A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| S-Decyanomethyl-S-(1-methyl-1H-tetrazol-5-yl) cefmetazole | S-Decyanomethyl-S-(1-methyl-1H-tetrazol-5-yl) cefmetazole. Group: Biochemicals. Alternative Names: (6R-cis)-7-Methoxy-7-[[[(1-methyl-1H-tetrazol-5-yl)thio]acetyl]amino]-3-[[(1-methyl-1H-tetrazol-5-yl)thio]methyl]-8-oxo-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic acid. Grades: Highly Purified. CAS No. 74228-11-8. Pack Sizes: 5mg, 10mg, 25mg, 50mg, 100mg. Molecular Formula: C15H18N10O5S3. US Biological Life Sciences. |  Worldwide |
| S-Deoxo ?6-Fulvestrant | S-Deoxo ?6-Fulvestrant is an impurity of Fulvestrant, which is a drug for breast cancer. Alternative Names: 7-[9-[(4,4,5,5,5-Pentafluoropentyl)sulfenyl]nonyl]estra-1,3,5(10),6-tetraene-3,17β-diol; S-Deoxo Fulvestrant Impurity E. CAS No. 2170200-16-3. Molecular formula: C32H45F5O2S. Mole weight: 588.75. |  |
| S-Deoxo-6-oxo-fulvestrant | Fulvestrant impurity E derivative. Used in the preparation of steroids precursor with hormonal activity. Group: Biochemicals. Alternative Names: (7α,17 β ) -3, 17-Dihydroxy-7-[9-[ (4, 4, 5, 5, 5-pentafluoropentyl) thio]nonyl]-estra-1, 3, 5 (10) -trien-6-one. Grades: Highly Purified. CAS No. 1107606-70-1. Pack Sizes: 2.5mg. US Biological Life Sciences. | Worldwide |
| S-Deoxo Fulvestrant | S-Deoxo Fulvestrant is a derivative of Fulvestrant, an estrogen receptor antagonist used as a medication indicated for the treatment of hormone receptor (HR)-positive metastatic breast cancer in postmenopausal women. Alternative Names: (7a,17b)-7-[9-[(4,4,5,5,5-Pentafluoropentyl)thio]nonyl]-estra-1,3,5(10)-triene-3,17-diol. Grades: 95%. CAS No. 153004-31-0. Molecular formula: C32H47F5O2S. Mole weight: 590.77. | |
| S-Desmethyl Citalopram Hydrochloride | A metabolite of Citalopram, an inhibitor of serotonin (5-HT) uptake. Used as an antidepressant. Group: Biochemicals. Alternative Names: 1S)-1-(4-Fluorophenyl)-1,3-dihydro-1-[3-(methylamino)propyl]-5-isobenzo-furancarbonitrile Hydrochloride; (S)-1-(3-Methylaminopropyl)-1-(4-fluorophenyl)-1,3-dihydroisobenzofuran-5-carbonitrile Hydrochloride. Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| SDF-1α (human) | SDF-1α (human) is a synthetic peptide containing a 1:50 ratio of BSA (low levels of endotoxins) and is a multifunctional cytokine signaling through CXCR4. SDF-1α is involved in many pathological conditions such as rheumatoid arthritis, pulmonary fibrosis, metastasis and leukemia cell progression. Internalization of SDF-1α dependence of CXCR4 HIV coreceptor contributes to inhibition of HIV replication. Alternative Names: Stromal Cell-Derived Factor-1α (human); H-Lys-Pro-Val-Ser-Leu-Ser-Tyr-Arg-Cys-Pro-Cys-Arg-Phe-Phe-Glu-Ser-His-Val-Ala-Arg-Ala-Asn-Val-Lys-His-Leu-Lys-Ile-Leu-Asn-Thr-Pro-Asn-Cys-Ala-Leu-Gln-Ile-Val-Ala-Arg-Leu-Lys-Asn-Asn-Asn-Arg-Gln-Val-Cys-Ile-Asp-Pro-Lys-Leu-Lys-Trp-Ile-Gln-Glu-Tyr-Leu-Glu-Lys-Ala-Leu-Asn-Lys-OH (Disulfide bridge: Cys9-Cys34, Cys11-Cys50). Grades: ≥95%. CAS No. 1268129-65-2. Molecular formula: C356H578N106O93S4. Mole weight: 7959.43. | |
| SDGRG | SDGRG has been used as a control peptide which does not affect integrin function, in various studies. Alternative Names: S-D-G-R-G; H-SER-ASP-GLY-ARG-GLY-OH. Grades: >95%. CAS No. 108608-63-5. Molecular formula: C17H30N8O9. Mole weight: 490.5. | |
| SDH-IN-1 | SDH-IN-1 (compound 4i) is a succinate dehydrogenase (SDH) inhibitor with an IC50 of 4.53 μM. SDH-IN-1 has potent antifungal activities. SDH-IN-1 displays potent activity against S. sclerotiorum (EC50 of 0.14 mg/L)[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2685795-52-0. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-139983. |  |
| S-Dihydrodaidzein | S-Dihydrodaidzein is a natural product found in Pericopsis mooniana. Alternative Names: S-2,3-Dihydro-7-hydroxy-3-(4-hydroxyphenyl)-4H-1-Benzopyran-4-one; (S)-7-Hydroxy-3-(4-hydroxyphenyl)chroman-4-one; (S)-dihydrodaidzein; (S)-4',7-dihydroxyisoflavanone; 4H-1-Benzopyran-4-one, 2,3-dihydro-7-hydroxy-3-(4-hydroxyphenyl)-, (3S)-; (3S)-7-Hydroxy-3-(4-hydroxyphenyl)-2,3-dihydro-4H-chromen-4-one. Grades: ≥95%. CAS No. 879559-75-8. Molecular formula: C15H12O4. Mole weight: 256.25. | |
| S-Diphenylmethyl-L-cysteine | S-Diphenylmethyl-L-cysteine. Group: Biochemicals. Alternative Names: L-Cys(Dpm)-OH. Grades: Highly Purified. CAS No. 5191-80-0. Pack Sizes: 500mg, 1g. US Biological Life Sciences. | Worldwide |
| S-Diphenylmethyl-L-cysteine | The S-diphenylmethyl group is one of the most effective S-protecting groups for cysteine. Alternative Names: L-Cys(Dpm)-OH; (R)-2-Amino-3-(Benzhydrylthio)Propanoic Acid. Grades: ≥ 99% (TLC). CAS No. 5191-80-0. Molecular formula: C16H17NO2S. Mole weight: 287.38. | |
| S-Diphenylmethyl-L-cysteine 99+% (TLC) | S-Diphenylmethyl-L-cysteine 99+% (TLC). Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 250mg, 1g. US Biological Life Sciences. | Worldwide |
| S-D-Lactoylglutathione | S-D-Lactoylglutathione is a crucial intermediate metabolite of the glyoxalase (Glo) system. S-D-Lactoylglutathione acts as a "bridge molecule" for the conversion of methylglyoxal (MGO) into non-toxic D-lactic acid by continuous catalysis from Glo1 to Glo2, preventing cell damage caused by the accumulation of MGO[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: S-Lactylglutathione; (R)-S-Lactoylglutathione. CAS No. 41656-56-8. Pack Sizes: 5 mg; 10 mg. Product ID: HY-185057. | |
| SDM25N hydrochloride | SDM25N hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 342884-71-3. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| SDM-8 | SDM-8 is a difluoro-analog of UCB-J (HY-136873).SDM-8 shows high SV2A binding affinity with a Ki of 0.58 nM. SDM-8 can be used in the study of Alzheimer's disease[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2242777-37-1. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-167830. | |
| SDMA | SDMA (Symmetric dimethylarginine) is an endogenous inhibitor of nitric oxide (NO) synthase activity. SDMA, a novel kidney biomarker, permits earlier diagnosis of kidney disease than traditional creatinine testing. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Symmetric dimethylarginine; NG,NG'-Dimethyl-L-arginine. CAS No. 30344-00-4. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-101410. | |
| SDMA | An endogenous inhibitor of nitric oxide (NO) synthase activity. Alternative Names: (2S)-2-amino-5-[(N,N'-dimethylcarbamimidoyl)amino]pentanoic acid; guanidino-N(1),N(2)-dimethylarginine; N(G1),N(G2)-dimethylarginine; N,N'-dimethylarginine; NG,N'G-dimethyl-L-arginine; omega-N(G),N'(G)-dimethylarginine; sDMA arginine; symmetric dimethylarginine. CAS No. 30344-00-4. Molecular formula: C8H18N4O2. Mole weight: 202.25. | |
| SDMA-d6 | SDMA-d6 is the deuterium labeled SDMA. SDMA (Symmetric dimethylarginine) is an endogenous inhibitor of nitric oxide (NO) synthase activity[1][2]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Symmetric dimethylarginine-d6; NG,NG'-Dimethyl-L-arginine-d6. CAS No. 1331888-08-4. Pack Sizes: 1 mg. Product ID: HY-101410S. | |
| SD Rat Adipose-derived Mesenchymal Stem Cell-derived Exosomes | This product cannot be stored in liquid nitrogen. This product can be stored at -80°C for 12 months and at 4°C for 2 days. Avoid repeated freezing and thawing of this product. Each freeze-thaw cycle may cause loss of exosomes. If the single dose is small, please aliquot it immediately after the first thawing. Product ID: Exo-0006. |  |
| SD Rat Bone Marrow Mesenchymal Stem Cell-derived Exosomes | This product cannot be stored in liquid nitrogen. This product can be stored at -80°C for 12 months and at 4°C for 2 days. Avoid repeated freezing and thawing of this product. Each freeze-thaw cycle may cause loss of exosomes. If the single dose is small, please aliquot it immediately after the first thawing. Product ID: Exo-0005. | |
| SDS (Sodium dodecyl sulfate) | 500g Pack Size. Group: Detergents. Formula: C12H25NaO4S. CAS No. 151-21-3. Prepack ID 15171947-500g. Molecular Weight 288.38. See USA prepack pricing. |  |
| SDS (Sodium dodecyl sulfate) | 1kg Pack Size. Group: Detergents. Formula: C12H25NaO4S. CAS No. 151-21-3. Prepack ID 15171947-1kg. Molecular Weight 288.38. See USA prepack pricing. | |
| SDS (Sodium dodecyl sulfate) Ultrapure | 100g Pack Size. Group: Biochemicals, Detergents, Reagents. Formula: C12H26O4S.Na. CAS No. 151-21-3. Prepack ID 10325163-100g. Molecular Weight 288.38. See USA prepack pricing. | |
| SDS (Sodium dodecyl sulfate) Ultrapure | 500g Pack Size. Group: Biochemicals, Detergents, Reagents. Formula: C12H26O4S.Na. CAS No. 151-21-3. Prepack ID 10325163-500g. Molecular Weight 288.38. See USA prepack pricing. | |
| SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a 32-amino acid peptide. Alternative Names: Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser. Grades: >98%. Molecular formula: C151H236N40O50S. Mole weight: 3443.84. | |
| SDZ 205-557 hydrochloride | SDZ 205-557 hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 1197334-02-3. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| SDZ 21009 | SDZ 21009. Group: Biochemicals. Grades: Purified. CAS No. 39731-05-0. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| SDZ285-428 | SDZ285-428 is a CYP24A1 inhibitor. Alternative Names: SDZ285 428; 4-(4-chlorophenyl)-N-(2-imidazol-1-yl-2-phenylethyl)benzamide; NVP-VID-400; NVP VID 400; NVP-VID-400; NVP-VID 400; NVP-VID400; SDZ285428; SDZ 285428; SDZ-285428; SDZ285-428; SDZ 285-428; SDZ-285-428. CAS No. 174262-13-6. Molecular formula: C24H20ClN3O. Mole weight: 401,894. | |
| SDZ NKT 343 | SDZ NKT 343. Group: Biochemicals. Grades: Purified. CAS No. 180046-99-5. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| SDZ SER 082 | SDZ SER 082. Group: Biochemicals. Alternative Names: (7aR,11aS)-rel-4,5,7a,8,9,10,11,11a-Octahydro-10-methyl-7H-indolo[1,7-bc][2,6]naphthyridine. Grades: Highly Purified. CAS No. 141474-54-6. Pack Sizes: 10mg. Molecular Formula: C15H20N2, Molecular Weight: 228.33. US Biological Life Sciences. | Worldwide |
| SDZ WAG 994 | SDZ WAG 994. Group: Biochemicals. Grades: Purified. CAS No. 130714-47-5. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| SE-7552 | SE-7552, a 2-(difluoromethyl)-1,3,4-oxadiazole (DFMO) derivative, is an orally active, highly selective, non-hydroxamate HDAC6 inhibitor with an IC50 of 33 nM. SE-7552 is greater than 850-fold selectivity versus all other known HDAC isozymes. SE-7552 is capable of blocking multiple myeloma growth in vivo. SE-7552 acts as an anti-obesity agent in diet-induced obese mice[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2243575-79-1. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-161305. | |
| SEA0400 | SEA0400 is a novel and selective inhibitor of the Na+-Ca2+ exchanger (NCX), inhibiting Na+-dependent Ca2+ uptake in cultured neurons, astrocytes, and microglia with IC50s of from 5 to 33 nM. Uses: Scientific research. Category: Signaling pathways. CAS No. 223104-29-8. Pack Sizes: 10 mM * 1 mL in DMSO; 2 mg; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-15515. | |
| SEA0400 (Standard) | SEA0400 (Standard) is the analytical standard of SEA0400. This product is intended for research and analytical applications. SEA0400 is a novel and selective inhibitor of the Na+-Ca2+ exchanger (NCX), inhibiting Na+-dependent Ca2+ uptake in cultured neurons, astrocytes, and microglia with IC50s of from 5 to 33 nM. Uses: Scientific research. Category: Signaling pathways. CAS No. 223104-29-8. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15515R. | |
| Sea-buckthorn extract | Derived from sea-buckthorn berries or seeds. Rich in vitamins and essential fatty acids. Grades: Food grade. Product ID: CDF4-0292. | |
| Sea Buckthorn Extract (Ratio) | Sea Buckthorn Extract (Ratio). Group: Others. Purity: 4:1~20:1. Sea Buckthorn Extract (Ratio). Cat No: EXTW-076. |  |
| Sea buckthorn oil | Extracted from berries or seeds of Hippophae rhamnoides. Contains over 190 bioactives, notably omega - 7 (palmitoleic acid), vitamins C/E, and carotenoids. Powerful antioxidant, moisturiser, and skin - barrier repair agent. Used in anti - aging creams, sun - aftercare, and wound - healing ointments. Grades: Cosmetic grade. Product ID: CDC10-0837. | |
| Sea buckthorn Powder | Sea buckthorn powder takes sea buckthorn as raw material, adopts spray drying technology, low temperature physical grinding technology, instant grinding, to obtain edible high quality avocado powder. Product ID: CDF4-0230. Category: Flavour. Product Keywords: Flavor Enhancers; Sea buckthorn Powder; CDF4-0230; Flavour. Grade: Food Grade. Color: Aurantium powder. Physical State: powder. Storage: Room Temperature. Applications: Sea buckthorn powder has good fluidity, good taste, easy to dissolve, easy to preserve, widely used in health nutrition, infant food, solid drinks. | |
| Seabuckthorn Powder | Seabuckthorn powder is a kind of pure natural active components extracted from seabuckthorn seeds with high nutrition and economic value. The nutrient component of seabuckthorn fruit juice powder is plentiful which including multiple kinds of vitamin, fatty acid, microelement, flavone compounds and many kinds of amino acid needed by human bodies. Group: Others. Seabuckthorn Powder; Hippophae rhamnoides L. Cat No: EXTC-084. | |
| Sea Buckthorn Powder | Sea buckthorn Powder is fresh squeezed juice, made by spray drying. Seabuckthorn contains all the nutrients. Sea buckthorn is rich in protein, 20 kinds of amino acids it contains, including eight kinds of essential amino acids. Its VC content is called "king of fruits", the content of vitamin E is 30 times yarn soybean oil, vitamin B1 is 2 times strawberries; others also contains vitamin B2, vitamin P, folic acid, and trace elements and leaves amides unsaturated fatty acids. Group: Others. Sea Buckthorn Powder. Cat No: EXTC-145. | |
| Sea Clean 2 | 5lt Pack Size. Group: Analytical Reagents. Prepack ID 90023807-5lt. See USA prepack pricing. | |
| Sea Clean 2 (25lt) | 25lt Pack Size. Group: Analytical Reagents. Prepack ID 90023808-25lt. See USA prepack pricing. | |
| Sea Cucumber Extract | Sea Cucumber Extract. Group: Others. Purity: 5:1,10:1, 20:1. or polysaccharide 50%, 60%. Appearance: Brown powder. Sea Cucumber Extract. Cat No: EXTC-127. | |
| Sea cucumber peptide | Sea cucumber peptide is a product of wild sea cucumber as raw material and processed by enzymatic hydrolysis technology. Sea cucumber peptide contains rich polypeptide, sea cucumber polysaccharide and other components. Product ID: CDF4-0247. Category: Protein peptide. Product Keywords: Protein Peptides; Sea cucumber peptide; CDF4-0247; Protein peptide. Applications: It is widely used in food, cosmetics and medicine. | |
| Sea Cucumber Peptide | Sea cucumber peptides are derived from sea cucumbers by controlled enzymatic hydrolysis. Essentially, the larger proteins contained in sea cucumbers are broken down into short chains of amino acids known as peptides. Sea cucumber peptides have a low molecular weight, are highly bioavailable, and can be absorbed by the human body more easily than proteins can. SCPs are jam-packed with collagen, taurine and minerals found in sea cucumbers. Applications: Because sea cucumber peptides have been shown to have many biological activities they have found many uses in nutraceutical and cosmetic products. sea cucumber peptides are commonly used indietary supplements to promote joint health, muscle recovery and maintenance and regulate metabolism such as inflammation or tiredness. as cosmetics, sea cucumber peptides are often marketed as "anti-aging" due to their skin-repairing properties that induce collagen production. they are commonly added to premium creams and serums to increase skin firmness and hydration. Category: Natural extract. Product ID: PIPE-0224. Standard: In-House. |  |
| Sea Cucumber Powder & P.E. 25% (Mucopolysaccharides) | Sea Cucumber Powder & P.E. 25% (Mucopolysaccharides). |  CA, FL & NJ |
| Sea salts | Sea salts. |  |
| Seaweed powder | Seaweed powder is made of seaweed as raw material and processed by spray drying technology. Product ID: CDF4-0232. Category: Flavour. Product Keywords: Flavor Enhancers; Seaweed powder; CDF4-0232; Flavour. Grade: Food Grade. Color: Black green powder. Physical State: powder. Storage: Room Temperature. Applications: Seaweed contains A large amount of vitamin A and vitamin E, as well as a small amount of vitamin C, but also contains about 15% of minerals, widely used in a variety of functional foods, health products to improve the taste. | |
| Sebacic acid | Sebacic acid is a white granular powder. Melting point 153°F. Slightly soluble in water. Sublimes slowly at 750 mm Hg when heated to melting point.;DryPowder; DryPowder, PelletsLargeCrystals; OtherSolid; PelletsLargeCrystals;Solid;WHITE POWDER WITH CHARACTERISTIC ODOUR. Alternative Names: 1,10-Decanedioic acid. CAS No. 111-20-6. Molecular formula: C10H18O4. Mole weight: 202.25. Purity: 98%. IUPAC Name: Decanedioic acid. SMILES: C(CCCCC(=O)O)CCCC(=O)O. InChI: InChI=1S/C10H18O4/c11-9(12)7-5-3-1-2-4-6-8-10(13)14/h1-8H2,(H,11,12)(H,13,14). | |
| Sebacic acid | Decanedioic acid isolated from the herbs of Piper cubeba. It is an intermediate of aromatics, antiseptics, and painting materials, also a cross-linking agent for epoxy resins. Uses: Anti-hiv activity. Alternative Names: decanedioic acid. Grades: > 98 %. CAS No. 111-20-6. Molecular formula: C10H18O4. Mole weight: 202.25. | |
| Sebacic acid | Sebacic acid. Group: Biochemicals. Grades: Highly Purified. CAS No. 111-20-6. Pack Sizes: 100g, 250g, 500g, 1kg, 2kg. Molecular Formula: HO2C(CH2)8CO2H. US Biological Life Sciences. | Worldwide |
| Sebacic Acid | Sebacic Acid. Category ACIDS. Pack Sizes Drums/ bags/ bulk |  |
| Sebacic Acid | Sebacic Acid. Alternative Names: Decanedioic Acid; 1,8-Octanedicarboxylic Acid. CAS No. 111-20-6. Purity: 98.0%(GC)(T). Product ID: ACM-MO-111206. Molecular formula: C10H18O4. Mole weight: 202.25 g/mol. Alfa Chemistry - ISO 9001:32057 Certified. |  |
| Sebacic Acid | Sebacic Acid. CAS No. 111-20-6. Cenik is your partner of choice for specialised chemicals. We don't just provide products - we supply solutions to your technical and regulatory specifications. |  |
| Sebacic Acid | Sebacic acid is an alpha,omega-dicarboxylic acid that is the 1,8-dicarboxy derivative of octane. It has a role as a human metabolite and a plant metabolite. It is an alpha,omega-dicarboxylic acid and a dicarboxylic fatty acid. It is a conjugate acid of a sebacate(2-) and a sebacate. It derives from a hydride of a decane. Category: Solvents. Synonyms: DECANEDIOIC ACID. 1,8-Octanedicarboxylic acid. 1,10-Decanedioic acid. CAS No. 111-20-6. Product ID: CHE111206. Molecular formula: C10H18O4. Mole weight: 202.25. EINECS: 203-845-5. SMILES: C(CCCCC(=O)O)CCCC(=O)O. Appearance: white granular powder. | |
| SEBACIC ACID | SEBACIC ACID. We stock inventory in warehouses throughout the United States, allowing us to serve customers in all regions in a timely and cost effective manner. |  US and Canada |
| Sebacic Acid 111-20-6 | Sebacic Acid - Surface Coatings. SUPPLIERS TO BUSINESS CUSTOMERS ONLY. |  North America & APAC |
| Sebacic acid dibenzyl ester | Sebacic acid dibenzyl ester. Alternative Names: DIBENZYL SEBACATE;DIBENZYL DECANEDIOATE;DECANEDIOIC ACID DIBENZYL ESTER;Decanedioic acid, bis(phenylmethyl) ester;decanedioicacid,bis(phenylmethyl)ester;SEBACIC ACID DIBENZYL ESTER;bis(phenylmethyl) decanedioate;sebacic acid bis(benzyl) ester. CAS No. 140-24-9. Product ID: ACM140249. Molecular formula: C24H30O4. Mole weight: 382.5. Alfa Chemistry - ISO 9001:32057 Certified. | |
| Sebacic acid dioctyl ester | Sebacic acid dioctyl ester. Alternative Names: Propionic Acid Benzyl Ester; benzyl propanoate; Benzyl Propionate. CAS No. 122-63-3. Purity: 96%. Product ID: ACM122633. Molecular formula: C10H12O2. Mole weight: 164.20100. IUPAC Name: Benzyl propionate. Alfa Chemistry - ISO 9001:32057 Certified. | |
| Sebaconitrile | Sebaconitrile. Alternative Names: Octane-1,8-dicarbonitrile; Oktamethylendikyanid; Sebacoitrile; OCTAMETHYLENE DICYANIDE; SEBACIC ACID DINITRILE; SEBACONITRILE; 1,8-DICYANOOCTANE; DECANE-1,10-DINITRILE. Grades: >98.0%(GC). CAS No. 1871-96-1. Molecular formula: C10H16N2. Mole weight: 164.25. | |
| Sebacoyl chloride | 25g Pack Size. Group: Biochemicals, Building Blocks, Organics. Formula: ClCO(CH2)8COCl. CAS No. 111-19-3. Prepack ID 25445778-25g. Molecular Weight 239.14. See USA prepack pricing. | |
| Sebacoyl chloride | Sebacoyl chloride. Group: Biochemicals. Grades: Highly Purified. CAS No. 111-19-3. Pack Sizes: 250g, 500g, 1kg, 2kg, 5kg. US Biological Life Sciences. | Worldwide |
| Sebacoyl Chloride | Sebacoyl Chloride. Molecular formula: C10H16Cl2O2. Mole weight: 239.14g/mol. IUPAC Name: decanedioyl dichloride. SMILES: C(CCCCC(=O)Cl)CCCC(=O)Cl. InChI: InChI=1S/C10H16Cl2O2/c11-9(13)7-5-3-1-2-4-6-8-10(12)14/h1-8H2. | |
| Sebaleic acid | Sebaleic acid is a biochemical assay reagent. Uses: Scientific research. Category: Signaling pathways. CAS No. 22733-46-6. Pack Sizes: 1 mg (35.66 mM * 100 μL in Ethanol). Product ID: HY-W746683. | |
| SEB Domain 144-153 | SEB Domain 144-153, the 144-153 amino acid residues of the staphylococcal enterotoxin B (SEB) domain, inhibits transcytosis of multiple staphylococcal enterotoxins, SEA, SEE and TSST-1. SEB is a toxin produced by Staphylococcus aureus. Alternative Names: Lys-Lys-Lys-Val-Thr-Ala-Gln-Glu-Leu-Asp; L-lysyl-L-lysyl-L-lysyl-L-valyl-L-threonyl-L-alanyl-L-glutaminyl-L-glutamyl-L-leucyl-L-aspartic acid. Grades: ≥95%. CAS No. 210229-94-0. Molecular formula: C50H90N14O17. Mole weight: 1159.33. | |
| Sebetralstat | Sebetralstat (KVD900) is a plasma kallikrein inhibitor (WO2016083820). Sebetralstat can be used for the research of metabolic diseases[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: KVD900. CAS No. 1933514-13-6. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-132830. | |
| SEBUTHYLAZINE-2-HYDROXY | SEBUTHYLAZINE-2-HYDROXY. Alternative Names: SEBUTHYLAZINE-2-HYDROXY. Grades: 95%. CAS No. 33124-61-7. Molecular formula: C9H17N5O. Mole weight: 211.26. | |
| Sec61-IN-1 | Sec61-IN-1 (compound A317) is a potent sec61 inhibitor that effectively targets glioma cells and enhances T cell cytotoxic effects[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2484865-42-9. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-139615. | |
| Sec61-IN-3 | Sec61-IN-2 (A3) is a protein secretion inhibitor (extracted from patent WO2020176863)[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2484862-54-4. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-139617. | |
| Secalciferol | A metabolite of Vitamin D, a possibly anti-inflammatory steroid. Group: Biochemicals. Grades: Highly Purified. CAS No. 55721-11-4. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
Our database is helping our users find suppliers everyday.
