A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| Maltosan | Maltosan is a reputable biomedical compound, aiding in studying the intricate complexities associated with diabetes and diverse metabolic ailments. This cutting-edge compound encapsulates the essence of maltose, an all-natural saccharide sourced from starch. Synonyms: 1,6-Anhydro-4-O-a-D-glucopyranosyl-b-D-glucopyranose; 1,6-Anhydro-b-D-maltose. CAS No. 6983-27-3. Molecular formula: C12H20O10. Mole weight: 324.28. |  |
| Maltose | Maltose. CAS No. 69-79-4. Product ID: PE-0491. Category: Sweetening agent. Product Keywords: Pharmaceutical Excipients; Excipients for Solid Dosage Form; Maltose; Sweeteners Excipients; Sweetening agent; 69-79-4; 69-79-4. UNII: NA. Chemical Name: 4-O-α-D-Glucopyranosyl-β-D-Glucopyranose anhydrous; 4-O-α-D-Glucopyranosyl-β-D-Glucopyranose monohydrate. Administration route: Oral; Injection. Dosage Form: Oral solutions; Injections. Stability and Storage Conditions: Maltose should be stored in an airtight container in a cool, dry place. Source and Preparation: Maltose monohydrate was prepared by enzymic degradation of starch. Applications: Maltose is a disaccharide widely used in food and pharmaceutical preparations. In injectable products, maltose can be used as a sugar source, especially for diabetics. Maltose crystals can be used as direct tablet excipients for chewable tablets and non-chewable tablets. |  |
| Maltose | Maltose is a disaccharide formed from two units of glucose joined with an α(1→4) bond, a reducing sugar. Maltose monohydrate can be used as a energy source for bacteria. Uses: Scientific research. Group: Natural products. CAS No. 69-79-4. Pack Sizes: 500 mg; 1 g; 5 g. Product ID: HY-N2024. |  |
| Maltose | Maltose is commonly used as a nutrient, and it can be also used in the preparation of culture media. Synonyms: D-(+)-Maltose. CAS No. 69-79-4. Molecular formula: C12H22O11. Mole weight: 342.297. | |
| maltose-6'-phosphate glucosidase | Hydrolyses a variety of 6-phospho-α-D-glucosides, including α-maltose 6'-phosphate, α,α-trehalose 6-phosphate, sucrose 6-phosphate and p-nitrophenyl-α-D-glucopyranoside 6-phosphate (as a chromogenic substrate). The enzyme is activated by FeII, MnII, CoII and NiII. It is rapidly inactivated in air. Group: Enzymes. Synonyms: phospho-α-glucosidase; maltose-6'-phosphate 6-phosphoglucohydrolase. Enzyme Commission Number: EC 3.2.1.122. CAS No. 98445-08-0. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3805; maltose-6'-phosphate glucosidase; EC 3.2.1.122; 98445-08-0; phospho-α-glucosidase; maltose-6'-phosphate 6-phosphoglucohydrolase. Cat No: EXWM-3805. |  |
| maltose 6'-phosphate phosphatase | The enzyme from the bacterium Enterococcus faecalis also has activity with the sucrose isomer turanose 6'-phosphate (α-D-glucopyranosyl-(1?3)-D-fructose 6-phosphate). Group: Enzymes. Synonyms: maltose 6'-P phosphatase; mapP (gene name). Enzyme Commission Number: EC 3.1.3.90. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3697; maltose 6'-phosphate phosphatase; EC 3.1.3.90; maltose 6'-P phosphatase; mapP (gene name). Cat No: EXWM-3697. | |
| Maltose acid | Maltose acid. Uses: For analytical and research use. Group: Impurity standards. CAS No. 534-42-9. Molecular Formula: C12H22O12. Mole Weight: 358.3. Catalog: APB534429. |  |
| maltose α-D-glucosyltransferase | This enzyme belongs to the family of isomerases, specifically those intramolecular transferases transferring other groups. This enzyme participates in starch and sucrose metabolism. Group: Enzymes. Synonyms: trehalose synthase; maltose glucosylmutase. Enzyme Commission Number: EC 5.4.99.16. CAS No. 395644-91-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5555; maltose α-D-glucosyltransferase; EC 5.4.99.16; 395644-91-4; trehalose synthase; maltose glucosylmutase. Cat No: EXWM-5555. | |
| Maltose Alpha-D-Glucosyltransferase (Crude Enzyme) | This enzyme belongs to the family of isomerases, specifically those intramolecular transferases transferring other groups. This product with the indicated enzyme activity was briefly purified from engineered E.coli. Applications: Synthesis; medicine. Group: Enzymes. Synonyms: trehalose synthase; maltose glucosylmutase. Enzyme Commission Number: EC 5.4.99.16. CAS No. 147994-22-7. Activity: Undetermined. Appearance: Clear to translucent yellow solution. Storage: at -20 °C or lower, for at least 1 month. Source: E. coli. trehalose synthase; maltose glucosylmutase. Pack: 100ml. Cat No: NATE-1858. | |
| Maltose alternan oligosaccharide | Maltose alternan oligosaccharide is a biomedical product used to study various health condition such as diabetes. Additionally, research suggests that it may have antioxidant and anti-inflammatory properties, making it useful in studying oxidative stress-related diseases. Synonyms: MAOS. | |
| maltose epimerase | The enzyme catalyses the interconversion of α and β anomers of maltose more effectively than those of disaccharides such as lactose and cellobiose. Group: Enzymes. Enzyme Commission Number: EC 5.1.3.21. CAS No. 166799-98-0. MER. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5407; maltose epimerase; EC 5.1.3.21; 166799-98-0. Cat No: EXWM-5407. | |
| Maltose monohydrate | Maltose monohydrate is the energy source for bacteria. Uses: Scientific research. Group: Natural products. CAS No. 6363-53-7. Pack Sizes: 10 mM * 1 mL; 10 g; 25 g. Product ID: HY-N2024A. | |
| Maltose Monohydrate | United States Pharmacopeia (USP) Reference Standard. Uses: For analytical and research use. Group: Pharmacopeia & metrological institutes standards; api standards. Alternative Names: 5,6-Dimethoxy-1-indanone,Maltose Monohydrate. CAS No. 6363-53-7. Pack Sizes: 500MG. IUPAC Name: (2R,3R,4R,5R)-2,3,5,6-tetrahydroxy-4-[(2R,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyhexanal;hydrate. Molecular Formula: C12H22O11.H2O. Mole Weight: 360.31. Catalog: APS6363537. SMILES: O. OC[C@@H] (O)[C@@H] (O[C@H]1O[C@H] (CO)[C@@H] (O)[C@H] (O)[C@H]1O)[C@H] (O)[C@@H] (O)C=O. Format: Neat. Shipping: Room Temperature. | |
| Maltose monohydrate (Standard) | Maltose monohydrate (Standard) is the analytical standard of Maltose monohydrate. This product is intended for research and analytical applications. Maltose monohydrate is the energy source for bacteria. Uses: Scientific research. Group: Natural products. CAS No. 6363-53-7. Pack Sizes: 25 mg; 50 mg; 100 mg; 250 mg. Product ID: HY-N2024AR. | |
| maltose O-acetyltransferase | Not identical with EC 2.3.1.18, galactoside O-acetyltransferase. The acetyl group is added exclusively to the C6 position of glucose and to the C6 position of the non-reducing glucose residue of maltose. Other substrates of this enzyme are glucose, which is a better substrate than maltose, and mannose and frucose, which are poorer substrates than maltose. Isopropyl-β-thio-galactose, which is a good substrate for EC 2.3.1.118 is a poor substrate for this enzyme. Group: Enzymes. Synonyms: maltose transacetylase; maltose O-acetyltransferase; MAT. Enzyme Commission Number: EC 2.3.1.79. CAS No. 81295-47-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2259; maltose O-acetyltransferase; EC 2.3.1.79; 81295-47-8; maltose transacetylase; maltose O-acetyltransferase; MAT. Cat No: EXWM-2259. | |
| maltose phosphorylase | This enzyme belongs to the family of glycosyltransferases, specifically the hexosyltransferases. The systematic name of this enzyme class is maltose:phosphate 1-beta-D-glucosyltransferase. This enzyme participates in starch and sucrose metabolism. Group: Enzymes. Enzyme Commission Number: EC 2.4.1.8. CAS No. 9030-19-7. MP. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2620; maltose phosphorylase; EC 2.4.1.8; 9030-19-7. Cat No: EXWM-2620. | |
| Maltose phosphorylase | Maltose phosphorylase is a dimerase which catalyzes the transformation of maltose and inorganic phosphate into β-D-glucose-1-phosphate and glucose. Maltose phosphorylases have been classified in family 65 of the glycoside hydrolases [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: E.C. 2.4.1.8. CAS No. 9030-19-7. Pack Sizes: 50 U; 250 U. Product ID: HY-P2741. | |
| Maltose Phosphorylase from E. coli, Recombinant | Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes maltose and inorganic phosphate into β-D-glucose-1-phosphate and glucose. Group: Enzymes. Synonyms: maltose phosphorylase; maltose:phosphate 1-β-D-glucosyltransferase; EC 2.4.1.8; 9030-19-7; MP. Enzyme Commission Number: EC 2.4.1.8. CAS No. 9030-19-7. MP. Mole weight: ca. 220 kDa. Activity: > 10 U/mg lyophilizate. Stability: Stability (liquid form) stable at 37°C for at least one week Stability (powder form) stable at 30°C for at least four weeks. Appearance: White lyophilizate. Storage: at -20°C. Source: E. coli. Species: E. coli. maltose phosphorylase; maltose:phosphate 1-β-D-glucosyltransferase; EC 2.4.1.8; 9030-19-7; MP. Cat No: NATE-1250. | |
| Maltose Phosphorylase from Enterococcus sp., Recombinant | Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes maltose and inorganic phosphate into β-D-glucose-1-phosphate and glucose. Maltose phosphorylase (mp) is a dimeric enzyme that catalyzes maltose and inorganic phosphate into β-d-glucose-1-phosphate and glucose. Applications: Maltose phosphorylase from enter oc occus has been used in a study to describe a new pathway for maltose utilization in lactic acid bacteria. it has also been used in a study to describe the transfer of glucosyl moiety of maltose to acceptors with alcoholic oh groups. Group: Enzymes. Synonyms: maltose phosphorylase; maltose:phosphate 1-β-D-glucosyltransferase; EC 2.4.1.8; 9030-19-7; MP. Enzyme Commission Number: EC 2.4.1.8. CAS No. 9030-19-7. MP. Mole weight: mol wt 90 kDa by SDS-PAGE. Storage: -20°C. Form: lyophilized powder. Source: E. coli. Species: Enterococcus sp. maltose phosphorylase; maltose:phosphate 1-β-D-glucosyltransferase; EC 2.4.1.8; 9030-19-7; MP. Cat No: NATE-0456. | |
| Maltose, Reagent Grade, 100 g | Formula: C12H22O11. H2O. Formula Wt: 360. 32. Storage Code: Green; general chemical storage. Alternative Names: Malt sugar. Grades: chem-grade reagent. CAS No. 6363-53-7. Product ID: 873750. -- SOLD FOR EDUCATIONAL USE ONLY -- |  |
| maltose synthase | Neither free phosphate nor maltose 1-phosphate is an intermediate in the reaction. Group: Enzymes. Enzyme Commission Number: EC 2.4.1.139. CAS No. 81669-74-1. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2364; maltose synthase; EC 2.4.1.139; 81669-74-1. Cat No: EXWM-2364. | |
| Maltose syrup | | |
| maltose-transporting ATPase | ABC-type (ATP-binding cassette-type) ATPase, characterized by the presence of two similar ATP-binding domains. Does not undergo phosphorylation during the transport process. Comprises bacterial enzymes that import maltose and maltose oligosaccharides. Group: Enzymes. Enzyme Commission Number: EC 7.5.2.1 (Formerly EC 3.6.3.19). Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4655; maltose-transporting ATPase; EC 3.6.3.19. Cat No: EXWM-4655. | |
| Maltosine | Maltosine. Group: Biochemicals. Alternative Names: (a-S)-a-Amino-3-hydroxy-2-methyl-4-oxo-1(4H)-pyridinehexanoic acid; (S)-a-amino-3-hydroxy-2-methyl-4-oxo-1(4H)-pyridinehexanoic acid. Grades: Highly Purified. CAS No. 121502-04-3. Pack Sizes: 10g. Molecular Formula: C12H18N2O4. US Biological Life Sciences. |  Worldwide |
| Maltosyl-ascorbic acid | | |
| Maltosyl trehalose | Maltosyl trehalose is a groundbreaking compound extensively employed in the biomedical sector, aiding in studying neurological afflictions like Alzheimer's disease. This compound exhibits noteworthy neuroprotective properties that can curb neuronal impairment. CAS No. 25545-20-4. Molecular formula: C24H42O21. Mole weight: 666.58. | |
| Maltotetradecaose | Maltotetradecaose is a long branched chain of Maltose units, molecules which arecommonly found in foods and commonly utilized in brewing processes. Synonyms: O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-D-Glucose. CAS No. 107882-52-0. Molecular formula: C84H142O71. Mole weight: 2287.98. | |
| Maltotetraitol | Maltotetraitol is a valuable compound aiding in studying various diseases such as diabetes and obesity. Its multifunctional nature enables it to enhance drug delivery systems, improve the stability of formulations and serve as an excipient in pharmaceutical preparations. Synonyms: a-D-glucopyranosyl-(1-4)-a-D-glucopyranosyl-(1-4)-a-D-glucopyranosyl-(1-4)-D-glucitol. CAS No. 66767-99-5. Molecular formula: C24H44O21. Mole weight: 668.59. | |
| Maltotetraose | Maltotetraose is a resplendent biomedical compound, used for studying diabetes, orchestrating commendable blood glucose regulation. Synonyms: O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-D-Glucose; Amylotetraose; α-1,4-Tetraglucose; a-D-Glucopyranosyl-1,4-O-a-D-glucopyranosyl-1,4-O-a-D-glucopyranosyl-1,4-D-glucopyranose; D-maltotetraose. Grades: ≥95%. CAS No. 34612-38-9. Molecular formula: C24H42O21. Mole weight: 666.58. | |
| Maltotetraose | Maltotetraose can serve as a substrate for enzyme-linked assays to measure amylase activity in biological fluids. Maltotetraose has oral active, and reduces TNF-α -induced inflammatory responses by inhibiting NF-κB activity and decreasing ICAM-1 expression. Maltotetraose also inhibits PDGF -induced vascular smooth muscle cell migration and neovascularization. Additionally, Maltotetraose derivatives can function as probes for detecting bacterial infections by targeting the maltodextrin transporter. With good long-term safety, Maltotetraose holds promise for research in atherosclerosis-related diseases [1] [2] [3] [4]. Uses: Scientific research. Group: Natural products. Alternative Names: Amylotetraose; Fujioligo 450; α-1,4-Tetraglucose. CAS No. 34612-38-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-N2464. | |
| Maltotetraose 2-aminobenzamide | Maltotetraose 2-aminobenzamide is a diagnostic compound widely used in the biomedical industry. It aids in the identification and analysis of various drugs and diseases. This product plays a crucial role in chemical research and drug discovery by providing accurate data on drug interactions, target identification and molecular mechanisms. Synonyms: Maltotetraose 2-AB. | |
| Maltotetraose-APD-HSA | | |
| Maltotetraose Deuterated | Maltotetraose Deuterated is an unlabelled form of Maltotetraose. Maltotetraose is a maltooligosaccharide that is used for research and diagnostic purposes. They can also be used in nutrients and healthcare. Uses: Sweetening agents. Synonyms: O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-D-Glucose; Amylotetraose; α-1,4-Tetraglucose Deuterated. Grades: 95%. Molecular formula: C24H42O21. Mole weight: 666.58. | |
| Maltotetraosyl-b-cyclodextrin | | |
| Maltotridecaose | Maltotridecaose is a long branched chain of Maltose units, molecules which arecommonly found in foods and commonly utilized in brewing processes. Synonyms: O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-. CAS No. 100307-91-3. Molecular formula: C78H132O66. Mole weight: 2125.84. | |
| Maltotriitol | Maltotriitol. Uses: For analytical and research use. Group: Impurity standards. CAS No. 32860-62-1. Molecular Formula: C18H34O16. Mole Weight: 506.45. Catalog: APB32860621. | |
| Maltotriitol | Maltotriitol is a biomedical product used for the research of various digestive disorders and intestinal dysfunctions like irritable bowel syndrome, Crohn's disease and ulcerative colitis. Maltotriitol usually acts as a prebiotic. Synonyms: a-D-Glucopyranosyl-a-1,4-O-a-D-glucopyranosyl-1,4-D-glucitol. CAS No. 32860-62-1. Molecular formula: C18H34O16. Mole weight: 506.45. | |
| Maltotriose | It is a trisaccharide produced by the digestion of α-maltose enzyme. Synonyms: a-1,4-Glucotriose; O-α-D-Glucopyranosyl-(1->4)-O-α-D-glucopyranosyl-(1->4)-D-glucose; Amylotriose; NSC 170180; Triomaltose; D-Maltotriose; alpha-D-Glc-(1->4)-alpha-D-Glc-(1->4)-D-Glc. Grades: ≥98%. CAS No. 1109-28-0. Molecular formula: C18H32O16. Mole weight: 504.44. | |
| Maltotriose | Maltotriose is a trisaccharide (three-part sugar) consisting of three glucose molecules linked with α-1,4 glycosidic bonds.It is most commonly produced by the digestive enzyme alpha-amylase (a common enzyme in human saliva) on amylose in starch. The creation of both maltotriose and maltose during this process is due to the random manner in which alpha amylase hydrolyses α-1,4 glycosidic bonds.It is the shortest chain oligosaccharide that can be classified as maltodextrin. Group: Polysaccharide. Alternative Names: 4-O-[4-O-(α-D-Glucopyranosyl)-α-D-glucopyranosyl]-D-glucose. CAS No. 1109-28-0. Product ID: (2R,3R,4S,5S,6R)-2-[(2R,3S,4R,5R,6R)-4,5-Dihydroxy-2-(hydroxymethyl)-6-[(2R,3S,4R,5R)-4,5,6-trihydroxy-2-(hydroxymethyl)oxan-3-yl]oxyoxan-3-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol. Molecular formula: 504.44. Mole weight: C18H32O16. C (C1C (C (C (C (O1)OC2C (OC (C (C2O)O)OC3C (OC (C (C3O)O)O)CO)CO)O)O)O)O. InChI=1S/C18H32O16/c19-1-4-7 (22)8 (23)12 (27)17 (31-4)34-15-6 (3-21)32-18 (13 (28)10 (15)25)33-14-5 (2-20)30-16 (29)11 (26)9 (14)24/h4-29H, 1-3H2/t4-, 5-, 6-, 7-, 8+, 9-, 10-, 11-, 12-, 13-, 14-, 15-, 16?, 17-, 18-/m1/s1. FYGDTMLNYKFZSV-DZOUCCHMSA-N. 98%. |  |
| Maltotriose | Maltotriose, the second most abundant sugar present in brewing, is an inducer of the maltose regulon of Escherichia coli. Maltotriose can induce beta-galactosidase synthesis [1] [2]. Uses: Scientific research. Group: Natural products. CAS No. 1109-28-0. Pack Sizes: 10 mM * 1 mL; 100 mg. Product ID: HY-113011. | |
| Maltotriose | Maltotriose is a trisaccharide (three-part sugar) consisting of three glucose molecules linked with α-1,4 glycosidic bonds.It is most commonly produced by the digestive enzyme alpha-amylase (a common enzyme in human saliva) on amylose in starch. The creation of both maltotriose and maltose during this process is due to the random manner in which alpha amylase hydrolyses α-1,4 glycosidic bonds.It is the shortest chain oligosaccharide that can be classified as maltodextrin. Group: Heterocyclic organic compound. Alternative Names: 4-O-[4-O-(α-D-Glucopyranosyl)-α-D-glucopyranosyl]-D-glucose. CAS No. 1109-28-0. Molecular formula: C18H32O16. Mole weight: 504.44. Appearance: White to off-white powder. Purity: 0.98. IUPACName: (2R,3R,4S,5S,6R)-2-[(2R,3S,4R,5R,6R)-4,5-Dihydroxy-2-(hydroxymethyl)-6-[(2R,3S,4R,5R)-4,5,6-trihydroxy-2-(hydroxymethyl)oxan-3-yl]oxyoxan-3-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol. Canonical SMILES: C (C1C (C (C (C (O1)OC2C (OC (C (C2O)O)OC3C (OC (C (C3O)O)O)CO)CO)O)O)O)O. Density: 1.4403 g/cm³. ECNumber: 214-174-2;232-945-1. Catalog: ACM1109280. |  |
| Maltotriose monohydrate | Maltotriose monohydrate is a specialized compound used in the research of glycogen storage diseases and diabetes-related complications. It acts as a glucose-releasing compound is assisting in the controlled delivery of glucose. Synonyms: Maltotriose xhydrate; Maltotriose hydrate, 95%; MALTOTRIOSE HYDRATE 95; (2R,3R,4S,5S,6R)-2-[(2R,3S,4R,5R,6R)-4,5-dihydroxy-2-(hydroxymethyl)-6-[(2R,3S,4R,5R)-4,5,6-trihydroxy-2-(hydroxymethyl)oxan-3-yl]oxyoxan-3-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol; hydrate; (3R,4R,5S,6R)-5-(((2R,3R,4R,5S,6R)-3,4-Dihydroxy-6-(hydroxymethyl)-5-(((2R,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-2-yl)oxy)tetrahydro-2H-pyran-2-yl)oxy)-6-(hydroxymethyl)tetrahydro-2H-pyran-2,3,4-triol hydrate; D-(+)-Maltotriose hydrate; Maltotriose hydrate,95%; alpha-D-Glucopyranosyl-(1->4)-alpha-D-glucopyranosyl-(1->4)-D-glucopyranose--water (1/1); O-alpha-D-Glucopyranosyl-(1->4)-O-alpha-D-glucopyranosyl-(1->4)-O-alpha-D-glucose; D-Glucose, O-alpha-D-glucopyranosyl-(1-->4)-O-alpha-D-glucopyranosyl-(1-->4)-, hydrate (9CI). CAS No. 207511-08-8. Molecular formula: C18H32O16 H2O. Mole weight: 522.45. | |
| Maltotriose - Technical | Maltotriose - Technical is an intricate carbohydrate compound, exhibiting paramount significance in the biomedical realm due to its multi-faceted and manifold applications in the spheres of molecular biology research and drug delivery systems. Esteemed for its exceptional attributes, it serves as an efficacious substrate for enzyme assays while also acting as a proficient and sophisticated complexing compound for specific pharmaceutical compounds. Consequently, its distinctive and unparalleled properties render it highly suitable for a diverse array of drug formulations devised to study formidable maladies including diabetes and obesity. Molecular formula: C18H32O16. Mole weight: 504.44. | |
| Maltotriosyltrehalose | Maltotriosyltrehalose is a compound product used in the research of diabetes and metabolic disorders. Derived from maltose, it possesses potential antioxidant and anti-inflammatory properties. Synonyms: Maltotriosyltrehalose; 5HKU557F95; 142831-49-0; UNII-5HKU557F95; alpha-D-Glucopyranoside, alpha-D-glucopyranosyl o-alpha-D-glucopyranosyl-(1->4)-o-alpha-D-glucopyranosyl-(1->4)-o-alpha-D-glucopyranosyl-(1->4)-; Q27262207.ALPHA.-D-GLUCOPYRANOSIDE. ALPHA.-D-GLUCOPYRANOSYL O-.ALPHA.-D-GLUCOPYRANOSYL-(1->4)-O-.ALPHA.-D-GLUCOPYRANOSYL-(1->4)-O-.ALPHA.-D-GLUCOPYRANOSYL-(1->4)-. CAS No. 142831-49-0. Molecular formula: C20H52O26. Mole weight: 708.61. | |
| Maltoundecaose | Maltoundecaose, an eminent biomedical product, acclaimed for its efficaciousness in tackling an array of ailments, epitomizes the pinnacle of scientific advancement. Its utilization as a robust adjunctive therapeutic agent in diabetes management stems from its unparalleled potential to meticulously regulate blood glucose levels. Furthermore, the extraordinary implications of maltoundecaose extend to the formidable combat against cardiovascular maladies and the relentless battle against cancer. Synonyms: Maltoundecose; Maltoundecaose; 50270-86-5; E87155. Molecular formula: C66H112O56. Mole weight: 1801.6. | |
| Maltoundecose | Maltoundecose is a long branched chain of Maltose units, molecules which arecommonly found in foods and commonly utilized in brewing processes. Synonyms: O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-D-Glucose. CAS No. 50270-86-5. Molecular formula: C66H112O56. Mole weight: 1801.56. | |
| Maltulose H2O | Maltulose H2O is a cutting-edge compound, aiding in studying both obesity and diabetes. To revolutionize the development of conventional sweeteners, Maltulose H2O materializes as an indispensable instrument in the meticulous research of these intricate conditions. Synonyms: Maltulose monohydrate. Grades: >98.0%(GC). CAS No. 17606-72-3. Molecular formula: C12H20O10·H2O. Mole weight: 360.32. | |
| Maltulose monohydrate | Maltulose monohydrate is a naturally occurring disaccharide widely utilized in the biomedical sector, used for the research of diabetes and obesity. Synonyms: 4-O-a-D-Glucopyranosyl-D-fructose monohydrate. CAS No. 207511-09-9. Molecular formula: C12H22O11 H2O. Mole weight: 360.32. | |
| Maltulose monohydrate | Maltulose monohydrate (4-O-α-D-Glucopyranosyl-D-fructose monohydrate) can be used as an energy source for bacteria. Maltulose monohydrate is a biomaterial or organic compound that can be used in life science research [1]. Uses: Scientific research. Group: Biochemical assay reagents. Alternative Names: 4-O-α-D-Glucopyranosyl-D-fructose monohydrate. CAS No. 207511-09-9. Pack Sizes: 50 mg; 100 mg. Product ID: HY-W415909. | |
| Malvidin 3,5-diglucoside | Malvidin 3,5-diglucoside is a significant compound present in diverse fruits and vegetables, exhibiting remarkable antioxidant attributes and has been subject to extensive investigation regarding its prospective role in averting chronic ailments such as cancer, cardiovascular diseases and neurodegenerative disorders. Synonyms: Malvoside; Malvidin chloride 3,5-diglucoside; Malvin(chloride). CAS No. 16727-30-3. Molecular formula: C29H35O17Cl. Mole weight: 691.03. | |
| Malvidin-3-galactoside chloride | Malvidin-3-galactoside chloride is a profoundly influential compound widely employed in the biomedical industry due to its immense therapeutic potential. With well-established acclaim for its formidable antioxidant prowess and remarkable anti-inflammatory attributes, this product showcases exceptional efficacy in combating an extensive range of afflictions including cancer, cardiovascular disorders, and neurodegenerative conditions. Synonyms: Primulin. CAS No. 30113-37-2. Molecular formula: C23H25ClO12. Mole weight: 528.9. | |
| Malvidin-3-galactoside chloride | Malvidin-3-galactoside chloride, an anthocyanin monomer, induces hepatocellular carcinoma (HCC) cells cycle arrest and apoptosis. Malvidin-3-galactoside chloride inhibits the production and accumulation of ROS. Malvidin-3-galactoside chloride has anti-tumor function [1]. Uses: Scientific research. Group: Natural products. CAS No. 30113-37-2. Pack Sizes: 1 mg; 5 mg. Product ID: HY-N6623. | |
| Malvidin 3-glucoside | Cas No. 7228-78-6. | |
| Malvidin-3-glucoside chloride | Malvidin-3-glucoside chloride (Malvidin-3-O-glucoside chloride), a major wine anthocyanin, is effective in promoting resilience against stress by modulating brain synaptic plasticity and peripheral inflammation [1]. Uses: Scientific research. Group: Natural products. Alternative Names: Malvidin-3-O-glucoside chloride; Oenin chloride. CAS No. 7228-78-6. Pack Sizes: 1 mg; 5 mg. Product ID: HY-125740. | |
| Malvidin-3-O-arabinoside chloride | Malvidin-3-O-arabinoside chloride is found in the fruits of Vaccinium myrtillus, it shows antioxidant activity.It has potential preventive effect in colorectal diseases. Synonyms: Malvidin 3-arabinoside. Grades: > 95%. CAS No. 28500-04-1. Molecular formula: C22H23ClO11. Mole weight: 498.87. | |
| Malvidin chloride | Malvidin (chloride) is a bioactive compound isolated from grape. Malvidin shows cytotoxicity through the arrest of the G 2 /M phase of cell cycle and induction of apoptosis. Malvidin can be used for the research of cancer [1]. Uses: Scientific research. Group: Natural products. Alternative Names: Syringidin. CAS No. 643-84-5. Pack Sizes: 5 mg; 10 mg. Product ID: HY-122496. | |
| malyl-CoA lyase | The enzyme from the bacterium Chloroflexus aurantiacus, which participates in the 3-hydroxypropanoate cycle for carbon assimilation, also has the activity of EC 4.1.3.25, (3S)-citramalyl-CoA lyase. The enzymes from Rhodobacter species are part of acetate assimilation pathways. The reactions are reversible. Group: Enzymes. Synonyms: malyl-coenzyme A lyase; (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase; mclA (gene name); mcl1 (gene name); (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase (acetyl-CoA-forming); L-malyl-CoA lyase. Enzyme Commission Number: EC 4.1.3.24. CAS No. 37290-67-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4904; malyl-CoA lyase; EC 4.1.3.24; 37290-67-8; malyl-coenzyme A lyase; (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase; mclA (gene name); mcl1 (gene name); (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase (acetyl-CoA-forming); L-malyl-CoA lyase. Cat No: EXWM-4904. | |
| Mambalgin 1 | Mambalgin 1, a toxin isolated from black mamba venom, is a disulfide-rich polypeptide consisting of 57 amino acids and belongs to the family of three-finger toxins. Mambalgin 1 is a selective ASIC1a inhibitor (IC50= 192 and 72 nM for human ASIC1a and ASIC1a/1b dimer, respectively), and binds to closed/inactive channel. Synonyms: LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQG CSSSCSETENNKCCSTDRCNK. Grades: >98%. CAS No. 1609937-15-6. Molecular formula: C272H429N85O84S10. Mole weight: 6554.51. | |
| m-Aminobenzoic acid | m-Aminobenzoic acid. CAS No: 99-05-8 |  Sarchem Laboratories New Jersey NJ |
| m-Aminophenylboronic acid-Agarose | m-Aminophenylboronic acid-Agarose. Group: Salt. | |
| Mammaglobin-A (23-31) | Mammaglobin-A (23-31) is a truncated fragment of Mammaglobin-A. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
| Mammaglobin-A precursor (2-10) | A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
| Mammaglobin-A precursor (32-40) | A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
| Mammaglobin-A precursor (4-12) | A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
| Mammaglobin-A precursor (66-74) | A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
| Mammaglobin-A precursor (83-92) | A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
| Man-1 | Man-1 is an impressive and discerning small molecule inhibitor, used in the research of acute myeloid leukemia (AML). This remarkable compound diligently focuses its efforts on MLL1, an oncogenic enzyme of paramount importance in the context of leukemogenesis. Molecular formula: C22H38N2O16. Mole weight: 586.54. | |
| Man-1-F N-Glycan | Man-1-F N-Glycan is a pivotal compound used in the research of peculiar glycosylation aberrations, namely congenital disorders of glycosylation. Synonyms: Oligomannose-1 core fucosylated; Man-1-Fuc; Manb1-4GlcNAcb1-4(Fuca1-6)GlcNAc. CAS No. 79300-36-0. Molecular formula: C28H48N2O20. Mole weight: 732.68. | |
| Man-1-Fuc | Man-1-Fuc is a potent inhibitor of fucose biosynthesis, primarily used in biomedical research. It hinders the biosynthesis of fucose-containing oligosaccharides, inhibiting the creation of cell surface glycoconjugates. Its usage often involves studying diseases related to abnormal fucosylation, including cancer, inflammation and congenital disorders. Synonyms: Oligomannose-1 fucose; Man-1-F; Manβ1-4GlcNAcβ1-4(Fucα1-6)GlcNAc. Molecular formula: C28H48N2O20. Mole weight: 732.68. | |
| Man-1 N-Glycan | Man-1 N-Glycan is a fundamental and indispensable compound assuming a paramount significance when it comes to studying diverse ailments, most notably cancer. Serving as a potent tool, its principal utility resides in the comprehensive scrutiny and subsequent modification of N-glycan structures, thereby facilitating an intricate comprehension of the intricacies inherent in glycosylation mechanisms operative within cellular frameworks. Synonyms: Oligomannose-1; Man-1; Man(b,1-4)GlcNAc(b,1-4)GlcNAc; O-beta-D-Mannopyranosyl-(1-4)-O-2-(acetylamino)-2-deoxy-beta-D-glucopyranosyl-(1-4)-2-(acetylamino)-2-deoxy-alpha-D-glucopyranose. Grades: ≥95%. CAS No. 159266-34-9. Molecular formula: C22H38N2O16. Mole weight: 586.54. | |
Our database is helping our users find suppliers everyday.
