A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| maltose 6'-phosphate phosphatase | The enzyme from the bacterium Enterococcus faecalis also has activity with the sucrose isomer turanose 6'-phosphate (α-D-glucopyranosyl-(1?3)-D-fructose 6-phosphate). Group: Enzymes. Synonyms: maltose 6'-P phosphatase; mapP (gene name). Enzyme Commission Number: EC 3.1.3.90. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3697; maltose 6'-phosphate phosphatase; EC 3.1.3.90; maltose 6'-P phosphatase; mapP (gene name). Cat No: EXWM-3697. |  |
| maltose α-D-glucosyltransferase | This enzyme belongs to the family of isomerases, specifically those intramolecular transferases transferring other groups. This enzyme participates in starch and sucrose metabolism. Group: Enzymes. Synonyms: trehalose synthase; maltose glucosylmutase. Enzyme Commission Number: EC 5.4.99.16. CAS No. 395644-91-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5555; maltose α-D-glucosyltransferase; EC 5.4.99.16; 395644-91-4; trehalose synthase; maltose glucosylmutase. Cat No: EXWM-5555. | |
| Maltose Alpha-D-Glucosyltransferase (Crude Enzyme) | This enzyme belongs to the family of isomerases, specifically those intramolecular transferases transferring other groups. This product with the indicated enzyme activity was briefly purified from engineered E.coli. Applications: Synthesis; medicine. Group: Enzymes. Synonyms: trehalose synthase; maltose glucosylmutase. Enzyme Commission Number: EC 5.4.99.16. CAS No. 147994-22-7. Activity: Undetermined. Appearance: Clear to translucent yellow solution. Storage: at -20 °C or lower, for at least 1 month. Source: E. coli. trehalose synthase; maltose glucosylmutase. Pack: 100ml. Cat No: NATE-1858. | |
| Maltose alternan oligosaccharide | Maltose alternan oligosaccharide is a biomedical product used to study various health condition such as diabetes. Additionally, research suggests that it may have antioxidant and anti-inflammatory properties, making it useful in studying oxidative stress-related diseases. Alternative Names: MAOS. |  |
| maltose epimerase | The enzyme catalyses the interconversion of α and β anomers of maltose more effectively than those of disaccharides such as lactose and cellobiose. Group: Enzymes. Enzyme Commission Number: EC 5.1.3.21. CAS No. 166799-98-0. MER. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5407; maltose epimerase; EC 5.1.3.21; 166799-98-0. Cat No: EXWM-5407. | |
| maltose O-acetyltransferase | Not identical with EC 2.3.1.18, galactoside O-acetyltransferase. The acetyl group is added exclusively to the C6 position of glucose and to the C6 position of the non-reducing glucose residue of maltose. Other substrates of this enzyme are glucose, which is a better substrate than maltose, and mannose and frucose, which are poorer substrates than maltose. Isopropyl-β-thio-galactose, which is a good substrate for EC 2.3.1.118 is a poor substrate for this enzyme. Group: Enzymes. Synonyms: maltose transacetylase; maltose O-acetyltransferase; MAT. Enzyme Commission Number: EC 2.3.1.79. CAS No. 81295-47-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2259; maltose O-acetyltransferase; EC 2.3.1.79; 81295-47-8; maltose transacetylase; maltose O-acetyltransferase; MAT. Cat No: EXWM-2259. | |
| Maltose octaacetate | Maltose octaacetate. Alternative Names: D-Glucopyranose, 4-O-(2,3,4,6-tetra-O-acetyl-α-D-glucopyranosyl)-, 1,2,3,6-tetraacetate; D-Maltose octaacetate; D-Glucopyranose, 4-O-(2,3,4,6-tetra-O-acetyl-α-D-glucopyranosyl)-, tetraacetate; Maltose, octaacetate; Maltose peracetate; Octa-O-acetyl-D-maltose; 1,2,2',3,3',4',6,6'-Octa-O-acetyl-D-maltose; 4-O-(2,3,4,6-Tetra-O-acetyl-α-D-glucopyranosyl)-D-glucopyranose 1,2,3,6-tetraacetate. Grades: ≥98%. CAS No. 20880-60-8. Molecular formula: C28H38O19. Mole weight: 678.59. | |
| maltose phosphorylase | This enzyme belongs to the family of glycosyltransferases, specifically the hexosyltransferases. The systematic name of this enzyme class is maltose:phosphate 1-beta-D-glucosyltransferase. This enzyme participates in starch and sucrose metabolism. Group: Enzymes. Enzyme Commission Number: EC 2.4.1.8. CAS No. 9030-19-7. MP. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2620; maltose phosphorylase; EC 2.4.1.8; 9030-19-7. Cat No: EXWM-2620. | |
| Maltose Phosphorylase from E. coli, Recombinant | Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes maltose and inorganic phosphate into β-D-glucose-1-phosphate and glucose. Group: Enzymes. Synonyms: maltose phosphorylase; maltose:phosphate 1-β-D-glucosyltransferase; EC 2.4.1.8; 9030-19-7; MP. Enzyme Commission Number: EC 2.4.1.8. CAS No. 9030-19-7. MP. Mole weight: ca. 220 kDa. Activity: > 10 U/mg lyophilizate. Stability: Stability (liquid form) stable at 37°C for at least one week Stability (powder form) stable at 30°C for at least four weeks. Appearance: White lyophilizate. Storage: at -20°C. Source: E. coli. Species: E. coli. maltose phosphorylase; maltose:phosphate 1-β-D-glucosyltransferase; EC 2.4.1.8; 9030-19-7; MP. Cat No: NATE-1250. | |
| Maltose Phosphorylase from Enterococcus sp., Recombinant | Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes maltose and inorganic phosphate into β-D-glucose-1-phosphate and glucose. Maltose phosphorylase (mp) is a dimeric enzyme that catalyzes maltose and inorganic phosphate into β-d-glucose-1-phosphate and glucose. Applications: Maltose phosphorylase from enter oc occus has been used in a study to describe a new pathway for maltose utilization in lactic acid bacteria. it has also been used in a study to describe the transfer of glucosyl moiety of maltose to acceptors with alcoholic oh groups. Group: Enzymes. Synonyms: maltose phosphorylase; maltose:phosphate 1-β-D-glucosyltransferase; EC 2.4.1.8; 9030-19-7; MP. Enzyme Commission Number: EC 2.4.1.8. CAS No. 9030-19-7. MP. Mole weight: mol wt 90 kDa by SDS-PAGE. Storage: -20°C. Form: lyophilized powder. Source: E. coli. Species: Enterococcus sp. maltose phosphorylase; maltose:phosphate 1-β-D-glucosyltransferase; EC 2.4.1.8; 9030-19-7; MP. Cat No: NATE-0456. | |
| maltose synthase | Neither free phosphate nor maltose 1-phosphate is an intermediate in the reaction. Group: Enzymes. Enzyme Commission Number: EC 2.4.1.139. CAS No. 81669-74-1. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2364; maltose synthase; EC 2.4.1.139; 81669-74-1. Cat No: EXWM-2364. | |
| Maltose syrup | Maltose syrup is a traditional Chinese sweetener that has been used for centuries. It is a thick, viscous syrup that is commonly used in various culinary applications due to its unique properties. Maltose syrup is produced through the enzymatic hydrolysis of starch in germinating grains such as wheat, corn, and rice. It exists as a golden-colored syrup with a sweet taste, but it is only about 30-60% as sweet as sugar, depending on the concentration. The syrup has different concentration levels, with 60% or less being normal maltose syrup, and anything above being high-maltose. Maltose syrup is known for its high viscosity at room temperature, being ten times thicker than regular syrup, and it won't fall from the cup if turned upside down. | |
| maltose-transporting ATPase | ABC-type (ATP-binding cassette-type) ATPase, characterized by the presence of two similar ATP-binding domains. Does not undergo phosphorylation during the transport process. Comprises bacterial enzymes that import maltose and maltose oligosaccharides. Group: Enzymes. Enzyme Commission Number: EC 7.5.2.1 (Formerly EC 3.6.3.19). Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4655; maltose-transporting ATPase; EC 3.6.3.19. Cat No: EXWM-4655. | |
| Maltosine | Maltosine. Group: Biochemicals. Alternative Names: (a-S)-a-Amino-3-hydroxy-2-methyl-4-oxo-1(4H)-pyridinehexanoic acid; (S)-a-amino-3-hydroxy-2-methyl-4-oxo-1(4H)-pyridinehexanoic acid. Grades: Highly Purified. CAS No. 121502-04-3. Pack Sizes: 10g. Molecular Formula: C12H18N2O4. US Biological Life Sciences. |  Worldwide |
| Maltosyl-ascorbic acid | Maltosyl-ascorbic acid. | |
| Maltosyl trehalose | Maltosyl trehalose is a groundbreaking compound extensively employed in the biomedical sector, aiding in studying neurological afflictions like Alzheimer's disease. This compound exhibits noteworthy neuroprotective properties that can curb neuronal impairment. Alternative Names: Glucopyranoside, O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-α-D-glucopyranosyl, α-D-; α-D-Glucopyranoside, O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-α-D-glucopyranosyl; α-D-Glucopyranosyl O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-α-D-glucopyranoside; Glc(a1-4)Glc(a1-4)Glc(a1-1a)Glc. CAS No. 25545-20-4. Molecular formula: C24H42O21. Mole weight: 666.58. | |
| Maltotetradecaose | Maltotetradecaose is a long branched chain of Maltose units, molecules which arecommonly found in foods and commonly utilized in brewing processes. Alternative Names: O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-D-Glucose; [O-α-D-Glucopyranosyl-(1→4)]13-D-glucose. CAS No. 107882-52-0. Molecular formula: C84H142O71. Mole weight: 2287.98. | |
| Maltotetraitol | Maltotetraitol is a valuable compound aiding in studying various diseases such as diabetes and obesity. Its multifunctional nature enables it to enhance drug delivery systems, improve the stability of formulations and serve as an excipient in pharmaceutical preparations. Alternative Names: a-D-glucopyranosyl-(1-4)-a-D-glucopyranosyl-(1-4)-a-D-glucopyranosyl-(1-4)-D-glucitol; O-α-D-Glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-D-glucitol; Maltotetratol. CAS No. 66767-99-5. Molecular formula: C24H44O21. Mole weight: 668.59. | |
| Maltotetraose | Maltotetraose can serve as a substrate for enzyme-linked assays to measure amylase activity in biological fluids. Maltotetraose has oral active, and reduces TNF-α-induced inflammatory responses by inhibiting NF-κB activity and decreasing ICAM-1 expression. Maltotetraose also inhibits PDGF-induced vascular smooth muscle cell migration and neovascularization. Additionally, Maltotetraose derivatives can function as probes for detecting bacterial infections by targeting the maltodextrin transporter. With good long-term safety, Maltotetraose holds promise for research in atherosclerosis-related diseases[1][2][3][4]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Amylotetraose; Fujioligo 450; α-1,4-Tetraglucose. CAS No. 34612-38-9. Pack Sizes: 10 mM * 1 mL in Water; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-N2464. |  |
| Maltotetraose | Maltotetraose is a resplendent biomedical compound, used for studying diabetes, orchestrating commendable blood glucose regulation. Alternative Names: O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-D-Glucose; Amylotetraose; α-1,4-Tetraglucose; a-D-Glucopyranosyl-1,4-O-a-D-glucopyranosyl-1,4-O-a-D-glucopyranosyl-1,4-D-glucopyranose; D-maltotetraose; α-1,4-Tetraglucose; Glc(a1-4)Glc(a1-4)Glc(a1-4)aldehydo-Glc. Grades: ≥95%. CAS No. 34612-38-9. Molecular formula: C24H42O21. Mole weight: 666.58. | |
| Maltotetraose 2-aminobenzamide | Maltotetraose 2-aminobenzamide is a diagnostic compound widely used in the biomedical industry. It aids in the identification and analysis of various drugs and diseases. This product plays a crucial role in chemical research and drug discovery by providing accurate data on drug interactions, target identification and molecular mechanisms. Alternative Names: Maltotetraose 2-AB; O-α-D-Glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-α-D-glucopyranose 2-aminobenzamide; α-D-Maltotetraose 2-aminobenzamide. | |
| Maltotetraose-APD-HSA | Maltotetraose-APD-HSA. | |
| Maltotetraosyl-b-cyclodextrin | Maltotetraosyl-b-cyclodextrin. | |
| Maltotridecaose | Maltotridecaose is a long branched chain of Maltose units, molecules which arecommonly found in foods and commonly utilized in brewing processes. Alternative Names: O-α-D-Glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-D-glucose; [O-α-D-Glucopyranosyl-(1→4)]12-D-glucose. CAS No. 100307-91-3. Molecular formula: C78H132O66. Mole weight: 2125.84. | |
| Maltotriitol | Maltotriitol is a biomedical product used for the research of various digestive disorders and intestinal dysfunctions like irritable bowel syndrome, Crohn's disease and ulcerative colitis. Maltotriitol usually acts as a prebiotic. Alternative Names: a-D-Glucopyranosyl-a-1,4-O-a-D-glucopyranosyl-1,4-D-glucitol; Glucitol, O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-, D-; O-α-D-Glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-D-glucitol. CAS No. 32860-62-1. Molecular formula: C18H34O16. Mole weight: 506.45. | |
| Maltotriitol | Maltotriitol is a biochemical reagent that can be used as a biological material or organic compound for life science related research. Uses: Scientific research. Category: Signaling pathways. CAS No. 32860-62-1. Pack Sizes: 10 mM * 1 mL in Water; 10 mg; 25 mg. Product ID: HY-136656. | |
| Maltotriose | Maltotriose is a maltooligosaccharide and a specific inducer of the Escherichia coli maltose operon. The oligosaccharide structure of Maltotriose acts as a highly efficient drug delivery carrier, which significantly enhances the targeting ability and water solubility of photosensitizers in photodynamic therapy for pancreatic cancer[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1109-28-0. Pack Sizes: 10 mM * 1 mL in Water; 100 mg; 500 mg; 1 g; 5 g. Product ID: HY-113011. | |
| Maltotriose | It is a trisaccharide produced by the digestion of α-maltose enzyme. Alternative Names: a-1,4-Glucotriose; O-α-D-Glucopyranosyl-(1->4)-O-α-D-glucopyranosyl-(1->4)-D-glucose; Amylotriose; NSC 170180; Triomaltose; D-Maltotriose; alpha-D-Glc-(1->4)-alpha-D-Glc-(1->4)-D-Glc; D-(+)-Maltotriose; Glc(a1-4)Glc(a1-4)aldehydo-Glc. Grades: ≥98%. CAS No. 1109-28-0. Molecular formula: C18H32O16. Mole weight: 504.44. | |
| Maltotriose | Maltotriose is a trisaccharide (three-part sugar) consisting of three glucose molecules linked with α-1,4 glycosidic bonds.It is most commonly produced by the digestive enzyme alpha-amylase (a common enzyme in human saliva) on amylose in starch. The creation of both maltotriose and maltose during this process is due to the random manner in which alpha amylase hydrolyses α-1,4 glycosidic bonds.It is the shortest chain oligosaccharide that can be classified as maltodextrin. Alternative Names: 4-O-[4-O-(α-D-Glucopyranosyl)-α-D-glucopyranosyl]-D-glucose. CAS No. 1109-28-0. Molecular formula: C18H32O16. Mole weight: 504.44. Purity: 98%. IUPAC Name: (2R,3R,4S,5S,6R)-2-[(2R,3S,4R,5R,6R)-4,5-Dihydroxy-2-(hydroxymethyl)-6-[(2R,3S,4R,5R)-4,5,6-trihydroxy-2-(hydroxymethyl)oxan-3-yl]oxyoxan-3-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol. SMILES: C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O. InChI: InChI=1S/C18H32O16/c19-1-4-7(22)8(23)12(27)17(31-4)34-15-6(3-21)32-18(13(28)10(15)25)33-14-5(2-20)30-16(29)11(26)9(14)24/h4-29H,1-3H2/t4-,5-,6-,7-,8+,9-,10-,11-,12-,13-,14-,15-,16?,17-,18-/m1/s1. |  |
| Maltotriose hydrate | Maltotriose hydrate is a specialized compound used in the research of glycogen storage diseases and diabetes-related complications. It acts as a glucose-releasing compound to help control glucose delivery. Alternative Names: D-Glucose, O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-, hydrate; Maltotriose x-hydrate; O-α-D-Glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-D-glucose hydrate; D-Maltotriose hydrate; Amylotriose hydrate; NSC 170180 hydrate; Triomaltose hydrate. CAS No. 207511-08-8. Molecular formula: C18H32O16.xH2O. Mole weight: 504.44 (anydrous basis). | |
| Maltotriose Hydrate | Maltotriose Hydrate. Alternative Names: D-(+)-Maltotriose Hydrate. CAS No. 207511-08-8. Purity: 95%. Product ID: ACM207511088. Molecular formula: C18H34O17. Mole weight: 522.50. Alfa Chemistry - ISO 9001:32057 Certified. |  |
| Maltotriose peracetate | Maltotriose peracetate is a biomedical product serving as an important intermediate in the synthesis of various drugs, particularly those targeting diseases like diabetes, cancer and cardiovascular disorders. Alternative Names: D-Glucose, O-2,3,4,6-tetra-O-acetyl-α-D-glucopyranosyl-(1→4)-O-2,3,6-tri-O-acetyl-α-D-glucopyranosyl-(1→4)-, 2,3,5,6-tetraacetate; Maltotriose undecaacetate; O-2,3,4,6-Tetra-O-acetyl-α-D-glucopyranosyl-(1→4)-O-2,3,6-tri-O-acetyl-α-D-glucopyranosyl-(1→4)-D-glucose 2,3,5,6-Tetraacetate; D-Maltotriose undecaacetate; (2R,3R,4S,5R)-3-(((2R,3R,4S,5R,6R)-3,4-Diacetoxy-6-(acetoxymethyl)-5-(((2R,3R,4S,5R,6R)-3,4,5-triacetoxy-6-(acetoxymethyl)tetrahydro-2H-pyran-2-yl)oxy)tetrahydro-2H-pyran-2-yl)oxy)-6-oxohexane-1,2,4,5-tetrayl tetraacetate. Grades: ≥95%. CAS No. 93911-20-7. Molecular formula: C40H54O27. Mole weight: 966.84. | |
| Maltotriose-[UL-13C18] Hydrate | Maltotriose-[UL-13C18] Hydrate. Alternative Names: [UL-13C18]Maltotriose hydrate; [UL-13C6]Glc(a1-4)[UL-13C6]Glc(a1-4)[UL-13C6]Glc hydrate. Molecular formula: [13C]18H32O16·(H2O)x. Mole weight: 522.30 (anydrous basis). | |
| Maltotriosyltrehalose | Maltotriosyltrehalose is a compound product used in the research of diabetes and metabolic disorders. Derived from maltose, it possesses potential antioxidant and anti-inflammatory properties. Alternative Names: α-D-Glucopyranosyl O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-α-D-glucopyranoside; (2R,3R,4S,5S,6R)-2-(((2R,3S,4R,5R,6R)-6-(((2R,3S,4R,5R,6R)-6-(((2R,3S,4R,5R,6R)-4,5-Dihydroxy-2-(hydroxymethyl)-6-(((2R,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-2-yl)oxy)tetrahydro-2H-pyran-3-yl)oxy)-4,5-dihydroxy-2-(hydroxymethyl)tetrahydro-2H-pyran-3-yl)oxy)-4,5-dihydroxy-2-(hydroxymethyl)tetrahydro-2H-pyran-3-yl)oxy)-6-(hydroxymethyl)tetrahydro-2H-pyran-3,4,5-triol. CAS No. 142831-49-0. Molecular formula: C30H52O26. Mole weight: 828.72. | |
| Maltoundecose | Maltoundecose is a long branched chain of Maltose units, molecules which are commonly found in foods and commonly utilized in brewing processes. Alternative Names: O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-O-α-D-glucopyranosyl-(1→4)-D-Glucose; Maltoundecaose; [O-α-D-Glucopyranosyl-(1→4)]10-D-glucose. CAS No. 50270-86-5. Molecular formula: C66H112O56. Mole weight: 1801.56. | |
| Maltulose | Maltulose is a cutting-edge compound, aiding in studying both obesity and diabetes. To revolutionize the development of conventional sweeteners, Maltulose materializes as an indispensable instrument in the meticulous research of these intricate conditions. Alternative Names: 4-O-α-D-Glucopyranosyl-D-fructose; Fructose, 4-O-α-D-glucopyranosyl-, D-; Glc(a1-4)keto-Fru; (3S,4R,5R)-1,3,5,6-Tetrahydroxy-4-(((2R,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-2-yl)oxy)hexan-2-one. Grades: >98% by GC. CAS No. 17606-72-3. Molecular formula: C12H22O11. Mole weight: 342.30. | |
| Maltulose monohydrate | Maltulose monohydrate is a naturally occurring disaccharide widely utilized in the biomedical sector, used for the research of diabetes and obesity. Alternative Names: 4-O-a-D-Glucopyranosyl-D-fructose monohydrate; D-Fructose, 4-O-α-D-glucopyranosyl-, monohydrate; 4-O-α-D-Glucopyranosyl-D-fructose hydrate. CAS No. 207511-09-9. Molecular formula: C12H22O11.H2O. Mole weight: 360.32. | |
| Mal-va-mac-SN38 | Mal-va-mac-SN38 is a drug-linker conjugate for ADC. Mal-va-mac-SN38 contains a ADC cytotoxin SN-38 (HY-13704) and a linker (HY-126364). Mal-va-mac-SN38 can rapidly and covalently bind with endogenous albumin in vivo, resulting in the formation of HSA-va-mac-SN38. Mal-va-mac-SN38 demonstrates exceptional stability in human plasma, and has anti-tumor and anti-metastasis effect[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2778229-31-3. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg. Product ID: HY-159563. | |
| Mal-VC-PAB-DM1 | Mal-VC-PAB-DM1 is a agent-linker conjugate for ADC with potent antitumor activity by using DM1 (a potent microtubule-disrupting agent), linked via the ADC linker Mal-VC-PAB [1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1464051-44-2. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-126682. | |
| Mal-VC-PAB-DMEA-PNU-159682 | Mal-VC-PAB-DMEA-PNU-159682 is a agent-linker conjugate for ADC with potent antitumor activity by using the anti-topoisomerase II agent, PNU-159682, linked via the lysosomally cleavable dipeptide, Mc-VC-PAB. Mal-VC-PAB-DMEA-PNU-159682 can be used in the synthesis of Anti-CD22-NMS249 (HY-164761)[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: SET0568. CAS No. 1178887-17-6. Pack Sizes: 5 mg; 10 mg; 25 mg. Product ID: HY-171138. | |
| Mal-VC-PAB-PNP | Mal-VC-PAB-PNP is a cleavable ADC linker. Mal-VC-PAB-PNP can be used in the synthesis of antibody-drug conjugates (ADCs)[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1096584-62-1. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-148461. | |
| Malvidin 3,5-diglucoside | Malvidin 3,5-diglucoside is a significant compound present in diverse fruits and vegetables, exhibiting remarkable antioxidant attributes and has been subject to extensive investigation regarding its prospective role in averting chronic ailments such as cancer, cardiovascular diseases and neurodegenerative disorders. Alternative Names: Malvoside; Malvidin chloride 3,5-diglucoside; Malvin(chloride). CAS No. 16727-30-3. Molecular formula: C29H35O17Cl. Mole weight: 691.03. | |
| Malvidin 3,5-diglucoside chloride | Malvidin 3,5-diglucoside chloride. Alternative Names: Malvin(chloride), Malvidin chloride 3,5-diglucoside, Malvidin-3,5-diglucoside, Malvoside. CAS No. 16727-30-3. Purity: >90.0%. Product ID: FFC-AR-16727303. Molecular formula: C29H35ClO17. Mole weight: 691.03. IUPAC Name: (2S,3R,4S,5S,6R)-2-[7-hydroxy-2-(4-hydroxy-3,5-dimethoxyphenyl)-3-[(2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxychromenylium-5-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol chloride. Alfa Chemistry - ISO 9001:32057 Certified. | |
| Malvidin-3-galactoside chloride | Malvidin-3-galactoside chloride. Alternative Names: Primulin. CAS No. 30113-37-2. Purity: >95.0%. Product ID: FFC-AR-30113372. Molecular formula: C23H25ClO12. Mole weight: 528.89. IUPAC Name: (2S,3R,4S,5R,6R)-2-[5,7-dihydroxy-2-(4-hydroxy-3,5-dimethoxyphenyl)chromenylium-3-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol chloride. Alfa Chemistry - ISO 9001:32057 Certified. | |
| Malvidin-3-galactoside chloride | Malvidin-3-galactoside chloride is a profoundly influential compound widely employed in the biomedical industry due to its immense therapeutic potential. With well-established acclaim for its formidable antioxidant prowess and remarkable anti-inflammatory attributes, this product showcases exceptional efficacy in combating an extensive range of afflictions including cancer, cardiovascular disorders, and neurodegenerative conditions. Alternative Names: Primulin. CAS No. 30113-37-2. Molecular formula: C23H25ClO12. Mole weight: 528.89. | |
| Malvidin-3-galactoside chloride | Malvidin-3-galactoside chloride, an anthocyanin monomer, induces hepatocellular carcinoma (HCC) cells cycle arrest and apoptosis. Malvidin-3-galactoside chloride inhibits the production and accumulation of ROS. Malvidin-3-galactoside chloride has anti-tumor function[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 30113-37-2. Pack Sizes: 1 mg; 5 mg. Product ID: HY-N6623. | |
| Malvidin 3-glucoside chloride | Malvidin 3-glucoside chloride is a potent compound offering a novel approach in studying oxidative stress-induced ailments. Functioning as an exemplary antioxidant, this exceptional compound shields delicate cellular structures from the detrimental impact of notorious free radicals while concurrently studying detrimental inflammatory responses. Alternative Names: Oenin; Ligulin; Enoside; Malvidin 3-glucoside. CAS No. 7228-78-6. Molecular formula: C23H25O12Cl. Mole weight: 528.89. | |
| Malvidin-3-glucoside chloride | Malvidin-3-glucoside (Malvidin-3-O-glucoside; Oenin) chloride is an orally active inhibitor of the NF-κB pathway, which blocks inflammatory responses induced by TNF-α, reduces IκB-α degradation and p65 nuclear translocation, and upregulates endothelial nitric oxide synthase eNOS to increase NO production. Malvidin-3-glucoside chloride exerts anti-inflammatory and antioxidant effects by inhibiting pro-inflammatory molecules such as MCP-1, ICAM-1, and IL-6, and regulating intestinal microorganisms and metabolites, while protecting endothelial cells and improving intestinal microecological dysbiosis under inflammatory conditions. Malvidin-3-glucoside chloride can be used to study chronic inflammatory-related diseases such as atherosclerosis and inflammatory bowel disease, and has the potential to prevent vascular inflammation and improve intestinal health[1][2][3]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Malvidin-3-O-glucoside chloride; Oenin chloride. CAS No. 7228-78-6. Pack Sizes: 1 mg; 5 mg. Product ID: HY-125740. | |
| Malvidin-3-O-arabinoside chloride | Malvidin-3-O-arabinoside chloride is found in the fruits of Vaccinium myrtillus, it shows antioxidant activity.It has potential preventive effect in colorectal diseases. Alternative Names: Malvidin 3-arabinoside. Grades: > 95%. CAS No. 28500-04-1. Molecular formula: C22H23ClO11. Mole weight: 498.87. | |
| Malvidin-3-O-arabinoside chloride | Malvidin-3-O-arabinoside chloride ameliorates ethyl carbamate-induced oxidative damage by stimulating AMPK-mediated autophagy[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 28500-04-1. Pack Sizes: 1 mg; 5 mg. Product ID: HY-N9349. | |
| Malvidin 3-O-glucoside | Malvidin 3-O-glucoside is found in alcoholic beverages. Alternative Names: Malvidin-3-glucoside. Grades: > 95%. CAS No. 18470-06-9. Molecular formula: C23H25O12+. Mole weight: 493.44. | |
| Malvidin chloride | Malvidin chloride. Alternative Names: Syringidin chloride. CAS No. 643-84-5. Purity: >95.0%. Product ID: FFC-AR-643845. Molecular formula: C17H15ClO7. Mole weight: 366.75. IUPAC Name: 2-(4-hydroxy-3,5-dimethoxyphenyl)chromenylium-3,5,7-triol chloride. Alfa Chemistry - ISO 9001:32057 Certified. | |
| Malvin chloride | Malvin chloride. CAS No. 16727-30-3. Product ID: ACM16727303. Molecular formula: C29H35ClO17. Mole weight: 691.03. Alfa Chemistry - ISO 9001:32057 Certified. | |
| malyl-CoA lyase | The enzyme from the bacterium Chloroflexus aurantiacus, which participates in the 3-hydroxypropanoate cycle for carbon assimilation, also has the activity of EC 4.1.3.25, (3S)-citramalyl-CoA lyase. The enzymes from Rhodobacter species are part of acetate assimilation pathways. The reactions are reversible. Group: Enzymes. Synonyms: malyl-coenzyme A lyase; (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase; mclA (gene name); mcl1 (gene name); (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase (acetyl-CoA-forming); L-malyl-CoA lyase. Enzyme Commission Number: EC 4.1.3.24. CAS No. 37290-67-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4904; malyl-CoA lyase; EC 4.1.3.24; 37290-67-8; malyl-coenzyme A lyase; (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase; mclA (gene name); mcl1 (gene name); (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase (acetyl-CoA-forming); L-malyl-CoA lyase. Cat No: EXWM-4904. | |
| Malyngic acid | Malyngic acid is a natural product derived from plant source. Alternative Names: 9S,12R,13S-trihydroxy-10E,15Z-Octadecadienoic acid. CAS No. 51146-90-8. Molecular formula: C18H32O5. Mole weight: 328.44. | |
| Mambalgin 1 | Mambalgin 1, a toxin isolated from black mamba venom, is a disulfide-rich polypeptide consisting of 57 amino acids and belongs to the family of three-finger toxins. Mambalgin 1 is a selective ASIC1a inhibitor (IC50= 192 and 72 nM for human ASIC1a and ASIC1a/1b dimer, respectively), and binds to closed / inactive channel. Alternative Names: LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK. Grades: >98%. CAS No. 1609937-15-6. Molecular formula: C272H429N85O84S10. Mole weight: 6554.51. | |
| m-Aminobenzoic acid | m-Aminobenzoic acid. CAS No: 99-05-8 |  Sarchem Laboratories New Jersey NJ |
| m-Aminophenol HCl | m-Aminophenol HCl. Alternative Names: 3-Hydroxyaniliniumchloride. CAS No. 51-81-0. Purity: 0.98. Product ID: CI-HC-0264. Molecular formula: C6H8ClNO. Mole weight: 145.59 g/mol. IUPAC Name: 3-aminophenol;hydrochloride. Alfa Chemistry - ISO 9001:32057 Certified. | |
| m-Aminophenol Sulfate | m-Aminophenol Sulfate. Alternative Names: 3-Aminophenol hemisulfate. CAS No. 68239-81-6. Purity: 0.98. Product ID: CI-HC-0265. Molecular formula: C12H16N2O6S. Mole weight: 316.33 g/mol. IUPAC Name: 3-aminophenol;sulfuric acid. Alfa Chemistry - ISO 9001:32057 Certified. | |
| m-Aminophenylboronic acid-Agarose | m-Aminophenylboronic acid-Agarose. | |
| Mammaglobin-A (23-31) | Mammaglobin-A (23-31) is a truncated fragment of Mammaglobin-A. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
| Mammaglobin-A precursor (2-10) | A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
| Mammaglobin-A precursor (32-40) | A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
| Mammaglobin-A precursor (4-12) | A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
| Mammaglobin-A precursor (66-74) | A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
| Mammaglobin-A precursor (83-92) | A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
| Man-1-F N-Glycan | Man-1-F N-Glycan is a pivotal compound used in the research of peculiar glycosylation aberrations, namely congenital disorders of glycosylation. Alternative Names: Oligomannose-1 core fucosylated; Man-1-Fuc; Manb1-4GlcNAcb1-4(Fuca1-6)GlcNAc; D-Glucose, O-6-deoxy-α-L-galactopyranosyl-(1→6)-O-[O-β-D-mannopyranosyl-(1→4)-2-(acetylamino)-2-deoxy-β-D-glucopyranosyl-(1→4)]-2-(acetylamino)-2-deoxy-; O-β-D-Mannopyranosyl-(1→4)-O-2-(acetylamino)-2-deoxy-β-D-glucopyranosyl-(1→4)-O-[6-deoxy-α-L-galactopyranosyl-(1→6)]-2-(acetylamino)-2-deoxy-D-glucose; Man-1-Fuc; Oligomannose-1 fucose; Man-1-F; Manβ1-4GlcNAcβ1-4(Fucα1-6)GlcNAc. CAS No. 79300-36-0. Molecular formula: C28H48N2O20. Mole weight: 732.68. | |
| Man-1 N-Glycan | Man-1 N-Glycan is a fundamental and indispensable compound assuming a paramount significance when it comes to studying diverse ailments, most notably cancer. Serving as a potent tool, its principal utility resides in the comprehensive scrutiny and subsequent modification of N-glycan structures, thereby facilitating an intricate comprehension of the intricacies inherent in glycosylation mechanisms operative within cellular frameworks. Alternative Names: Oligomannose-1; Man-1; Man(b,1-4)GlcNAc(b,1-4)GlcNAc; O-beta-D-Mannopyranosyl-(1-4)-O-2-(acetylamino)-2-deoxy-beta-D-glucopyranosyl-(1-4)-2-(acetylamino)-2-deoxy-alpha-D-glucopyranose; O-β-D-Mannopyranosyl-(1→4)-O-2-(acetylamino)-2-deoxy-β-D-glucopyranosyl-(1→4)-2-(acetylamino)-2-deoxy-α-D-glucopyranose; Man(b1-4)GlcNAc(b1-4)a-GlcNAc; beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)-beta-D-GlcpNAc. Grades: ≥95%. CAS No. 159266-34-9. Molecular formula: C22H38N2O16. Mole weight: 586.54. | |
| Man-2a N-Glycan | Man-2a N-Glycan is a synthetic N-glycan structure consisting of two mannose residues acting as a substrate or standard for glycan analysand glycosylation studies. It is commonly used to study the glycosylation patterns of proteins and identify abnormalities associated with diseases such as cancer, autoimmune disorders and genetic disorders. Alternative Names: Oligomannose-2(a); Mana6Manb4GlcNAcb4GlcNAc; O-alpha-D-Mannopyranosyl-(1-6)-O-beta-D-mannopyranosyl-(1-4)-O-2-(acetylamino)-2-deoxy-beta-D-glucopyranosyl-(1-4)-2-(acetylamino)-2-deoxy-beta-D-glucopyranose; β-D-Glucopyranose, O-α-D-mannopyranosyl-(1→6)-O-β-D-mannopyranosyl-(1→4)-O-2-(acetylamino)-2-deoxy-β-D-glucopyranosyl-(1→4)-2-(acetylamino)-2-deoxy-; Man(a1-6)Man(b1-4)GlcNAc(b1-4)b-GlcNAc. CAS No. 491845-49-9. Molecular formula: C28H48N2O21. Mole weight: 748.68. | |
| Man-2b N-Glycan | Man-2b N-Glycan is an indispensable compound with application extends to the meticulous examination of N-glycan structures, which harbinger various ailments including cancer, diabetes and autoimmune disorders. Alternative Names: Oligomannose-2 (b); O-α-D-Mannopyranosyl-(1→3)-O-β-D-mannopyranosyl-(1→4)-O-2-(acetylamino)-2-deoxy-β-D-glucopyranosyl-(1→4)-2-(acetylamino)-2-deoxy-D-glucose. CAS No. 81034-76-6. Molecular formula: C28H48N2O21. Mole weight: 748.68. | |
Our database is helping our users find suppliers everyday.
