American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
Maltulose monohydrate 4-O-a-D-glucopyranosyl D-fructose. CAS No. 207511-09-9. Product ID: 3-00036. Molecular formula: C12H24O11. Mole weight: 360.32. CarboMer Inc
Malvidin 3,5-diglucoside Malvidin 3,5-diglucoside is a significant compound present in diverse fruits and vegetables, exhibiting remarkable antioxidant attributes and has been subject to extensive investigation regarding its prospective role in averting chronic ailments such as cancer, cardiovascular diseases and neurodegenerative disorders. Synonyms: Malvoside; Malvidin chloride 3,5-diglucoside; Malvin(chloride). CAS No. 16727-30-3. Molecular formula: C29H35O17Cl. Mole weight: 691.03. BOC Sciences 11
Malvidin-3-b-glucoside Malvidin-3-b-glucoside. CAS No. 7228-78-6. Product ID: 3-00250. Molecular formula: C23H25ClO12. Mole weight: 528.9. Purity: 90+%. Categories: Malvidin-3-O-glucoside. CarboMer Inc
Malvidin-3-galactoside chloride Malvidin-3-galactoside chloride, an anthocyanin monomer, induces hepatocellular carcinoma (HCC) cells cycle arrest and apoptosis. Malvidin-3-galactoside chloride inhibits the production and accumulation of ROS. Malvidin-3-galactoside chloride has anti-tumor function [1]. Uses: Scientific research. Group: Natural products. CAS No. 30113-37-2. Pack Sizes: 1 mg; 5 mg. Product ID: HY-N6623. MedChemExpress MCE
Malvidin-3-galactoside chloride Malvidin-3-galactoside chloride is a profoundly influential compound widely employed in the biomedical industry due to its immense therapeutic potential. With well-established acclaim for its formidable antioxidant prowess and remarkable anti-inflammatory attributes, this product showcases exceptional efficacy in combating an extensive range of afflictions including cancer, cardiovascular disorders, and neurodegenerative conditions. Synonyms: Primulin. CAS No. 30113-37-2. Molecular formula: C23H25ClO12. Mole weight: 528.9. BOC Sciences 11
Malvidin 3-glucoside Cas No. 7228-78-6. BOC Sciences 11
Malvidin-3-glucoside Malvidin-3-glucoside. CAS No. 7228-78-6. Product ID: 3-00251. Molecular formula: C23H25ClO12. Mole weight: 528.9. Purity: 0.3. Properties: soluble in water, ethanol and methanol. Reference: Merck, 11, 7014. CarboMer Inc
Malvidin-3-glucoside chloride Malvidin-3-glucoside chloride (Malvidin-3-O-glucoside chloride), a major wine anthocyanin, is effective in promoting resilience against stress by modulating brain synaptic plasticity and peripheral inflammation [1]. Uses: Scientific research. Group: Natural products. Alternative Names: Malvidin-3-O-glucoside chloride; Oenin chloride. CAS No. 7228-78-6. Pack Sizes: 1 mg; 5 mg. Product ID: HY-125740. MedChemExpress MCE
Malvidin-3-O-arabinoside chloride Malvidin-3-O-arabinoside chloride is found in the fruits of Vaccinium myrtillus, it shows antioxidant activity.It has potential preventive effect in colorectal diseases. Synonyms: Malvidin 3-arabinoside. Grades: > 95%. CAS No. 28500-04-1. Molecular formula: C22H23ClO11. Mole weight: 498.87. BOC Sciences 9
Malvidin chloride Malvidin (chloride) is a bioactive compound isolated from grape. Malvidin shows cytotoxicity through the arrest of the G 2 /M phase of cell cycle and induction of apoptosis. Malvidin can be used for the research of cancer [1]. Uses: Scientific research. Group: Natural products. Alternative Names: Syringidin. CAS No. 643-84-5. Pack Sizes: 5 mg; 10 mg. Product ID: HY-122496. MedChemExpress MCE
malyl-CoA lyase The enzyme from the bacterium Chloroflexus aurantiacus, which participates in the 3-hydroxypropanoate cycle for carbon assimilation, also has the activity of EC 4.1.3.25, (3S)-citramalyl-CoA lyase. The enzymes from Rhodobacter species are part of acetate assimilation pathways. The reactions are reversible. Group: Enzymes. Synonyms: malyl-coenzyme A lyase; (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase; mclA (gene name); mcl1 (gene name); (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase (acetyl-CoA-forming); L-malyl-CoA lyase. Enzyme Commission Number: EC 4.1.3.24. CAS No. 37290-67-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4904; malyl-CoA lyase; EC 4.1.3.24; 37290-67-8; malyl-coenzyme A lyase; (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase; mclA (gene name); mcl1 (gene name); (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase (acetyl-CoA-forming); L-malyl-CoA lyase. Cat No: EXWM-4904. Creative Enzymes
Mambalgin 1 Mambalgin 1, a toxin isolated from black mamba venom, is a disulfide-rich polypeptide consisting of 57 amino acids and belongs to the family of three-finger toxins. Mambalgin 1 is a selective ASIC1a inhibitor (IC50= 192 and 72 nM for human ASIC1a and ASIC1a/1b dimer, respectively), and binds to closed/inactive channel. Synonyms: LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQG CSSSCSETENNKCCSTDRCNK. Grades: >98%. CAS No. 1609937-15-6. Molecular formula: C272H429N85O84S10. Mole weight: 6554.51. BOC Sciences 3
m-Aminobenzoic acid m-Aminobenzoic acid. CAS No: 99-05-8 Sarchem Laboratories
Sarchem Laboratories New Jersey NJ
M-AMINOBENZYL CYANIDE M-AMINOBENZYL CYANIDE. Uses: Designed for use in research and industrial production. Additional or Alternative Names: M-AMINOBENZYL CYANIDE;3-AMINOBENZYL CYANIDE;2-(3-Aminophenyl)acetonitrile. Product Category: Heterocyclic Organic Compound. CAS No. 4623-24-9. Molecular formula: C8H8N2. Mole weight: 132.16. Product ID: ACM4623249. Alfa Chemistry — ISO 9001:2015 Certified. Categories: (3-AMINO-PHENYL)-ACETONITRILE. Alfa Chemistry. 5
m-Aminophenylboronic acid-Agarose m-Aminophenylboronic acid-Agarose. Group: Salt. Alfa Chemistry Materials 6
Mammaglobin-A (23-31) Mammaglobin-A (23-31) is a truncated fragment of Mammaglobin-A. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. BOC Sciences 3
Mammaglobin-A precursor (2-10) A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. BOC Sciences 3
Mammaglobin-A precursor (32-40) A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. BOC Sciences 3
Mammaglobin-A precursor (4-12) A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. BOC Sciences 3
Mammaglobin-A precursor (66-74) A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. BOC Sciences 3
Mammaglobin-A precursor (83-92) A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. BOC Sciences 3
Man-1 Man-1 is an impressive and discerning small molecule inhibitor, used in the research of acute myeloid leukemia (AML). This remarkable compound diligently focuses its efforts on MLL1, an oncogenic enzyme of paramount importance in the context of leukemogenesis. Molecular formula: C22H38N2O16. Mole weight: 586.54. BOC Sciences 12
Man-1-F N-Glycan Man-1-F N-Glycan is a pivotal compound used in the research of peculiar glycosylation aberrations, namely congenital disorders of glycosylation. Synonyms: Oligomannose-1 core fucosylated; Man-1-Fuc; Manb1-4GlcNAcb1-4(Fuca1-6)GlcNAc. CAS No. 79300-36-0. Molecular formula: C28H48N2O20. Mole weight: 732.68. BOC Sciences 12
Man-1-Fuc Man-1-Fuc is a potent inhibitor of fucose biosynthesis, primarily used in biomedical research. It hinders the biosynthesis of fucose-containing oligosaccharides, inhibiting the creation of cell surface glycoconjugates. Its usage often involves studying diseases related to abnormal fucosylation, including cancer, inflammation and congenital disorders. Synonyms: Oligomannose-1 fucose; Man-1-F; Manβ1-4GlcNAcβ1-4(Fucα1-6)GlcNAc. Molecular formula: C28H48N2O20. Mole weight: 732.68. BOC Sciences 12
Man-1 N-Glycan Man-1 N-Glycan is a fundamental and indispensable compound assuming a paramount significance when it comes to studying diverse ailments, most notably cancer. Serving as a potent tool, its principal utility resides in the comprehensive scrutiny and subsequent modification of N-glycan structures, thereby facilitating an intricate comprehension of the intricacies inherent in glycosylation mechanisms operative within cellular frameworks. Synonyms: Oligomannose-1; Man-1; Man(b,1-4)GlcNAc(b,1-4)GlcNAc; O-beta-D-Mannopyranosyl-(1-4)-O-2-(acetylamino)-2-deoxy-beta-D-glucopyranosyl-(1-4)-2-(acetylamino)-2-deoxy-alpha-D-glucopyranose. Grades: ≥95%. CAS No. 159266-34-9. Molecular formula: C22H38N2O16. Mole weight: 586.54. BOC Sciences 12
Man-2(a) Man-2(a) is a groundbreaking synthetic molecular compound with exceptional prowess, ensnaring attention through its formidable anti-inflammatory capacities. Molecular formula: C28H48N2O21. Mole weight: 748.68. BOC Sciences 12
Man-2a N-Glycan Man-2a N-Glycan is a synthetic N-glycan structure consisting of two mannose residues acting as a substrate or standard for glycan analysand glycosylation studies. It is commonly used to study the glycosylation patterns of proteins and identify abnormalities associated with diseases such as cancer, autoimmune disorders and genetic disorders. Synonyms: Oligomannose-2(a); Mana6Manb4GlcNAcb4GlcNAc; O-alpha-D-Mannopyranosyl-(1-6)-O-beta-D-mannopyranosyl-(1-4)-O-2-(acetylamino)-2-deoxy-beta-D-glucopyranosyl-(1-4)-2-(acetylamino)-2-deoxy-beta-D-glucopyranose; β-D-Glucopyranose, O-α-D-mannopyranosyl-(1?6)-O-β-D-mannopyranosyl-(1?4)-O-2-(acetylamino)-2-deoxy-β-D-glucopyranosyl-(1?4)-2-(acetylamino)-2-deoxy-. CAS No. 491845-49-9. Molecular formula: C28H48N2O21. Mole weight: 748.68. BOC Sciences 12
Man-2(b) Man-2(b), an innovative biomedicine solution, emerges as a groundbreaking intervention for specific glycosylation-related ailments. By effectively inhibiting critical enzymes implicated in glycosylation, it facilitates optimal protein folding and cellular operations. As an outcome, Man-2(b) yields tremendous potential as a therapeutic alternative for aberrant glycosylation-induced conditions, encompassing congenital disorders of glycosylation (CDGs) and select cancer forms. Molecular formula: C28H48N2O21. Mole weight: 748.68. BOC Sciences 12
Man-2b N-Glycan Man-2b N-Glycan is an indispensable compound with application extends to the meticulous examination of N-glycan structures, which harbinger various ailments including cancer, diabetes and autoimmune disorders. Synonyms: Oligomannose-2 (b). CAS No. 81034-76-6. Molecular formula: C28H48N2O21. Mole weight: 748.68. BOC Sciences 12
Man[2Bz,3All,46Bzd]b(1-4)GlcNPhth[36Bn]-b-MP Man[2Bz,3All,46Bzd]b(1-4)GlcNPhth[36Bn]-b-MP, an innovative bioactive compound widely applied in the field of biomedicine, showcases great promise as a therapeutic agent for a myriad of ailments encompassing cancer and inflammation. Its distinctive structural attributes prompt targeted drug administration, thereby amplifying its effectiveness. Molecular formula: C58H55NO14. Mole weight: 990.06. BOC Sciences 12
Man-3a N-Glycan The Man-3a N-Glycan, a complex glycan structure, intricately participates in numerous biological processes, such as immune response and cell signaling. Its various anomalous configurations have been correlated to the onset of a spectrum of diseases, encompassing cancer and autoimmune disorders. Promising and recent studies have highlighted the potential of altering the cellular dynamics by directing focus towards Man-3a N-Glycan, paving the way for groundbreaking therapeutic development. Synonyms: Oligomannose-3(a); Man-3(a); Mannotriose-di-(N-acetyl-D-glucosamine); M3N2 N-Glycan; Man(a1, 3)[Man(a1, 6)]Man(b1, 4)GlcNAc(b1, 4)GlcNAc; alpha-D-Man-(1->3)-[alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAc-(1->4)-D-GlcNAc; alpha-D-mannopyranosyl-(1->3)-[alpha-D-mannopyranosyl-(1->6)]-beta-D-mannopyranosyl-(1->4)-2-acetamido-2-deoxy-beta-D-glucopyranosyl-(1->4)-2-acetamido-2-deoxy-D-glucopyranose. Grades: ≥90%. CAS No. 70858-45-6. Molecular formula: C34H58N2O26. Mole weight: 910.82. BOC Sciences 12
Man-3(b) Man-3(b) is a remarkable compound, aiding in studying breast cancer through its selective engagement with estrogen receptor-positive cells, thereby impeding their proliferation. Molecular formula: C34H58N2O26. Mole weight: 910.82. BOC Sciences 12
Man-3b N-Glycan Man-3b N-Glycan is a crucial component playing a significant role in glycobiology and glycosylation research. This glycan structure is commonly found in glycoproteins and is extensively studied for its involvement in various biological processes such as cell signaling, protein folding and immune response modulation. Synonyms: Man(a1, 3)Man(a1, 6)Man(b1, 4)GlcNAc(b1, 4)GlcNAc; Oligomannose-3b. CAS No. 1072108-34-9. Molecular formula: C34H58N2O26. Mole weight: 910.82. BOC Sciences 12
Man-3-F N-Glycan Man-3-F N-Glycan is a highly consequential biomolecule widely employed, possessing immense significance in unraveling the intricate mechanisms underlying glycosylation and glycoprotein therapeutics. When comprehending the intricate intricacies linked to the structural and functional aspects of glycoproteins, this biomolecule acts as an invaluable resource, facilitating the development of precisely tailored researchs for an extensive range of ailments, encompassing cancer, autoimmune disorders and infectious diseases. Synonyms: Mannotriose-[fucosyl-di-(N-acetyl-D-glucosamine)]; Oligomannose-3 glycan, core fucosylated; Pentasaccharide core (1-6) fucosylated; Man-3-F; Pentasaccharide core fucosylated (MAN-3F); Man3(Fuc)GlcNAc2; M3F; Oligomannose-3-Fuc (1-6) (Man-3-Fuc); 6-Deoxy-α-L-galactopyranosyl-(1->6)-[α-D-mannopyranosyl-(1->3)-[α-D-mannopyranosyl-(1->6)]-β-D-mannopyranosyl-(1->4)-2-acetamido-2-deoxy-β-D-glucopyranosyl-(1->4)]-2-acetamido-2-deoxy-D-glucose. CAS No. 110387-51-4. Molecular formula: C40H68N2O30. Mole weight: 1056.96. BOC Sciences 12
Man-3 Glycan, 2-AB labelled Man-3 Glycan, 2-AB labelled is a crucial tool in the biomedical industry for studying disease mechanisms and glycoprotein functions. This product, consisting of a mannosylated trimeric glycan labeled with 2-aminobenzamide (2-AB), can be used for glycan profiling, glycoprotein analysis and carbohydrate biomarker discovery. It aids in the research and development of novel drugs targeting drug-resistant cancers, infectious diseases and autoimmune disorders. Synonyms: M3N2 Glycan, 2-AB labelled. BOC Sciences 12
Man-3-Xyl-Fuc N-Glycan Man-3-Xyl-Fuc N-Glycan is a distinctive biochemical compound, finding purpose in the realm of biomedical studies, specifically illuminating the intricate patterns of glycosylation implicated in disease mechanisms. By virtue of aiding the exploration of glycan-mediated targets, this product emboldens the progression towards groundbreaking and tailored researchs aimed at specific drug targets. Synonyms: Man-3-Xyl, Fuc; Oligomannose-3 xylose, 1-3 fucose; Man-3-X-F; Manα1-6(Manα1-3)Manβ(Xylβ1-2)1-4GlcNAcβ1-4(Fucα1-3)GlcNAc. Molecular formula: C45H76N2O34. Mole weight: 1189.08. BOC Sciences 12
Man-3Xyl N-Glycan Man-3Xyl N-Glycan is a cutting-edge biomedical compound, used for the glycoprotein analysis. Its application transcends conventional boundaries, delving into the intricate exploration of glycosylation patterns affixed to diverse protein entities, most notably antibodies. Synonyms: Oligomannose-3XL. CAS No. 110037-52-0. Molecular formula: C39H66N2O30. Mole weight: 1042.94. BOC Sciences 12
Man-3-xylose Man-3-xylose is a compound showcasing auspicious outcomes by impeding the proliferation of select neoplastic cells, finding applications in studying breast and colon cancer. Synonyms: Oligomannose-3 xylose; M3N2X; Manα1-6(Manα1-3)Manβ(Xylβ1-2)1-4GlcNAcβ1-4GlcNAc. Molecular formula: C39H66N2O30. Mole weight: 1042.94. BOC Sciences 12
Man-4(b) Man-4(b) stands as a distinguished chemical compound prevalent in the domain of biomedicine. Its application within the biomedical industry proves particularly pertinent, given its noteworthy involvement in the amelioration of diverse ailments, such as cancer and autoimmune disorders. An inherent capacity to selectively target cellular receptors, coupled with the capability to regulate signal transduction pathways, imparts this product with immense significance. Molecular formula: C40H68N2O31. Mole weight: 1072.96. BOC Sciences 12
Man-4 N-Glycan Man-4 N-Glycan is a crucial biomolecule widely used in biomedical field acting as a key target for various drugs aiming to diseases such as cancer, cardiovascular disorders and immune-related conditions. This N-glycan structure plays a pivotal role in cellular communication and regulation. Synonyms: Oligomannose-4. Molecular formula: C40H68N2O31. Mole weight: 1072.96. BOC Sciences 12
Man5GlcNAc Man5GlcNAc is a quintessential molecule assuming a pivotal function in the realm of drug discovery aimed at studying glycosylation-related maladies including cancer, diabetes and hereditary anomalies. Its distinctive configuration bestows profound insights into protein folding, cellular signaling and pathogenic mechanisms, thereby rendering it an invaluable compound for the investigation and advancement of researchs. Synonyms: Man(a1-6)[Man(a1-3)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc. CAS No. 74385-50-5. Molecular formula: C38H65NO31. Mole weight: 1031.91. BOC Sciences 12
Man-5 Glycan, 2-AA labelled Man-5 Glycan, 2-AA labelled is a critical tool for studying N-glycan processing. This product is widely used in the biomedical industry to investigate N-glycan branching, trimming, and non-enzymatic glycation. Man-5 Glycan, 2-AA labelled is also essential for analyzing genetic disorders such as Congenital Disorders of Glycosylation (CDG). BOC Sciences 12
Man-5 Glycan, 2-AB labelled BOC Sciences 12
Man-5 N-Glycan Man-5 N-Glycan is a crucial biomolecule widely utilized industry. This glycan structure plays a vital role in protein glycosylation, affecting cellular processes like protein folding, stability and immune responses. It serves as a crucial tool for studying glycosylation-related diseases such as cancer, inflammation and congenital disorders. Synonyms: Mannopentaose-di-(N-acetyl-D-glucosamine); Oligomannose-5 glycan; Man-5; Oligomannose-5; (Man)5(GlcNAc)2; α-D-Mannopyranosyl-(1->3)-[α-D-mannopyranosyl-(1->3)-[α-D-mannopyranosyl-(1->6)]-α-D-mannopyranosyl-(1->6)]-β-D-mannopyranosyl-(1->4)-2-acetamido-2-deoxy-β-D-glucopyranosyl-(1->4)-2-acetamido-2-deoxy-D-glucose. Grades: ≥90%. CAS No. 66091-47-2. Molecular formula: C46H78N2O36. Mole weight: 1235.10. BOC Sciences 12
Man6GlcNAc (I) Man6GlcNAc (I) as an indispensable intermediate in the intricate biosynthesis of complex N-glycans. It intricately participates in a myriad of vital biological processes, encompassing cellular recognition, signal transduction and immune response. Furthermore, this compound stands as a cherished compound in the research and development of glycosylation-related diseases and congenital disorders of glycosylation. Synonyms: Man(a1-6)[Man(a1-3)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc. CAS No. 70158-31-5. Molecular formula: C44H75NO36. Mole weight: 1194.05. BOC Sciences 12
Man6GlcNAc(II) Man6GlcNAc(II) is an indispensable glycan moiety identified on N-glycoproteins assuming a pivotal function in protein folding, trafficking and quality control mechanisms within a biological framework. It unequivocally serves as an obligatory constituent for a diverse array of enzymes instrumental in glycosylation processes. In biomedical research, Man6GlcNAc(II) finds application in elucidating regulatory mechanisms of glycoproteins, exploring therapeutic modalities for lysosomal storage disorders and deciphering ailments stemming from irregular protein glycosylation. Synonyms: Man(a1-2)Man(a1-3)Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc. Molecular formula: C44H75NO36. Mole weight: 1194.05. BOC Sciences 12
Man-6 Glycan, 2-AA labelled Man-6 Glycan, 2-AA labelled, an indispensable tool for scrutinizing lysosomal storage ailments, is a derivative of Man-6 Glycan that is fluorescently labelled. It serves as a substrate to explore glycosidases that partake in glycosaminoglycan degradation. Its high precision in identifying insufficiencies in lysosomal enzyme activity renders it an invaluable asset for therapeutic progress in hitherto unresolvable disorders such as mucopolysaccharidoses. BOC Sciences 12
Man-6 Glycan, 2-AB labelled BOC Sciences 12
Man-6 N-Glycan Man-6 N-Glycan is a crucial carbohydrate structure found on glycoproteins. It plays a significant role in the biomedical industry, particularly in the study of protein-folding diseases, such as Gaucher disease and lysosomal storage disorders. Synonyms: Oligomannose-6; Man-6; Oligomannose-6 glycan; Man-6 N-linked oligosaccharide; Mana6 [Mana3]Mana6 [Mana2Mana3]Manb4GlcNAcb4GlcNAc; O-alpha-D-Mannopyranosyl-(1-3)-O-[alpha-D-mannopyranosyl-(1-6)]-O-alpha-D-mannopyranosyl-(1-6)-O-[O-alpha-D-mannopyranosyl-(1-2)-alpha-D-mannopyranosyl-(1-3)]-O-beta-D-mannopyranosyl-(1-3)-O-2-(acetylamino)-2-deoxy-beta-D-glucopyranosyl-(1-4)-2-(acetylamino)-2-deoxy-D-glucose. Grades: ≥85%. CAS No. 340982-27-6. Molecular formula: C52H88N2O41. Mole weight: 1397.24. BOC Sciences 12
Man-7D1 N-Glycan Man-7D1 N-Glycan is an indispensable compound within the biomedical sector assuming a pivotal position in the investigation and development of a myriad of pharmaceuticals pertaining to glycoproteins and N-glycosylation. This unparalleled product facilitates disease research encompassing cancer, neurodegenerative disorders and autoimmune maladies. Synonyms: Oligomannose-7D1; Mannoheptaose-di-(N-acetyl-D-glucosamine)D1; Man-7D1; Man7(GlcNAc)2; D-Glucose, O-α-D-mannopyranosyl-(1->2)-O-α-D-mannopyranosyl-(1->2)-O-α-D-mannopyranosyl-(1->3)-O-[O-α-D-mannopyranosyl-(1->3)-O-[α-D-mannopyranosyl-(1->6)]-α-D-mannopyranosyl-(1->6)]-O-β-D-mannopyranosyl-(1->4)-O-2-(acetylamino)-2-deoxy-β-D-glucopyranosyl-(1->4)-2-(acetylamino)-2-deoxy-; α-D-Mannopyranosyl-(1->2)-α-D-mannopyranosyl-(1->2)-α-D-mannopyranosyl-(1->3)-[α-D-mannopyranosyl-(1->3)-[α-D-mannopyranosyl-(1->6)]-α-D-mannopyranosyl-(1->6)]-β-D-mannopyranosyl-(1->4)-2-acetamido-2-deoxy-β-D-glucopyranosyl-(1->4)-2-acetamido-2-deoxy-D-glucose. CAS No. 83178-05-6. Molecular formula: C58H98N2O46. Mole weight: 1559.38. BOC Sciences 12
Man-7D2 N-Glycan BOC Sciences 12
Man-7D3 N-Glycan Man-7D3 N-Glycan is a vital component used in the biomedical industry utilized in the evaluation and characterization of glycosylation patterns in therapeutic proteins, such as monoclonal antibodies and glycoproteins, contributing to the understanding and research of various diseases. Synonyms: Oligomannose-7D3; Mannoheptaose-di-(N-acetyl-D-glucosamine)D3; Man-7D3; Man7GlcNAc2; D-Glucose, O-α-D-mannopyranosyl-(1->2)-O-α-D-mannopyranosyl-(1->6)-O-[α-D-mannopyranosyl-(1->3)]-O-α-D-mannopyranosyl-(1->6)-O-[α-D-mannopyranosyl-(1->2)-α-D-mannopyranosyl-(1->3)]-O-β-D-mannopyranosyl-(1->4)-O-2-(acetylamino)-2-deoxy-β-D-glucopyranosyl-(1->4)-2-(acetylamino)-2-deoxy-. CAS No. 84182-22-9. Molecular formula: C58H98N2O46. Mole weight: 1559.38. BOC Sciences 12
Man-7 Glycan, 2-AA labelled Man-7 Glycan, 2-AA labelled, is a biomolecule of interest within the biomedical community as it facilitates studies of the nuanced structures and transformative purposes of glycans. As it successfully delves into glycoproteins, this biomolecule proves to be an exceptionally effective tool in the quest for understanding diseases ranging from cancer to neurodegenerative disorders and autoimmune diseases. The 2-AA labelled iteration of Man-7 Glycan presents itself as a highly valuable asset as it empowers scholars to execute extensive glycan profiling and structure analysis. BOC Sciences 12
Man-7 Glycan, 2-AB labelled BOC Sciences 12
Man-7 N-Glycan Man-7 N-Glycan is a vital component in the biomedical industry used for glycoprotein analysis aiding in elucidating the structure and function of different glycoproteins involved in various diseases such as cancer, viral infections and immune disorders. With its high purity and stability, Man-7 N-Glycan enables precise examination and research into potential therapeutic targets. Synonyms: Man-7 N-linked oligosaccharide; Oligomannose 7 glycan. Molecular formula: C58H98N2O46. Mole weight: 1559.38. BOC Sciences 12
Man-8D1D2 N-Glycan BOC Sciences 12
Man-8D1D3 N-Glycan Man-8D1D3 N-Glycan is a pivotal biomolecule of immense significance, exerting a profound influence on antibody-mediated immune responses while actively participating in a myriad of intricate signaling pathways. This remarkable molecular structure holds immense potential for investigating intricate glycosylation patterns, thereby unraveling their inherent association with afflictions such as cancer, autoimmune disorders and contagious ailments. Synonyms: Oligomannose 8D1D3. CAS No. 1361121-69-8. Molecular formula: C64H108N2O51. Mole weight: 1721.53. BOC Sciences 12
Man-8 Glycan, 2-AA labelled Man-8 Glycan, 2-AA labelled is a biomolecule used in glycobiology studies to investigate the roles of specific glycan structures in processes such as protein folding, cell adhesion, and infection by viruses such as HIV. It is also utilized in the development and testing of drugs targeting diseases related to glycan abnormalities, such as cancer and cardiovascular disease. BOC Sciences 12
Man-8 Glycan, 2-AB labelled BOC Sciences 12
Man-8 N-Glycan Man-8 N-Glycan is an indispensable compound, presenting itself as a paramount instrument for studying and dissecting the intricate phenomenon of protein glycosylation. Synonyms: Oligomannose-8D1D3; Mannooctaose-di-(N-acetyl-D-glucosamine)D1D3; Man-8D1D3; Oligomannose 8 glycan; Man-8 N-linked oligosaccharide; Man8(GlcNAc)2; α-D-Mannopyranosyl-(1->2)-α-D-mannopyranosyl-(1->2)-α-D-mannopyranosyl-(1->3)-[α-D-mannopyranosyl-(1->3)-[α-D-mannopyranosyl-(1->2)-α-D-mannopyranosyl-(1->6)]-α-D-mannopyranosyl-(1->6)]-β-D-mannopyranosyl-(1->4)-2-acetamido-2-deoxy-β-D-glucopyranosyl-(1->4)-2-acetamido-2-deoxy-D-glucose. Grades: ≥80%. CAS No. 77036-51-2. Molecular formula: C64H108N2O51. Mole weight: 1721.53. BOC Sciences 12
Man-9-Glc N-Glycan Man-9-Glc N-Glycan is an essential glycan structure intricately linked to diverse biological processes assuming the role of a distinctive marker for particular enzymes and receptors. Its profound influence encompasses the facilitation of optimal protein folding and intricate cell signaling. Gaining immense significance in biomedical investigations, this product unfailingly contributes to an array of studies pertaining to protein glycosylation, glycan profiling and the identification of therapeutic targets for debilitating conditions such as cancer, alzheimer's disease and genetic anomalies. Synonyms: Oligomannose-9-Glc; Man-9-Glc; O-alpha-D-Glucopyranosyl-(1-3)-[O-alpha-D-mannopyranosyl-(1-2)]2-O-alpha-D-mannopyranosyl-(1-3)-O-[O-alpha-D-mannopyranosyl-(1-2)-O-alpha-D-mannopyranosyl-(1-3)-O-[O-alpha-D-mannopyranosyl-(1-2)-alpha-D-mannopyranosyl-(1-6)]-alpha-D-mannopyranosyl-(1-6)]-O-beta-D-mannopyranosyl-(1-4)-O-2-(acetylamino)-2-deoxy-beta-D-glucopyranosyl-(1-4)-2-(acetylamino)-2-deoxy-beta-D-glucopyranose. Grades: ≥95%. CAS No. 906471-35-0. Molecular formula: C76H128N2O61. Mole weight: 2045.81. BOC Sciences 12
Man-9 Glycan, 2-AA labelled Man-9 Glycan, 2-AA labelled is a biomedical product that plays a critical role in studying the glycan structures of proteins. This product is used for labeling and visualizing glycans in glycoproteins and glycolipids, aiding in the research related to diseases such as cancer and Alzheimer's. Its use can also help in optimizing the production of therapeutic glycoproteins through glycoengineering. BOC Sciences 12
Man-9 Glycan, 2-AB labelled BOC Sciences 12
Man-9 N-Glycan Man-9 N-Glycan is a highly intricate polysaccharide arrangement, finding significant applications for exploring the intricate nature of glycoproteins. Comprising a chain of nine mannose residues, this complex carbohydrate structure assumes a pivotal function in the realms of protein folding, stability and recognition mechanisms. Synonyms: Oligomannose-9; Man-9; Mannononaose-di-(N-acetyl-D-glucosamine); (Man)9(GlcNAc)2; Man-9 N-linked oligosaccharide; α-D-Mannopyranosyl-(1->2)-α-D-mannopyranosyl-(1->2)-α-D-mannopyranosyl-(1->3)-[α-D-mannopyranosyl-(1->2)-α-D-mannopyranosyl-(1->3)-[α-D-mannopyranosyl-(1->2)-α-D-mannopyranosyl-(1->6)]-α-D-mannopyranosyl-(1->6)]-β-D-mannopyranosyl-(1->4)-2-acetamido-2-desoxy-β-D-glucopyranosyl-(1->4)-2-acetamido-2-desoxy-D-glucose. Grades: ≥80%. CAS No. 71246-55-4. Molecular formula: C70H118N2O56. Mole weight: 1883.67. BOC Sciences 12
Man-a-1,2-Man-a-1,2-Man-a-1-O-(CH2)3NH2 BOC Sciences 12
Mancozeb Mancozeb is a widely used fungicide that is effective against fungal diseases in most cereals, vegetables, fruits and ornamental plants. In addition, Mancozeb can cause liver damage in mice by activating the Keap1/Nrf2 signaling pathway. Mancozeb upregulates lactate dehydrogenase and cytochrome c to alter cell metabolism and induce cell death. Mancozeb has reproductive toxicity and can induce apoptosis in ovarian cells [1] [2] [3] [4]. Uses: Scientific research. Group: Signaling pathways. CAS No. 8018-1-7. Pack Sizes: 500 mg; 1 g. Product ID: HY-B0854. MedChemExpress MCE
Mancozeb Mancozeb. Group: Biochemicals. Alternative Names: [N- [2- [ (dithiocarboxy) amino] ethyl] carbamodithioato (2-) -κ S, κ S'] manganese mixture with [N- [2- [ (dithiocarboxy) amino] ethyl] carbamodithioato (2-) -κ S, κ S'] zinc; Zinc manganese ethylene bisdithiocarbamate; Agrox 16D. Grades: Highly Purified. CAS No. 8018-1-7. Pack Sizes: 500mg, 1g, 2g, 5g, 10g. Molecular Formula: C8H12MnN4S8Zn. US Biological Life Sciences. USBiological 7
Worldwide
Mancozeb Mancozeb is a fungicide used to protect crops in agriculture. Synonyms: Manganese Zinc ethylenebis(dithiocarbamate). CAS No. 8018-1-7. Molecular formula: C8H12MnN4S8Zn. Mole weight: 541.1. BOC Sciences 6
Mandaril Mandaril. CAS No. 124358-45-8. VIGON Item # 502519. Categories: Speciality Ingrdients Suppliers, Fragrances, Perfumers. Vigon
America & Internationally
Mandarinal 32048 SAEF Mandarinal 32048 SAEF. CAS No. MIXTURE. VIGON Item # 502967. Categories: Speciality Ingrdients Suppliers, Fragrances, Perfumers. Vigon
America & Internationally

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products