American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
S-Deoxo-3,17-bis-(O-tetrahydro-2H-pyran-2-yl)-6-hydroxy-fulvestrant Fulvestrant impurity E derivative. Group: Biochemicals. Alternative Names: 7-[9-[ (4, 4, 5, 5, 5-Pentafluoropentyl) sulfenyl]nonyl]estra-1, 3, 5 (10) -triene-6-ol-3, 17 β-bis-(O-tetrahydro-2H-pyran-2-yl). Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 2
Worldwide
S-Deoxo ?6-Fulvestrant Fulvestrant impurity E derivative. Group: Biochemicals. Alternative Names: 7-[9-[ (4, 4, 5, 5, 5-Pentafluoropentyl) sulfenyl]nonyl]estra-1, 3, 5 (10) , 6-tetraene-3, 17 β-diol; S-Deoxo Fulvestrant Impurity E. Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 2
Worldwide
S-Deoxo-6-oxo-fulvestrant Fulvestrant impurity E derivative. Used in the preparation of steroids precursor with hormonal activity. Group: Biochemicals. Alternative Names: (7α,17 β ) -3, 17-Dihydroxy-7-[9-[ (4, 4, 5, 5, 5-pentafluoropentyl) thio]nonyl]-estra-1, 3, 5 (10) -trien-6-one. Grades: Highly Purified. CAS No. 1107606-70-1. Pack Sizes: 2.5mg. US Biological Life Sciences. USBiological 2
Worldwide
S-Deoxo-6-oxo-fulvestrant S-Deoxo-6-oxo-fulvestrant. Uses: For analytical and research use. Group: Impurity standards. Pack Sizes: 2.5MG. Catalog: APS012062. Format: Neat. Shipping: Room Temperature. Alfa Chemistry Analytical Products 4
S-Desmethyl Citalopram Hydrochloride A metabolite of Citalopram, an inhibitor of serotonin (5-HT) uptake. Used as an antidepressant. Group: Biochemicals. Alternative Names: 1S)-1-(4-Fluorophenyl)-1,3-dihydro-1-[3-(methylamino)propyl]-5-isobenzo-furancarbonitrile Hydrochloride; (S)-1-(3-Methylaminopropyl)-1-(4-fluorophenyl)-1,3-dihydroisobenzofuran-5-carbonitrile Hydrochloride. Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 2
Worldwide
S-Desmethyl-S-(2-hydroxy-2-methylpropyl) Rosuvastatin Sodium Salt S-Desmethyl-S-(2-hydroxy-2-methylpropyl) Rosuvastatin Sodium Salt. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: (3R,5S,6E)-7-[4-(4-Fluorophenyl)-2-[[(2-hydroxy-2-methylpropyl)sulfonyl]methylamino]-6-(1-methylethyl)-5-pyrimidinyl]-3,5-dihydroxy-6-heptenoic Acid Sodium Salt (1:1), Rosuvastatin Calcium Imp. A (EP) as Sodium Salt. CAS No. 1714147-50-8. Pack Sizes: 10MG. IUPAC Name: sodium;(E,3R,5S)-7-[4-(4-fluorophenyl)-2-[(2-hydroxy-2-methylpropyl)sulfonyl-methylamino]-6-propan-2-ylpyrimidin-5-yl]-3,5-dihydroxyhept-6-enoate. Molecular formula: C25H33FN3O7S.Na. Mole weight: 561.60. Catalog: APS1714147508. SMILES: [Na+].CC(C)c1nc(nc(c2ccc(F)cc2)c1\C=C\[C@@H](O)C[C@@H](O)CC(=O)[O-])N(C)S(=O)(=O)CC(C)(C)O. Format: Neat. Shipping: Room Temperature. Alfa Chemistry Analytical Products 4
S-Desmethyl-S-(2-hydroxy-2-methylpropyl) Rosuvastatin tert-Butyl Ester S-Desmethyl-S-(2-hydroxy-2-methylpropyl) Rosuvastatin tert-Butyl Ester. Uses: For analytical and research use. Group: Impurity standards. Pack Sizes: 10MG. Catalog: APS012063. Format: Neat. Shipping: Room Temperature. Alfa Chemistry Analytical Products 4
SDF-1alpha (CXCL12) from mouse recombinant, expressed in E. coli, ?99% (SDS-PAGE), ?99% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
SDF-1 alpha from rat recombinant, expressed in E. coli, ?98% (SDS-PAGE), ?98% (HPLC), suitable for cell culture. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
SDF-1α (human) SDF-1α (human) is a synthetic peptide containing a 1:50 ratio of BSA (low levels of endotoxins) and is a multifunctional cytokine signaling through CXCR4. SDF-1α is involved in many pathological conditions such as rheumatoid arthritis, pulmonary fibrosis, metastasis and leukemia cell progression. Internalization of SDF-1α dependence of CXCR4 HIV coreceptor contributes to inhibition of HIV replication. Synonyms: Stromal Cell-Derived Factor-1α (human); H-Lys-Pro-Val-Ser-Leu-Ser-Tyr-Arg-Cys-Pro-Cys-Arg-Phe-Phe-Glu-Ser-His-Val-Ala-Arg-Ala-Asn-Val-Lys-His-Leu-Lys-Ile-Leu-Asn-Thr-Pro-Asn-Cys-Ala-Leu-Gln-Ile-Val-Ala-Arg-Leu-Lys-Asn-Asn-Asn-Arg-Gln-Val-Cys-Ile-Asp-Pro-Lys-Leu-Lys-Trp-Ile-Gln-Glu-Tyr-Leu-Glu-Lys-Ala-Leu-Asn-Lys-OH (Disulfide bridge: Cys9-Cys34, Cys11-Cys50). Grade: ≥95%. CAS No. 1268129-65-2. Molecular formula: C356H578N106O93S4. Mole weight: 7959.43. BOC Sciences 11
SDF-1 ALPHA human Animal-component free, recombinant, expressed in E. coli, ?98% (SDS-PAGE), ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
SDF-1beta (CXCL12) from mouse recombinant, expressed in E. coli, ?98% (SDS-PAGE), ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
SDF-1 beta from rat recombinant, expressed in E. coli, ?95% (SDS-PAGE), ?95% (HPLC), suitable for cell culture. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
SDF-1 BETA human Animal-component free, recombinant, expressed in E. coli, ?98% (SDS-PAGE), ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
SDG SDG. Group: Biochemicals. CAS No. 158932-33-3. Pack Sizes: 5mg. US Biological Life Sciences. USBiological 9
Worldwide
SDGRG SDGRG has been used as a control peptide which does not affect integrin function, in various studies. Synonyms: S-D-G-R-G; H-SER-ASP-GLY-ARG-GLY-OH. Grade: >95%. CAS No. 108608-63-5. Molecular formula: C17H30N8O9. Mole weight: 490.5. BOC Sciences 11
S-Diclofenac S-Diclofenac is a hybrid molecule of an H 2 S donor and the NSAID diclofenac. S-Diclofenac spares the gastric mucosa of injury despite markedly suppressing prostaglandin synthesis [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: ACS 15; ATB-337. CAS No. 912758-00-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15035. MedChemExpress MCE
S- (Di methyl carbamoyl methyl ) O,O-Dimethyl Ester Phosphorodithioic Acid S- (Di methyl carbamoyl methyl ) O,O-Dimethyl Ester Phosphorodithioic Acid. Group: Biochemicals. Alternative Names: O,O-dimethyl Ester Phosphorodithioic Acid S-Ester with 2-Mercapto-N,N-dimethylacetamide. Grades: Highly Purified. CAS No. 60823-19-0. Pack Sizes: 100mg. Molecular Formula: C6H14NO3PS2, Molecular Weight: 243.28. US Biological Life Sciences. USBiological 3
Worldwide
S- (Di methyl carbamoyl methyl ) O,O-Dimethyl Ester Phosphorodithioic Acid-d6 S- (Di methyl carbamoyl methyl ) O,O-Dimethyl Ester Phosphorodithioic Acid-d6. Group: Biochemicals. Alternative Names: O,O-dimethyl Ester Phosphorodithioic Acid S-Ester with 2-Mercapto-N,N-dimethylacetamide-d6. Grades: Highly Purified. Pack Sizes: 5mg. Molecular Formula: C6H8D6NO3PS2, Molecular Weight: 249.32. US Biological Life Sciences. USBiological 3
Worldwide
S-Diphenylmethyl-L-cysteine The S-diphenylmethyl group is one of the most effective S-protecting groups for cysteine. Synonyms: L-Cys(Dpm)-OH; (R)-2-Amino-3-(Benzhydrylthio)Propanoic Acid. Grade: ≥ 99% (TLC). CAS No. 5191-80-0. Molecular formula: C16H17NO2S. Mole weight: 287.38. BOC Sciences 11
S-Diphenylmethyl-L-cysteine S-Diphenylmethyl-L-cysteine. Group: Biochemicals. Alternative Names: L-Cys(Dpm)-OH. Grades: Highly Purified. CAS No. 5191-80-0. Pack Sizes: 500mg, 1g. US Biological Life Sciences. USBiological 7
Worldwide
S-Diphenylmethyl-L-cysteine 99+% (TLC) S-Diphenylmethyl-L-cysteine 99+% (TLC). Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 250mg, 1g. US Biological Life Sciences. USBiological 5
Worldwide
sDLL-1 human recombinant, expressed in HEK 293 cells, ?95% (SDS-PAGE), ?95% (HPLC), suitable for cell culture. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
sDLL-4 human recombinant, expressed in HEK 293 cells, ?95% (SDS-PAGE), ?95% (HPLC), suitable for cell culture. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
SDM25N hydrochloride SDM25N hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 342884-71-3. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
SDMA SDMA (Symmetric dimethylarginine) is an endogenous inhibitor of nitric oxide ( NO ) synthase activity. SDMA, a novel kidney biomarker, permits earlier diagnosis of kidney disease than traditional creatinine testing. Uses: Scientific research. Group: Natural products. Alternative Names: Symmetric dimethylarginine; NG,NG'-Dimethyl-L-arginine. CAS No. 30344-00-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-101410. MedChemExpress MCE
SDS (Sodium dodecyl sulfate) 500g Pack Size. Group: Detergents. Formula: C12H25NaO4S. CAS No. 151-21-3. Prepack ID 15171947-500g. Molecular Weight 288.38. See USA prepack pricing. Molekula Americas
SDS (Sodium dodecyl sulfate) 1kg Pack Size. Group: Detergents. Formula: C12H25NaO4S. CAS No. 151-21-3. Prepack ID 15171947-1kg. Molecular Weight 288.38. See USA prepack pricing. Molekula Americas
SDS (Sodium dodecyl sulfate) Ultrapure 500g Pack Size. Group: Biochemicals, Detergents, Reagents. Formula: C12H26O4S.Na. CAS No. 151-21-3. Prepack ID 10325163-500g. Molecular Weight 288.38. See USA prepack pricing. Molekula Americas
SDS (Sodium dodecyl sulfate) Ultrapure 100g Pack Size. Group: Biochemicals, Detergents, Reagents. Formula: C12H26O4S.Na. CAS No. 151-21-3. Prepack ID 10325163-100g. Molecular Weight 288.38. See USA prepack pricing. Molekula Americas
SDU-071 SDU-071 is a potent and orally active inhibitor of BRD4-p53 inhibitor. SDU-071 inhibits MDA-MB-231 cells proliferation with an IC50 of 10.5 ?M. SDU-071 induces cell cycle arrest and apoptosis[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 3036109-10-8. Pack Sizes: 5 mg; 10 mg; 25 mg. Product ID: HY-162352. MedChemExpress MCE
SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a 32-amino acid peptide. Synonyms: Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser. Grade: >98%. Molecular formula: C151H236N40O50S. Mole weight: 3443.84. BOC Sciences 11
SDZ 205-557 hydrochloride SDZ 205-557 hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 1197334-02-3. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
SDZ-205,557 hydrochloride solid. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
SDZ 21009 SDZ 21009. Group: Biochemicals. Grades: Purified. CAS No. 39731-05-0. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
SDZ 220-581 SDZ 220-581 is an orally active, potent, competitive NMDA receptor antagonist with pK i value of 7.7 [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 174575-17-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-13059. MedChemExpress MCE
SDZ 220-581 hydrochloride ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
SDZ 220-581 hydrochloride SDZ 220-581 hydrochloride is an orally active, potent, competitive NMDA receptor antagonist with pK i value of 7.7 [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 179411-93-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg. Product ID: HY-13059B. MedChemExpress MCE
SDZ NKT 343 SDZ NKT 343. Group: Biochemicals. Grades: Purified. CAS No. 180046-99-5. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 5
Worldwide
SDZ SER 082 SDZ SER 082. Group: Biochemicals. Alternative Names: (7aR,11aS)-rel-4,5,7a,8,9,10,11,11a-Octahydro-10-methyl-7H-indolo[1,7-bc][2,6]naphthyridine. Grades: Highly Purified. CAS No. 141474-54-6. Pack Sizes: 10mg. Molecular Formula: C15H20N2, Molecular Weight: 228.33. US Biological Life Sciences. USBiological 3
Worldwide
SDZ WAG 994 SDZ WAG 994. Group: Biochemicals. Grades: Purified. CAS No. 130714-47-5. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 5
Worldwide
SE 175 ?97%. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
SE 563 SE 563. Group: Biochemicals. Alternative Names: (4S)-6-Chloro-4-(2-cyclopropylethynyl)-1,4-dihydro-1-[(4-methoxyphenyl)methyl]-4-(trifluoromethyl)-2H-3,1-benzoxazin-2-one; (4S)-6-Chloro-4-(cyclopropylethynyl)-1,4-dihydro-1-[(4-methoxyphenyl)methyl]-4-(trifluoromethyl)-2H-3,1-benzoxazin-2-one; (S)-6-Chloro-4-(cyclopropylethynyl)-1,4-dihydro-1-[(4-methoxyphenyl)methyl]-4-(trifluoromethyl)-2H-3,1-benzoxazin-2-one. Grades: Highly Purified. CAS No. 174819-21-7. Pack Sizes: 10mg. Molecular Formula: C22H17ClF3NO3, Molecular Weight: 435.82. US Biological Life Sciences. USBiological 3
Worldwide
SE-7552 SE-7552, a 2-(difluoromethyl)-1,3,4-oxadiazole (DFMO) derivative, is an orally active, highly selective, non-hydroxamate HDAC6 inhibitor with an IC50 of 33 nM. SE-7552 is greater than 850-fold selectivity versus all other known HDAC isozymes. SE-7552 is capable of blocking multiple myeloma growth in vivo. SE-7552 acts as an anti-obesity agent in diet-induced obese mice[1][2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2243575-79-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-161305. MedChemExpress MCE
SEA0400 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
SEA0400 SEA0400 is a novel and selective inhibitor of the Na+-Ca2+ exchanger (NCX), inhibiting Na+-dependent Ca2+ uptake in cultured neurons, astrocytes, and microglia with IC50s of from 5 to 33 nM. Uses: Scientific research. Group: Signaling pathways. CAS No. 223104-29-8. Pack Sizes: 10 mM * 1 mL; 2 mg; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-15515. MedChemExpress MCE
Sea buckthorn extract Sea buckthorn extract. Uses: Designed for use in research and industrial production. Product Category: Material of health food. Appearance: Yellowish green or yellowish brown powder. CAS No. 90106-68-6. Product ID: ACM90106686. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry.
Sea Buckthorn Extract (Ratio) Sea Buckthorn Extract (Ratio). Group: Others. Purity: 4:1~20:1. Sea Buckthorn Extract (Ratio). Cat No: EXTW-076. Creative Enzymes
Sea buckthorn Powder Sea buckthorn powder takes sea buckthorn as raw material, adopts spray drying technology, low temperature physical grinding technology, instant grinding, to obtain edible high quality avocado powder. Product ID: CDF4-0230. Category: Flavour. Product Keywords: Flavor Enhancers; Sea buckthorn Powder; CDF4-0230; Flavour;. Grade: Food Grade. Color: Aurantium powder. Physical State: powder. Storage: Room Temperature. Applications: Sea buckthorn powder has good fluidity, good taste, easy to dissolve, easy to preserve, widely used in health nutrition, infant food, solid drinks. CD Formulation
Seabuckthorn Powder Seabuckthorn powder is a kind of pure natural active components extracted from seabuckthorn seeds with high nutrition and economic value. The nutrient component of seabuckthorn fruit juice powder is plentiful which including multiple kinds of vitamin, fatty acid, microelement, flavone compounds and many kinds of amino acid needed by human bodies. Group: Others. Seabuckthorn Powder; Hippophae rhamnoides L. Cat No: EXTC-084. Creative Enzymes
Sea Buckthorn Powder Sea buckthorn Powder is fresh squeezed juice, made by spray drying. Seabuckthorn contains all the nutrients. Sea buckthorn is rich in protein, 20 kinds of amino acids it contains, including eight kinds of essential amino acids. Its VC content is called "king of fruits", the content of vitamin E is 30 times yarn soybean oil, vitamin B1 is 2 times strawberries; others also contains vitamin B2, vitamin P, folic acid, and trace elements and leaves amides unsaturated fatty acids. Group: Others. Sea Buckthorn Powder. Cat No: EXTC-145. Creative Enzymes
Sea Clean 2 5lt Pack Size. Group: Analytical Reagents. Prepack ID 90023807-5lt. See USA prepack pricing. Molekula Americas
Sea Clean 2 (25lt) 25lt Pack Size. Group: Analytical Reagents. Prepack ID 90023808-25lt. See USA prepack pricing. Molekula Americas
Sea Cucumber Extract Sea Cucumber Extract. Group: Others. Purity: 5:1,10:1, 20:1. or polysaccharide 50%, 60%. Appearance: Brown powder. Sea Cucumber Extract. Cat No: EXTC-127. Creative Enzymes
Sea cucumber peptide Sea cucumber peptide is a product of wild sea cucumber as raw material and processed by enzymatic hydrolysis technology. Sea cucumber peptide contains rich polypeptide, sea cucumber polysaccharide and other components. Product ID: CDF4-0247. Category: Protein peptide. Product Keywords: Protein Peptides; Sea cucumber peptide; CDF4-0247; Protein peptide;. Applications: It is widely used in food, cosmetics and medicine. CD Formulation
Sea Cucumber Powder & P.E. 25% (Mucopolysaccharides) Sea Cucumber Powder & P.E. 25% (Mucopolysaccharides). Pharma Resources International LLC
CA, FL & NJ
Sea salts Sea salts. Group: Electrolytes. Alfa Chemistry Materials 5
SEAWEED (bladderwrack) (trace elements) SEAWEED (bladderwrack) (trace elements). Uses: For analytical and research use. Group: Process materials, geological, cement & soils. Catalog: APS012067. Format: Matrix Material. Shipping: Room Temperature. Alfa Chemistry Analytical Products 4
Seaweed powder Seaweed powder is made of seaweed as raw material and processed by spray drying technology. Product ID: CDF4-0232. Category: Flavour. Product Keywords: Flavor Enhancers; Seaweed powder; CDF4-0232; Flavour;. Grade: Food Grade. Color: Black green powder. Physical State: powder. Storage: Room Temperature. Applications: Seaweed contains A large amount of vitamin A and vitamin E, as well as a small amount of vitamin C, but also contains about 15% of minerals, widely used in a variety of functional foods, health products to improve the taste. CD Formulation
Sebacic acid Sebacic acid is a white granular powder. Melting point 153°F. Slightly soluble in water. Sublimes slowly at 750 mm Hg when heated to melting point.;DryPowder; DryPowder, PelletsLargeCrystals; OtherSolid; PelletsLargeCrystals;Solid;WHITE POWDER WITH CHARACTERISTIC ODOUR. Group: Monomers. Alternative Names: 1,10-Decanedioic acid. CAS No. 111-20-6. Product ID: Decanedioic acid. Molecular formula: 202.25. Mole weight: C10H18O4. C(CCCCC(=O)O)CCCC(=O)O. InChI=1S/C10H18O4/c11-9 (12)7-5-3-1-2-4-6-8-10 (13)14/h1-8H2, (H, 11, 12) (H, 13, 14). CXMXRPHRNRROMY-UHFFFAOYSA-N. 98%. Alfa Chemistry Materials 4
Sebacic acid Sebacic acid. Group: Biochemicals. Grades: Highly Purified. CAS No. 111-20-6. Pack Sizes: 100g, 250g, 500g, 1kg, 2kg. Molecular Formula: HO2C(CH2)8CO2H. US Biological Life Sciences. USBiological 8
Worldwide
Sebacic Acid Sebacic acid is an alpha,omega-dicarboxylic acid that is the 1,8-dicarboxy derivative of octane. It has a role as a human metabolite and a plant metabolite. It is an alpha,omega-dicarboxylic acid and a dicarboxylic fatty acid. It is a conjugate acid of a sebacate(2-) and a sebacate. It derives from a hydride of a decane. Alternative Names: DECANEDIOIC ACID. 1,8-Octanedicarboxylic acid. 1,10-Decanedioic acid. CAS No. 111-20-6. Product ID: CHE111206. Molecular formula: C10H18O4. Mole weight: 202.25. EINECS: 203-845-5. SMILES: C(CCCCC(=O)O)CCCC(=O)O. Appearance: white granular powder. Category: Acid. Protheragen
Sebacic Acid Sebacic Acid. Category ACIDS. Pack Sizes Drums/ bags/ bulk CJ Chemicals
Sebacic Acid Sebacic Acid. We stock inventory in warehouses throughout the United States, allowing us to serve customers in all regions in a timely and cost effective manner. Neuchem
California
Sebacic Acid 111-20-6 Sebacic Acid - Surface Coatings. SUPPLIERS TO BUSINESS CUSTOMERS ONLY. Redox
North America & APAC
Sebacic acid, bis(2-ethylhexyl) ester Food Contact Materials. Uses: For analytical and research use. Group: Reagents. Alternative Names: Bis(2-ethylhexyl) sebacate, Bis(ethylhexyl) sebacate, DOS, BEHS, Neosolue-EHS, Octoil S, PX 438, Monoplex DOS, Trivent DOS, NSC 68878, Synative ES DEHS, Bisoflex,Decanedioic acid, bis(2-ethylhexyl) ester (9CI), Plexol 201J, Edenor DEHS, Bis(2-ethylhexyl) decanedioate, Decanedioic acid di(2-ethylhexyl) ester, Ergoplast SDO, Plexol, Di-2-ethylhexyl sebacate, Dioctyl sebacate, Plasthall DOS, Uniflex DOS, Edenol DOS 888, Hallstar DOS, Bisoflex DOS, Reomol DDS, Staflex DOS, Edenol 888, Jeetox T-5, Sansocizer DOS, Reolube DOS, Sebacic acid di-2-ethylhexyl diester, Sebacic acid di(2-ethylhexyl) ester, Sebacic acid, bis(2-ethylhexyl) ester (6CI,8CI). CAS No. 122-62-3. IUPAC Name: bis(2-ethylhexyl) decanedioate. Alfa Chemistry Analytical Products 4
Sebacic acid bis(N-succinimidyl) ester ?97.0%. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
Sebacic acid,compound with 2,2-iminodiethanol Sebacic acid,compound with 2,2-iminodiethanol. Uses: Designed for use in research and industrial production. Additional or Alternative Names: EINECS 303-497-5; Sebacic acid,compound with 2,2-iminodiethanol; EINECS 282-256-5. Product Category: Heterocyclic Organic Compound. CAS No. 84145-30-2. Molecular formula: C14H29NO6. Mole weight: 307.3832. Purity: 0.96. IUPACName: decanedioic acid;2-(2-hydroxyethylamino)ethanol. Canonical SMILES: C(CCCCC(=O)O)CCCC(=O)O.C(CO)NCCO. Density: g/cm³. ECNumber: 303-497-5. Product ID: ACM84145302. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 4
Sebacic acid dioctyl ester Sebacic acid dioctyl ester. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Propionic Acid Benzyl Ester; benzyl propanoate; Benzyl Propionate. Product Category: Heterocyclic Organic Compound. Appearance: Colorless & Clear liquid. CAS No. 122-63-3. Molecular formula: C10H12O2. Mole weight: 164.201. Purity: 0.96. IUPACName: Benzyl propionate. Density: 1.031. Product ID: ACM122633. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 4
Sebacoyl chloride Sebacoyl chloride. Group: Biochemicals. Grades: Highly Purified. CAS No. 111-19-3. Pack Sizes: 250g, 500g, 1kg, 2kg, 5kg. US Biological Life Sciences. USBiological 8
Worldwide

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products