A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| Scutellarin | Scutellarin. Group: Biochemicals. Grades: Plant Grade. CAS No. 27740-01-8. Pack Sizes: 20mg. Molecular Formula: C21H18O12, Molecular Weight: 462.36. US Biological Life Sciences. |  Worldwide |
| Scutellarin | Scutellarin, an active flavone isolated from Scutellaria baicalensis, can down-regulates the STAT3/Girdin/Akt signaling in HCC cells, and inhibits RANKL-mediated MAPK and NF-κB signaling pathway in osteoclasts. Scutellarin is active against HIV-1IIIB, HIV-1(74V) and HIV-1KM018 with EC50s of 26 μM, 253 μM and 136 μM, respectively. Uses: Scientific research. Category: Signaling pathways. CAS No. 27740-01-8. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 500 mg. Product ID: HY-N0751. |  |
| Scutellarin methyl ester | Scutellarin methyl ester. Group: Biochemicals. Grades: Plant Grade. CAS No. 119262-68-9. Pack Sizes: 10mg. Molecular Formula: C22H20O12, Molecular Weight: 476.39. US Biological Life Sciences. | Worldwide |
| SC-VC-PAB-DM1 | SC-VC-PAB-DM1 is a agent-linker conjugate for ADC with with potent antitumor activity by using DM1 (Mertansine, a tubulin inhibitor) , linked via the ADC linker SC-VC-PAB[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2259318-47-1. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-126693. | |
| SC-VC-PAB-MMAE | SC-VC-PAB-MMAE (NHS-VC-PAB-MMAE) is a agent-linker conjugate for ADC with potent antitumor activity by using the anti-mitotic agent, monomethyl auristatin E (MMAE, a tubulin inhibitor), linked via the cleavable linker SC-VC-PAB[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: NHS-VC-PAB-MMAE. CAS No. 2259318-46-0. Pack Sizes: 1 mg; 5 mg; 10 mg; 50 mg. Product ID: HY-126681. | |
| S-Cyanoethyl-L-cysteine | S-Cyanoethyl-L-cysteine. Group: Biochemicals. Alternative Names: 2-Amino-3-(2-cyano-ethylsulfanyl)-propionic acid. Grades: Highly Purified. CAS No. 3958-13-2. Pack Sizes: 10mg, 25mg, 50mg, 100mg, 250mg. Molecular Formula: C6H10N2O2S. US Biological Life Sciences. | Worldwide |
| S-Cyanoethyl-L-cysteine (2-Amino-3-(2-cyano-ethylsulfanyl)-propionic Acid) | S-Cyanoethyl-L-cysteine (2-Amino-3-(2-cyano-ethylsulfanyl)-propionic Acid). Group: Biochemicals. Alternative Names: 2-Amino-3-(2-cyano-ethylsulfanyl)-propionic Acid. Grades: Highly Purified. CAS No. 3958-13-2. Pack Sizes: 25mg. US Biological Life Sciences. | Worldwide |
| Scyliorhinin II | Scyliorhinin II, a cyclic Tachykinin peptide, is a potent NK3 receptor agonist. Synonyms: L-Methioninamide, L-seryl-L-prolyl-L-seryl-L-asparaginyl-L-seryl-L-lysyl-L-cysteinyl-L-prolyl-L-α-aspartylglycyl-L-prolyl-L-α-aspartyl-L-cysteinyl-L-phenylalanyl-L-valylglycyl-L-leucyl-, cyclic(7→13)-disulfide; Ser-Pro-Ser-Asn-Ser-Lys-Cys-Pro-Asp-Gly-Pro-Asp-Cys-Phe-Val-Gly-Leu-Met-NH2. Grade: ≥98%. CAS No. 112748-19-3. Molecular formula: C77H119N21O26S3. Mole weight: 1851.09. |  |
| scyllo-inosamine 4-kinase | Also acts on streptamine, 2-deoxystreptamine and 1D-1-guanidino-3-amino-1,3-dideoxy-scyllo-inositol. Group: Enzymes. Synonyms: scyllo-inosamine kinase (phosphorylating); scyllo-inosamine kinase; ATP:inosamine phosphotransferase. Enzyme Commission Number: EC 2.7.1.65. CAS No. 37278-08-3. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3096; scyllo-inosamine 4-kinase; EC 2.7.1.65; 37278-08-3; scyllo-inosamine kinase (phosphorylating); scyllo-inosamine kinase; ATP:inosamine phosphotransferase. Cat No: EXWM-3096. |  |
| scyllo-inosamine-4-phosphate amidinotransferase | 1D-1-Guanidino-3-amino-1,3-dideoxy-scyllo-inositol 6-phosphate, streptamine phosphate and 2-deoxystreptamine phosphate can also act as acceptors; canavanine can act as donor. Group: Enzymes. Synonyms: L-arginine:inosamine-P-amidinotransferase; inosamine-P amidinotransferase; L-arginine:inosamine phosphate amidinotransferase; inosamine-phosphate amidinotransferase. Enzyme Commission Number: EC 2.1.4.2. CAS No. 52227-63-1. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2023; scyllo-inosamine-4-phosphate amidinotransferase; EC 2.1.4.2; 52227-63-1; L-arginine:inosamine-P-amidinotransferase; inosamine-P amidinotransferase; L-arginine:inosamine phosphate amidinotransferase; inosamine-phosphate amidinotransferase. Cat No: EXWM-2023. | |
| Scyllo-Inositol | Scyllo-Inositol is an inhibitor that targets the aggregation of misfolded proteins (such as α-synuclein and Amyloid-β), is orally effective, and can cross the blood-brain barrier. Scyllo-Inositol can selectively bind to and stabilize non-toxic oligomers, preventing them from converting into toxic fibers, exerting protein homeostasis regulation and neuroprotective activity. Scyllo-Inositol binds to the hydrophobic region of pathogenic proteins, inhibits protein aggregation, and promotes lysosome- and proteasome-mediated degradation pathways, thereby reducing neurotoxicity. Scyllo-Inositol can be used in the study of neurodegenerative diseases such as Parkinson's disease, Alzheimer's disease, and Huntington's disease[1][2][3]. Uses: Scientific research. Category: Signaling pathways. CAS No. 488-59-5. Pack Sizes: 10 mM * 1 mL in Water; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-W010041. | |
| scyllo-inositol-[1-d] | scyllo-inositol-[1-d]. Synonyms: [1-2H]scyllo-inositol; scyllo-inositol-1-d. Molecular formula: C6H11DO6. Mole weight: 181.16. | |
| scyllo-Inositol-1-d | scyllo-Inositol-1-d. Group: Biochemicals. Alternative Names: Scyllitol-1-d; Cocositol-1-d; Quercinitol-1-d; 1,3,5/2,4,6-Hexahydroxycyclohexane-1-d; scyllo-Cyclohexanehexol. Grades: Highly Purified. Pack Sizes: 2.5mg. US Biological Life Sciences. | Worldwide |
| scyllo-inositol 2-dehydrogenase (NAD+) | The enzyme, found in the bacterium Bacillus subtilis, has no activity with NADP+ [cf. EC 1.1.1.371, scyllo-inositol 2-dehydrogenase (NADP+)]. It is part of a scyllo-inositol degradation pathway leading to acetyl-CoA. Group: Enzymes. Synonyms: iolX (gene name). Enzyme Commission Number: EC 1.1.1.370. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0288; scyllo-inositol 2-dehydrogenase (NAD+); EC 1.1.1.370; iolX (gene name). Cat No: EXWM-0288. | |
| scyllo-inositol 2-dehydrogenase (NADP+) | The enzyme, found in the bacterium Bacillus subtilis, has no activity with NAD+ [cf. EC 1.1.1.370, scyllo-inositol 2-dehydrogenase (NAD+)]. Group: Enzymes. Synonyms: iolW (gene name). Enzyme Commission Number: EC 1.1.1.371. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0289; scyllo-inositol 2-dehydrogenase (NADP+); EC 1.1.1.371; iolW (gene name). Cat No: EXWM-0289. | |
| scymnol sulfotransferase | The enzyme from the shark Heterodontus portusjacksoni is able to sulfate the C27 bile salts 5β-scymnol (the natural bile salt) and 5α-cyprinol (the carp bile salt). Enzyme activity is activated by Mg2+ but inhibited by the product 5β-scymnol sulfate. Group: Enzymes. Enzyme Commission Number: EC 2.8.2.32. CAS No. 220581-70-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3392; scymnol sulfotransferase; EC 2.8.2.32; 220581-70-4. Cat No: EXWM-3392. | |
| Scyphostatin | It is a mammalian N-SMase inhibitor produced by the strain of Trichopeziza mollissima SANK 13892. It inhibits N-SMase with IC50 of 1.0 μmol/L. Synonyms: (2E,4E,6E,12E)-(8R,10S,14R)-8,10,12,14-Tetramethyl-hexadeca-2,4,6,12-tetraenoic acid [(S)-1-hydroxymethyl-2-((1S,2S,6S)-2-hydroxy-3-oxo-7-oxa-bicyclo[4.1.0]hept-4-en-2-yl)-ethyl]-amide; (2'S,2''E,4S,4''E,5S,6S,6''E,8''R,10''S,12''E,14''R)-4,5-epoxy-6-hydroxy-6-[3'-hydroxy-2'-(8'',10'',12'',14''-tetramethylhexadeca-2'',4'',6'',12''-tetraenoylamino)-propyl]-2-cyclohexen-1-one; (+)-scyphostatin. CAS No. 169062-93-5. Molecular formula: C29H43NO5. Mole weight: 485.66. | |
| Scytalidin | It is a terpenoid antibiotic produced by the strain of Scytalidium sp. FSC-470. It has antifungal effect. The antibacterial activity is strongest when the pH value of liquid determination is 3.5, and the activity decreases when the pH value increases. Synonyms: Scytalidic-acid; NSC-236264; 1H-Cyclonona(1,2-c:5,6-c')difuran-1,3,6,8(4H)-tetrone, 10-butyl-5,9,10,11-tetrahydro-10-hydroxy-4-pentyl-, (4S,10R)-; 1H-Cyclonona[1,2-c:5,6-c']difuran-1,3,6,8(4H)-tetrone, 10-butyl-5,9,10,11-tetrahydro-10-hydroxy-4-pentyl-, [4S-(4R*,10S*)]-. CAS No. 39012-16-3. Molecular formula: C22H28O7. Mole weight: 404.45. | |
| scytalidopepsin A | Isolated from the imperfect fungus Scytalidium lignicolum. Not inhibited by pepstatin-Ac, methyl 2-diazoacetamidohexanoate or 1,2-epoxy-3-(p-nitrophenyl)propane. A related enzyme from the same organism, proteinase C, is also insensitive to these inhibitors and has Mr = 406,000. Group: Enzymes. Synonyms: Scytalidium aspartic proteinase A; Scytalidium lignicolum aspartic proteinase; Scytalidium lignicolum aspartic proteinase A-2; Scytalidium lignicolum aspartic proteinase A-I; Scytalidium lignicolum aspartic proteinase C; Scytalidium lignicolum carboxyl proteinase; Scytalidium lignicolum acid proteinase. Enzyme Commission Number: EC 3.4.23.31. CAS No. 42613-34-3. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4269; scytalidopepsin A; EC 3.4.23.31; 42613-34-3; Scytalidium aspartic proteinase A; Scytalidium lignicolum aspartic proteinase; Scytalidium lignicolum aspartic proteinase A-2; Scytalidium lignicolum aspartic proteinase A-I; Scytalidium lignicolum aspartic proteinase C; Scytalidium lignicolum carboxyl proteinase; Scytalidium lignicolum acid proteinase. Cat No: EXWM-4269. | |
| scytalidopepsin B | A second endopeptidase from Scytalidium lignicolum (see scytalidopepsin A) that is insensitive to pepstatin and methyl 2-diazoacetamidohexanoate. 1,2-Epoxy-3-(p-nitrophenoxy)propane reacts with Glu53, which replaces one of the aspartic residues at the active centre. One of the smallest aspartic endopeptidases active as the monomer, with Mr 22,000. Similarly inhibitor-resistant endopeptidases are found in the basidiomycetes Lentinus edodes and Ganoderma lucidum, and in Polyporus tulipiferae, a second endopeptidase distinct from polyporopepsin, but these are of typical aspartic endopeptidase size, Mr about 36,000. Type example of peptidase family G1. Group: Enzymes. Synonyms: Scytalidium aspartic proteinase B; Ganoderma lucidum carboxyl proteinase; Ganoderma lucidum aspartic proteinase; Scytalidium lignicolum aspartic proteinase B; SLB. Enzyme Commission Number: EC 3.4.23.32. CAS No. 104781-89-7. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4270; scytalidopepsin B; EC 3.4.23.32; 104781-89-7; Scytalidium aspartic proteinase B; Ganoderma lucidum carboxyl proteinase; Ganoderma lucidum aspartic proteinase; Scytalidium lignicolum aspartic proteinase B; SLB. Cat No: EXWM-4270. | |
| Scytalol A | It is produced by the strain of Scytalidium sp. 36-93. It selectively inhibits biosynthesis of dihydroxynaphthalene melanin in Lachnellula sp. A32-89, but does not inhibit the growth of the strain. Synonyms: 10H-Naphtho[2,3-c]pyran-10-one,1,3,4,4a,5,10a-hexahydro-3,5,9-trihydroxy-7-methoxy-3-methyl-, (3R,4aS,5S,10aR)-rel-(+)-. CAS No. 208183-19-1. Molecular formula: C15H18O6. Mole weight: 294.30. | |
| Scytalol B | It is produced by the strain of Scytalidium sp. 36-93. Synonyms: 10H-Naphtho[2,3-c]pyran-10-one,1,3,4,4a,5,10a-hexahydro-5,9-dihydroxy-3,7-dimethoxy-3-methyl-, (3R,4aS,5S,10aR)-rel-(+)-. CAS No. 208183-20-4. Molecular formula: C16H20O6. Mole weight: 308.33. | |
| Scytalol C | It is produced by the strain of Scytalidium sp. 36-93. Synonyms: Naphtho[1,2-b]furan-5(4H)-one,2,3,3a,9btetrahydro-6-hydroxy-2,8-dimethoxy-4-(methoxymethylene)-2-methyl-, (2R,3aR,4E,9bR)-rel-(-)-. CAS No. 208183-22-6. Molecular formula: C17H20O6. Mole weight: 320.34. | |
| Scytalol D | It is produced by the strain of Scytalidium sp. 36-93. It selectively inhibits biosynthesis of dihydroxynaphthalene melanin in Lachnellula sp. A32-89, but does not inhibit the growth of the strain. Synonyms: 1(2H)-Naphthalenone, 3,4-dihydro-4,8-dihydroxy-6-methoxy-3-(2-oxopropyl)-, (3R,4R)-rel-(+)-. CAS No. 208183-24-8. Molecular formula: C14H16O5. Mole weight: 264.27. | |
| scytalone dehydratase | Involved, with EC 1.1.1.252 tetrahydroxynaphthalene reductase, in the biosynthesis of melanin in pathogenic fungi. Group: Enzymes. Synonyms: scytalone 7,8-hydro-lyase. Enzyme Commission Number: EC 4.2.1.94. CAS No. 118901-79-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5078; scytalone dehydratase; EC 4.2.1.94; 118901-79-4; scytalone 7,8-hydro-lyase. Cat No: EXWM-5078. | |
| Sd1 | Sd1 is an antibacterial peptide isolated from Saccharum officinarum (Sugarcane). It has activity against fungi. Synonyms: Arg-Tyr-Cys-Leu-Ser-Gln-Ser-His-Arg-Phe-Lys-Gly-Leu-Cys-Met-Ser-Ser-Ser-Asn-Cys-Ala-Asn-Val-Cys-Gln-Thr-Glu-Asn-Phe-Pro-Gly-Gly-Glu-Cys-Lys-Ala-Asp-Gly-Ala-Thr-Arg-Lys-Cys-Phe-Cys-Lys-Lys-Ile-Cys. | |
| SD 1008 | SD 1008. Group: Biochemicals. Grades: Purified. CAS No. 960201-81-4. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| SD2 | Sd2 is an antibacterial peptide isolated from Helianthus annuus (Common sunflower). It has activity against fungi. Synonyms: Asn-Glu-Met-Gly-Gly-Pro-Leu-Val-Val-Glu-Ala-Arg-Thr-Cys-Glu-Ser-Gln-Ser-His-Lys-Phe-Lys-Gly-Thr-Cys-Leu-Ser-Asp-Thr-Asn-Cys-Ala-Asn-Val-Cys-His-Ser-Glu-Arg-Phe-Ser-Gly-Gly-Lys-Cys-Arg-Gly-Phe-Arg-Arg-Arg-Cys-Phe-Cys-Thr-Thr-His-Cys. | |
| SD 208 | SD 208. Group: Biochemicals. Grades: Purified. CAS No. 627536-09-8. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| SD-208 | SD-208 is a selective TGF-βRI (ALK5) inhibitor with IC50 of 48 nM, and > 100-fold selectivity over TGF-βRII. Uses: Scientific research. Category: Signaling pathways. CAS No. 627536-09-8. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-13227. | |
| Sd3 | Sd3 is an antibacterial peptide isolated from Saccharum officinarum (Sugarcane). It has activity against fungi. Synonyms: Arg-His-Arg-His-Cys-Phe-Ser-Gln-Ser-His-Lys-Phe-Val-Gly-Ala-Cys-Leu-Arg-Glu-Ser-Asn-Cys-Glu-Asn-Val-Cys-Lys-Thr-Glu-Gly-Phe-Pro-Ser-Gly-Glu-Cys-Lys-Trp-His-Gly-Ile-Val-Ser-Lys-Cys-His-Cys-Lys-Arg-Ile-Cys. | |
| SD-36 | SD-36 is a potent and efficacious STAT3 PROTAC degrader (Kd=~50 nM), and demonstrates high selectivity over other STAT members. SD-36 also effectively degrades mutated STAT3 proteins in cells and suppresses the transcriptional activity of STAT3 (IC50=10 nM). SD-36 exerts robust anti-tumor activity, and achieves complete and long-lasting tumor regression in mouse tumor models. SD-36 is composed of the STAT3 inhibitor SI-109, a linker, and an analog of Cereblon ligand Lenalidomide for E3 ubiquitin ligase[1]. SD-36 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Category: Signaling pathways. CAS No. 2429877-44-9. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg. Product ID: HY-129602. | |
| SD-436 | SD-436 is a highly selective and efficacious STAT3 PROTAC degrader (DC50: 0.5 μM), with IC50 of 19 nM (STAT3), 270 nM (STAT1), 360 nM (STAT4), >10 μM (STAT5) and >10 μM (STAT6). SD-436 promotes ubiquitination and degradation of STAT3, and induces tumor regression. SD-436 can be used for tumor research, such as leukemia and lymphoma (Pink: STAT3 ligand (HY-169361); Blue: E3 ligase ligand (HY-43722); Black: linker (HY-147052)[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2497585-50-7. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-169360. | |
| SD-70 | SD-70 is an inhibitor for histone demethylase JMJD2C and exhibits antitumor efficacy. SD-70 inhibits viability of cancer cells CWR22Rv1 (9% cell survival at 10 μM), PC3 (14% cell survival at 2 μM) and DU145 (26% cell survival at 2 μM)[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 332173-89-4. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-121522. | |
| SD-91 | SD-91 (STAT3 degrader-2), a product of the hydrolysis of SD-36 (HY-129602), is a selective PROTAC-based STAT3 degrader with a Ki of 5.5 nM. SD-91 displays >300-fold selectivity over other STAT family protein members. SD-91 potently induces degradation of STAT3 protein in cells. SD-91 has anticancer effects, such as myeloid leukemia, lymphoma (Pink: ligand for target protein (HY-150895); Black: linker; Blue: E3 ligase ligand; E3 ligase ligand+linker: HY-176506)[1][2]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: STAT3 degrader-2. CAS No. 2497583-03-4. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg. Product ID: HY-150251. | |
| S-Decyanomethyl-S-(1-methyl-1H-tetrazol-5-yl) cefmetazole | S-Decyanomethyl-S-(1-methyl-1H-tetrazol-5-yl) cefmetazole. Group: Biochemicals. Alternative Names: (6R-cis)-7-Methoxy-7-[[[(1-methyl-1H-tetrazol-5-yl)thio]acetyl]amino]-3-[[(1-methyl-1H-tetrazol-5-yl)thio]methyl]-8-oxo-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic acid. Grades: Highly Purified. CAS No. 74228-11-8. Pack Sizes: 5mg, 10mg, 25mg, 50mg, 100mg. Molecular Formula: C15H18N10O5S3. US Biological Life Sciences. | Worldwide |
| S-Deoxo-6-oxo-fulvestrant | Fulvestrant impurity E derivative. Used in the preparation of steroids precursor with hormonal activity. Group: Biochemicals. Alternative Names: (7α,17 β ) -3, 17-Dihydroxy-7-[9-[ (4, 4, 5, 5, 5-pentafluoropentyl) thio]nonyl]-estra-1, 3, 5 (10) -trien-6-one. Grades: Highly Purified. CAS No. 1107606-70-1. Pack Sizes: 2.5mg. US Biological Life Sciences. | Worldwide |
| S-Desmethyl Citalopram Hydrochloride | A metabolite of Citalopram, an inhibitor of serotonin (5-HT) uptake. Used as an antidepressant. Group: Biochemicals. Alternative Names: 1S)-1-(4-Fluorophenyl)-1,3-dihydro-1-[3-(methylamino)propyl]-5-isobenzo-furancarbonitrile Hydrochloride; (S)-1-(3-Methylaminopropyl)-1-(4-fluorophenyl)-1,3-dihydroisobenzofuran-5-carbonitrile Hydrochloride. Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| SDF-1α (human) | SDF-1α (human) is a synthetic peptide containing a 1:50 ratio of BSA (low levels of endotoxins) and is a multifunctional cytokine signaling through CXCR4. SDF-1α is involved in many pathological conditions such as rheumatoid arthritis, pulmonary fibrosis, metastasis and leukemia cell progression. Internalization of SDF-1α dependence of CXCR4 HIV coreceptor contributes to inhibition of HIV replication. Synonyms: Stromal Cell-Derived Factor-1α (human); H-Lys-Pro-Val-Ser-Leu-Ser-Tyr-Arg-Cys-Pro-Cys-Arg-Phe-Phe-Glu-Ser-His-Val-Ala-Arg-Ala-Asn-Val-Lys-His-Leu-Lys-Ile-Leu-Asn-Thr-Pro-Asn-Cys-Ala-Leu-Gln-Ile-Val-Ala-Arg-Leu-Lys-Asn-Asn-Asn-Arg-Gln-Val-Cys-Ile-Asp-Pro-Lys-Leu-Lys-Trp-Ile-Gln-Glu-Tyr-Leu-Glu-Lys-Ala-Leu-Asn-Lys-OH (Disulfide bridge: Cys9-Cys34, Cys11-Cys50). Grade: ≥95%. CAS No. 1268129-65-2. Molecular formula: C356H578N106O93S4. Mole weight: 7959.43. | |
| SDGRG | SDGRG has been used as a control peptide which does not affect integrin function, in various studies. Synonyms: S-D-G-R-G; H-SER-ASP-GLY-ARG-GLY-OH. Grade: >95%. CAS No. 108608-63-5. Molecular formula: C17H30N8O9. Mole weight: 490.5. | |
| SDH-IN-1 | SDH-IN-1 (compound 4i) is a succinate dehydrogenase (SDH) inhibitor with an IC50 of 4.53 μM. SDH-IN-1 has potent antifungal activities. SDH-IN-1 displays potent activity against S. sclerotiorum (EC50 of 0.14 mg/L)[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2685795-52-0. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-139983. | |
| S-Diphenylmethyl-L-cysteine | S-Diphenylmethyl-L-cysteine. Group: Biochemicals. Alternative Names: L-Cys(Dpm)-OH. Grades: Highly Purified. CAS No. 5191-80-0. Pack Sizes: 500mg, 1g. US Biological Life Sciences. | Worldwide |
| S-Diphenylmethyl-L-cysteine | The S-diphenylmethyl group is one of the most effective S-protecting groups for cysteine. Synonyms: L-Cys(Dpm)-OH; (R)-2-Amino-3-(Benzhydrylthio)Propanoic Acid. Grade: ≥ 99% (TLC). CAS No. 5191-80-0. Molecular formula: C16H17NO2S. Mole weight: 287.38. | |
| S-Diphenylmethyl-L-cysteine 99+% (TLC) | S-Diphenylmethyl-L-cysteine 99+% (TLC). Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 250mg, 1g. US Biological Life Sciences. | Worldwide |
| S-D-Lactoylglutathione | S-D-Lactoylglutathione is a crucial intermediate metabolite of the glyoxalase (Glo) system. S-D-Lactoylglutathione acts as a "bridge molecule" for the conversion of methylglyoxal (MGO) into non-toxic D-lactic acid by continuous catalysis from Glo1 to Glo2, preventing cell damage caused by the accumulation of MGO[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: S-Lactylglutathione; (R)-S-Lactoylglutathione. CAS No. 41656-56-8. Pack Sizes: 5 mg; 10 mg. Product ID: HY-185057. | |
| SDM25N hydrochloride | SDM25N hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 342884-71-3. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| SDM-8 | SDM-8 is a difluoro-analog of UCB-J (HY-136873).SDM-8 shows high SV2A binding affinity with a Ki of 0.58 nM. SDM-8 can be used in the study of Alzheimer's disease[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2242777-37-1. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-167830. | |
| SDMA | SDMA (Symmetric dimethylarginine) is an endogenous inhibitor of nitric oxide (NO) synthase activity. SDMA, a novel kidney biomarker, permits earlier diagnosis of kidney disease than traditional creatinine testing. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Symmetric dimethylarginine; NG,NG'-Dimethyl-L-arginine. CAS No. 30344-00-4. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-101410. | |
| SDMA-d6 | SDMA-d6 is the deuterium labeled SDMA. SDMA (Symmetric dimethylarginine) is an endogenous inhibitor of nitric oxide (NO) synthase activity[1][2]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Symmetric dimethylarginine-d6; NG,NG'-Dimethyl-L-arginine-d6. CAS No. 1331888-08-4. Pack Sizes: 1 mg. Product ID: HY-101410S. | |
| SDS (Sodium dodecyl sulfate) | 500g Pack Size. Group: Detergents. Formula: C12H25NaO4S. CAS No. 151-21-3. Prepack ID 15171947-500g. Molecular Weight 288.38. See USA prepack pricing. |  |
| SDS (Sodium dodecyl sulfate) | 1kg Pack Size. Group: Detergents. Formula: C12H25NaO4S. CAS No. 151-21-3. Prepack ID 15171947-1kg. Molecular Weight 288.38. See USA prepack pricing. | |
| SDS (Sodium dodecyl sulfate) Ultrapure | 100g Pack Size. Group: Biochemicals, Detergents, Reagents. Formula: C12H26O4S.Na. CAS No. 151-21-3. Prepack ID 10325163-100g. Molecular Weight 288.38. See USA prepack pricing. | |
| SDS (Sodium dodecyl sulfate) Ultrapure | 500g Pack Size. Group: Biochemicals, Detergents, Reagents. Formula: C12H26O4S.Na. CAS No. 151-21-3. Prepack ID 10325163-500g. Molecular Weight 288.38. See USA prepack pricing. | |
| SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a 32-amino acid peptide. Synonyms: Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser. Grade: >98%. Molecular formula: C151H236N40O50S. Mole weight: 3443.84. | |
| SDZ 205-557 hydrochloride | SDZ 205-557 hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 1197334-02-3. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| SDZ 21009 | SDZ 21009. Group: Biochemicals. Grades: Purified. CAS No. 39731-05-0. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| SDZ NKT 343 | SDZ NKT 343. Group: Biochemicals. Grades: Purified. CAS No. 180046-99-5. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| SDZ SER 082 | SDZ SER 082. Group: Biochemicals. Alternative Names: (7aR,11aS)-rel-4,5,7a,8,9,10,11,11a-Octahydro-10-methyl-7H-indolo[1,7-bc][2,6]naphthyridine. Grades: Highly Purified. CAS No. 141474-54-6. Pack Sizes: 10mg. Molecular Formula: C15H20N2, Molecular Weight: 228.33. US Biological Life Sciences. | Worldwide |
| SDZ WAG 994 | SDZ WAG 994. Group: Biochemicals. Grades: Purified. CAS No. 130714-47-5. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| SE-7552 | SE-7552, a 2-(difluoromethyl)-1,3,4-oxadiazole (DFMO) derivative, is an orally active, highly selective, non-hydroxamate HDAC6 inhibitor with an IC50 of 33 nM. SE-7552 is greater than 850-fold selectivity versus all other known HDAC isozymes. SE-7552 is capable of blocking multiple myeloma growth in vivo. SE-7552 acts as an anti-obesity agent in diet-induced obese mice[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2243575-79-1. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-161305. | |
| SEA0400 | SEA0400 is a novel and selective inhibitor of the Na+-Ca2+ exchanger (NCX), inhibiting Na+-dependent Ca2+ uptake in cultured neurons, astrocytes, and microglia with IC50s of from 5 to 33 nM. Uses: Scientific research. Category: Signaling pathways. CAS No. 223104-29-8. Pack Sizes: 10 mM * 1 mL in DMSO; 2 mg; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-15515. | |
| SEA0400 (Standard) | SEA0400 (Standard) is the analytical standard of SEA0400. This product is intended for research and analytical applications. SEA0400 is a novel and selective inhibitor of the Na+-Ca2+ exchanger (NCX), inhibiting Na+-dependent Ca2+ uptake in cultured neurons, astrocytes, and microglia with IC50s of from 5 to 33 nM. Uses: Scientific research. Category: Signaling pathways. CAS No. 223104-29-8. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15515R. | |
| Sea Buckthorn Extract (Ratio) | Sea Buckthorn Extract (Ratio). Group: Others. Purity: 4:1~20:1. Sea Buckthorn Extract (Ratio). Cat No: EXTW-076. | |
| Sea buckthorn Powder | Sea buckthorn powder takes sea buckthorn as raw material, adopts spray drying technology, low temperature physical grinding technology, instant grinding, to obtain edible high quality avocado powder. Product ID: CDF4-0230. Category: Flavour. Product Keywords: Flavor Enhancers; Sea buckthorn Powder; CDF4-0230; Flavour;. Grade: Food Grade. Color: Aurantium powder. Physical State: powder. Storage: Room Temperature. Applications: Sea buckthorn powder has good fluidity, good taste, easy to dissolve, easy to preserve, widely used in health nutrition, infant food, solid drinks. |  |
| Seabuckthorn Powder | Seabuckthorn powder is a kind of pure natural active components extracted from seabuckthorn seeds with high nutrition and economic value. The nutrient component of seabuckthorn fruit juice powder is plentiful which including multiple kinds of vitamin, fatty acid, microelement, flavone compounds and many kinds of amino acid needed by human bodies. Group: Others. Seabuckthorn Powder; Hippophae rhamnoides L. Cat No: EXTC-084. | |
| Sea Buckthorn Powder | Sea buckthorn Powder is fresh squeezed juice, made by spray drying. Seabuckthorn contains all the nutrients. Sea buckthorn is rich in protein, 20 kinds of amino acids it contains, including eight kinds of essential amino acids. Its VC content is called "king of fruits", the content of vitamin E is 30 times yarn soybean oil, vitamin B1 is 2 times strawberries; others also contains vitamin B2, vitamin P, folic acid, and trace elements and leaves amides unsaturated fatty acids. Group: Others. Sea Buckthorn Powder. Cat No: EXTC-145. | |
| Sea Clean 2 | 5lt Pack Size. Group: Analytical Reagents. Prepack ID 90023807-5lt. See USA prepack pricing. | |
| Sea Clean 2 (25lt) | 25lt Pack Size. Group: Analytical Reagents. Prepack ID 90023808-25lt. See USA prepack pricing. | |
| Sea Cucumber Extract | Sea Cucumber Extract. Group: Others. Purity: 5:1,10:1, 20:1. or polysaccharide 50%, 60%. Appearance: Brown powder. Sea Cucumber Extract. Cat No: EXTC-127. | |
| Sea cucumber peptide | Sea cucumber peptide is a product of wild sea cucumber as raw material and processed by enzymatic hydrolysis technology. Sea cucumber peptide contains rich polypeptide, sea cucumber polysaccharide and other components. Product ID: CDF4-0247. Category: Protein peptide. Product Keywords: Protein Peptides; Sea cucumber peptide; CDF4-0247; Protein peptide;. Applications: It is widely used in food, cosmetics and medicine. | |
Our database is helping our users find suppliers everyday.
