maltotetraose can serve as a substrate for enzyme-linked assays to measure amylase activity in biological fluids. Maltotetraose has oral active, and reduces TNF-α-induced inflammatory responses by inhibiting NF-κB activity and decreasing ICAM-1 expression. Maltotetraose also inhibits PDGF-induced vascular smooth muscle cell migration and neovascularization. Additionally, Maltotetraose derivatives can function as probes for detecting bacterial infections by targeting the maltodextrin transporter. With good long-term safety, Maltotetraose holds promise for research in atherosclerosis-related diseases[1][2][3][4]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Amylotetraose; Fujioligo 450; α-1,4-Tetraglucose. CAS No. 34612-38-9. Pack Sizes: 10 mM * 1 mL in Water; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-N2464. | |
| Maltotetraose-[UL-13C24] | Maltotetraose-[UL-13C24] is a 13C labelled analogue of Maltotetraose, which is a maltooligosaccharide that is used for research and diagnostic purposes. Maltotetraose-[13C2] itself can be also used as a standard in diagnostic purposes. Molecular formula: [13C]24H42O21. Mole weight: 690.39. | |
| Maltotriitol | Maltotriitol is a biochemical reagent that can be used as a biological material or organic compound for life science related research. Uses: Scientific research. Category: Signaling pathways. CAS No. 32860-62-1. Pack Sizes: 10 mM * 1 mL in Water; 10 mg; 25 mg. Product ID: HY-136656. | |
| Maltotriose | Maltotriose is a trisaccharide (three-part sugar) consisting of three glucose molecules linked with α-1,4 glycosidic bonds.It is most commonly produced by the digestive enzyme alpha-amylase (a common enzyme in human saliva) on amylose in starch. The creation of both maltotriose and maltose during this process is due to the random manner in which alpha amylase hydrolyses α-1,4 glycosidic bonds.It is the shortest chain oligosaccharide that can be classified as maltodextrin. Alternative Names: 4-O-[4-O-(α-D-Glucopyranosyl)-α-D-glucopyranosyl]-D-glucose. CAS No. 1109-28-0. Molecular formula: C18H32O16. Mole weight: 504.44. Purity: 98%. IUPAC Name: (2R,3R,4S,5S,6R)-2-[(2R,3S,4R,5R,6R)-4,5-Dihydroxy-2-(hydroxymethyl)-6-[(2R,3S,4R,5R)-4,5,6-trihydroxy-2-(hydroxymethyl)oxan-3-yl]oxyoxan-3-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol. SMILES: C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O. InChI: InChI=1S/C18H32O16/c19-1-4-7(22)8(23)12(27)17(31-4)34-15-6(3-21)32-18(13(28)10(15)25)33-14-5(2-20)30-16(29)11(26)9(14)24/h4-29H,1-3H2/t4-,5-,6-,7-,8+,9-,10-,11-,12-,13-,14-,15-,16?,17-,18-/m1/s1. | |
| Maltotriose | Maltotriose is a maltooligosaccharide and a specific inducer of the Escherichia coli maltose operon. The oligosaccharide structure of Maltotriose acts as a highly efficient drug delivery carrier, which significantly enhances the targeting ability and water solubility of photosensitizers in photodynamic therapy for pancreatic cancer[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1109-28-0. Pack Sizes: 10 mM * 1 mL in Water; 100 mg; 500 mg; 1 g; 5 g. Product ID: HY-113011. | |
| Maltotriose Hydrate | Maltotriose Hydrate. Alternative Names: D-(+)-Maltotriose Hydrate. CAS No. 207511-08-8. Purity: 95%. Product ID: ACM207511088. Molecular formula: C18H34O17. Mole weight: 522.50. Alfa Chemistry - ISO 9001:32057 Certified. | |
| Maltotriose-[UL-13C18] Hydrate | Maltotriose-[UL-13C18] Hydrate. Synonyms: [UL-13C18]Maltotriose hydrate; [UL-13C6]Glc(a1-4)[UL-13C6]Glc(a1-4)[UL-13C6]Glc hydrate. Molecular formula: [13C]18H32O16·(H2O)x. Mole weight: 522.30 (anydrous basis). | |
| Mal-va-mac-SN38 | Mal-va-mac-SN38 is a drug-linker conjugate for ADC. Mal-va-mac-SN38 contains a ADC cytotoxin SN-38 (HY-13704) and a linker (HY-126364). Mal-va-mac-SN38 can rapidly and covalently bind with endogenous albumin in vivo, resulting in the formation of HSA-va-mac-SN38. Mal-va-mac-SN38 demonstrates exceptional stability in human plasma, and has anti-tumor and anti-metastasis effect[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2778229-31-3. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg. Product ID: HY-159563. | |
| Mal-VC-PAB-DM1 | Mal-VC-PAB-DM1 is a agent-linker conjugate for ADC with potent antitumor activity by using DM1 (a potent microtubule-disrupting agent), linked via the ADC linker Mal-VC-PAB [1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1464051-44-2. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-126682. | |
| Mal-VC-PAB-DMEA-PNU-159682 | Mal-VC-PAB-DMEA-PNU-159682 is a agent-linker conjugate for ADC with potent antitumor activity by using the anti-topoisomerase II agent, PNU-159682, linked via the lysosomally cleavable dipeptide, Mc-VC-PAB. Mal-VC-PAB-DMEA-PNU-159682 can be used in the synthesis of Anti-CD22-NMS249 (HY-164761)[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: SET0568. CAS No. 1178887-17-6. Pack Sizes: 5 mg; 10 mg; 25 mg. Product ID: HY-171138. | |
| Mal-VC-PAB-PNP | Mal-VC-PAB-PNP is a cleavable ADC linker. Mal-VC-PAB-PNP can be used in the synthesis of antibody-drug conjugates (ADCs)[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1096584-62-1. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-148461. | |
| Malvidin 3,5-diglucoside chloride | Malvidin 3,5-diglucoside chloride. Alternative Names: Malvin(chloride), Malvidin chloride 3,5-diglucoside, Malvidin-3,5-diglucoside, Malvoside. CAS No. 16727-30-3. Purity: >90.0%. Product ID: FFC-AR-16727303. Molecular formula: C29H35ClO17. Mole weight: 691.03. IUPAC Name: (2S,3R,4S,5S,6R)-2-[7-hydroxy-2-(4-hydroxy-3,5-dimethoxyphenyl)-3-[(2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxychromenylium-5-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol chloride. Alfa Chemistry - ISO 9001:32057 Certified. | |
| Malvidin-3-galactoside chloride | Malvidin-3-galactoside chloride, an anthocyanin monomer, induces hepatocellular carcinoma (HCC) cells cycle arrest and apoptosis. Malvidin-3-galactoside chloride inhibits the production and accumulation of ROS. Malvidin-3-galactoside chloride has anti-tumor function[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 30113-37-2. Pack Sizes: 1 mg; 5 mg. Product ID: HY-N6623. | |
| Malvidin-3-galactoside chloride | Malvidin-3-galactoside chloride. Alternative Names: Primulin. CAS No. 30113-37-2. Purity: >95.0%. Product ID: FFC-AR-30113372. Molecular formula: C23H25ClO12. Mole weight: 528.89. IUPAC Name: (2S,3R,4S,5R,6R)-2-[5,7-dihydroxy-2-(4-hydroxy-3,5-dimethoxyphenyl)chromenylium-3-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol chloride. Alfa Chemistry - ISO 9001:32057 Certified. | |
| Malvidin-3-glucoside chloride | Malvidin-3-glucoside (Malvidin-3-O-glucoside; Oenin) chloride is an orally active inhibitor of the NF-κB pathway, which blocks inflammatory responses induced by TNF-α, reduces IκB-α degradation and p65 nuclear translocation, and upregulates endothelial nitric oxide synthase eNOS to increase NO production. Malvidin-3-glucoside chloride exerts anti-inflammatory and antioxidant effects by inhibiting pro-inflammatory molecules such as MCP-1, ICAM-1, and IL-6, and regulating intestinal microorganisms and metabolites, while protecting endothelial cells and improving intestinal microecological dysbiosis under inflammatory conditions. Malvidin-3-glucoside chloride can be used to study chronic inflammatory-related diseases such as atherosclerosis and inflammatory bowel disease, and has the potential to prevent vascular inflammation and improve intestinal health[1][2][3]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Malvidin-3-O-glucoside chloride; Oenin chloride. CAS No. 7228-78-6. Pack Sizes: 1 mg; 5 mg. Product ID: HY-125740. | |
| Malvidin-3-O-arabinoside chloride | Malvidin-3-O-arabinoside chloride ameliorates ethyl carbamate-induced oxidative damage by stimulating AMPK-mediated autophagy[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 28500-04-1. Pack Sizes: 1 mg; 5 mg. Product ID: HY-N9349. | |
| Malvidin chloride | Malvidin chloride. Alternative Names: Syringidin chloride. CAS No. 643-84-5. Purity: >95.0%. Product ID: FFC-AR-643845. Molecular formula: C17H15ClO7. Mole weight: 366.75. IUPAC Name: 2-(4-hydroxy-3,5-dimethoxyphenyl)chromenylium-3,5,7-triol chloride. Alfa Chemistry - ISO 9001:32057 Certified. | |
| Malvin chloride | Malvin chloride. CAS No. 16727-30-3. Product ID: ACM16727303. Molecular formula: C29H35ClO17. Mole weight: 691.03. Alfa Chemistry - ISO 9001:32057 Certified. | |
| malyl-CoA lyase | The enzyme from the bacterium Chloroflexus aurantiacus, which participates in the 3-hydroxypropanoate cycle for carbon assimilation, also has the activity of EC 4.1.3.25, (3S)-citramalyl-CoA lyase. The enzymes from Rhodobacter species are part of acetate assimilation pathways. The reactions are reversible. Group: Enzymes. Synonyms: malyl-coenzyme A lyase; (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase; mclA (gene name); mcl1 (gene name); (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase (acetyl-CoA-forming); L-malyl-CoA lyase. Enzyme Commission Number: EC 4.1.3.24. CAS No. 37290-67-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4904; malyl-CoA lyase; EC 4.1.3.24; 37290-67-8; malyl-coenzyme A lyase; (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase; mclA (gene name); mcl1 (gene name); (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase (acetyl-CoA-forming); L-malyl-CoA lyase. Cat No: EXWM-4904. | |
| MAM2201 4-Hydroxypentyl metabolite-[d5] (indole-[d5]) | An isotope labelled of MAM2201 N-(4-hydroxypentyl). MAM2201 N-(4-hydroxypentyl) is a synthetic cannabinoid (CB) agonist that displays high affinity for CB receptors. Grade: 95% by HPLC; 98% atom D. Molecular formula: C25H19D5FNO2. Mole weight: 394.5. | |
| Mambalgin 1 | Mambalgin 1, a toxin isolated from black mamba venom, is a disulfide-rich polypeptide consisting of 57 amino acids and belongs to the family of three-finger toxins. Mambalgin 1 is a selective ASIC1a inhibitor (IC50= 192 and 72 nM for human ASIC1a and ASIC1a/1b dimer, respectively), and binds to closed/inactive channel. Synonyms: LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK. Grade: >98%. CAS No. 1609937-15-6. Molecular formula: C272H429N85O84S10. Mole weight: 6554.51. | |
| m-Aminobenzoic acid | m-Aminobenzoic acid. CAS No: 99-05-8 |  Sarchem Laboratories New Jersey NJ |
| m-Aminophenol HCl | m-Aminophenol HCl. Alternative Names: 3-Hydroxyaniliniumchloride. CAS No. 51-81-0. Purity: 0.98. Product ID: CI-HC-0264. Molecular formula: C6H8ClNO. Mole weight: 145.59 g/mol. IUPAC Name: 3-aminophenol;hydrochloride. Alfa Chemistry - ISO 9001:32057 Certified. | |
| m-Aminophenol Sulfate | m-Aminophenol Sulfate. Alternative Names: 3-Aminophenol hemisulfate. CAS No. 68239-81-6. Purity: 0.98. Product ID: CI-HC-0265. Molecular formula: C12H16N2O6S. Mole weight: 316.33 g/mol. IUPAC Name: 3-aminophenol;sulfuric acid. Alfa Chemistry - ISO 9001:32057 Certified. | |
| m-Aminophenylboronic acid-Agarose | m-Aminophenylboronic acid-Agarose. | |
| Mammaglobin-A (23-31) | Mammaglobin-A (23-31) is a truncated fragment of Mammaglobin-A. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
| Mammaglobin-A precursor (2-10) | A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
| Mammaglobin-A precursor (32-40) | A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
| Mammaglobin-A precursor (4-12) | A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
| Mammaglobin-A precursor (66-74) | A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
| Mammaglobin-A precursor (83-92) | A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
| Mancozeb | Mancozeb is a widely used fungicide that is effective against fungal diseases in most cereals, vegetables, fruits and ornamental plants. In addition, Mancozeb can cause liver damage in mice by activating the Keap1/Nrf2 signaling pathway. Mancozeb upregulates lactate dehydrogenase and cytochrome c to alter cell metabolism and induce cell death. Mancozeb has reproductive toxicity and can induce apoptosis in ovarian cells[1][2][3][4]. Uses: Scientific research. Category: Signaling pathways. CAS No. 8018-1-7. Pack Sizes: 100 mg; 500 mg; 1 g. Product ID: HY-B0854. | |
| Mancozeb | Mancozeb is a fungicide used to protect crops in agriculture. Synonyms: Manganese Zinc ethylenebis(dithiocarbamate). CAS No. 8018-1-7. Molecular formula: C8H12MnN4S8Zn. Mole weight: 541.1. | |
Our database is helping our users find suppliers everyday.
