A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Sd1 is an antibacterial peptide isolated from Saccharum officinarum (Sugarcane). It has activity against fungi. Synonyms: Arg-Tyr-Cys-Leu-Ser-Gln-Ser-His-Arg-Phe-Lys-Gly-Leu-Cys-Met-Ser-Ser-Ser-Asn-Cys-Ala-Asn-Val-Cys-Gln-Thr-Glu-Asn-Phe-Pro-Gly-Gly-Glu-Cys-Lys-Ala-Asp-Gly-Ala-Thr-Arg-Lys-Cys-Phe-Cys-Lys-Lys-Ile-Cys.
SD 1008
SD 1008. Group: Biochemicals. Grades: Purified. CAS No. 960201-81-4. Pack Sizes: 10mg, 50mg. US Biological Life Sciences.
Worldwide
SD-1008
SD-1008 is a potent JAK inhibitor. SD-1008 inhibits tyrosyl phosphorylation of STAT3, JAK2 and Src. SD-1008 also reduces STAT3-dependent luciferase activity. SD-1008 enhances apoptosis induced by Paclitaxel in ovarian cancer cells via directly blocking the JAK-STAT3 signaling pathway [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 960201-81-4. Pack Sizes: 5 mg; 10 mg. Product ID: HY-107595.
SD2
Sd2 is an antibacterial peptide isolated from Helianthus annuus (Common sunflower). It has activity against fungi. Synonyms: Asn-Glu-Met-Gly-Gly-Pro-Leu-Val-Val-Glu-Ala-Arg-Thr-Cys-Glu-Ser-Gln-Ser-His-Lys-Phe-Lys-Gly-Thr-Cys-Leu-Ser-Asp-Thr-Asn-Cys-Ala-Asn-Val-Cys-His-Ser-Glu-Arg-Phe-Ser-Gly-Gly-Lys-Cys-Arg-Gly-Phe-Arg-Arg-Arg-Cys-Phe-Cys-Thr-Thr-His-Cys.
SD 208
SD 208. Group: Biochemicals. Grades: Purified. CAS No. 627536-09-8. Pack Sizes: 10mg, 50mg. US Biological Life Sciences.
SD-208 is a selective TGF-βRI (ALK5) inhibitor with IC 50 of 48 nM, and > 100-fold selectivity over TGF-βRII. Uses: Scientific research. Group: Signaling pathways. CAS No. 627536-09-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-13227.
Sd3
Sd3 is an antibacterial peptide isolated from Saccharum officinarum (Sugarcane). It has activity against fungi. Synonyms: Arg-His-Arg-His-Cys-Phe-Ser-Gln-Ser-His-Lys-Phe-Val-Gly-Ala-Cys-Leu-Arg-Glu-Ser-Asn-Cys-Glu-Asn-Val-Cys-Lys-Thr-Glu-Gly-Phe-Pro-Ser-Gly-Glu-Cys-Lys-Trp-His-Gly-Ile-Val-Ser-Lys-Cys-His-Cys-Lys-Arg-Ile-Cys.
SD-36
SD-36 is a potent and efficacious STAT3 PROTAC degrader (Kd=~50 nM), and demonstrates high selectivity over other STAT members. SD-36 also effectively degrades mutated STAT3 proteins in cells and suppresses the transcriptional activity of STAT3 (IC50=10 nM). SD-36 exerts robust anti-tumor activity, and achieves complete and long-lasting tumor regression in mouse tumor models. SD-36 is composed of the STAT3 inhibitor SI-109, a linker, and an analog of Cereblon ligand Lenalidomide for E3 ubiquitin ligase[1]. SD-36 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Group: Signaling pathways. CAS No. 2429877-44-9. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg. Product ID: HY-129602.
SD-6
SD-6 is an orally active inhibitor of hAChE and hBChE with IC 50 values of 0.907 μM and 1.579 μM, respectively. SD-6 has excellent blood-brain barrier (BBB) permeability and no neurotoxicity, which can be used for research on Alzheimer's disease [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 744206-31-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-149212.
SD-70
SD-70 is an inhibitor for histone demethylase JMJD2C and exhibits antitumor efficacy. SD-70 inhibits viability of cancer cells CWR22Rv1 (9% cell survival at 10 μM), PC3 (14% cell survival at 2 μM) and DU145 (26% cell survival at 2 μM) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 332173-89-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-121522.
SD Agar
for microbiology. Group: Fluorescence/luminescence spectroscopy.
Fulvestrant impurity E derivative. Used in the preparation of antiestrogenic 17-alkylene-16α-hydroxyestratrienes for cancer treatment. Group: Biochemicals. Alternative Names: 7-[9-[ (4, 4, 5, 5, 5-Pentafluoropentyl) sulfenyl]nonyl]--3, 17 β-bis-(O-tetrahydro-2H-pyran-2-yl)estra-1,3,5(10)-triene-6-one. Grades: Highly Purified. CAS No. 862700-70-7. Pack Sizes: 5mg. US Biological Life Sciences.
Fulvestrant impurity E derivative. Group: Biochemicals. Alternative Names: 7-[9-[ (4, 4, 5, 5, 5-Pentafluoropentyl) sulfenyl]nonyl]estra-1, 3, 5 (10) -triene-6-ol-3, 17 β-bis-(O-tetrahydro-2H-pyran-2-yl). Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences.
Worldwide
S-Deoxo ?6-Fulvestrant
Fulvestrant impurity E derivative. Group: Biochemicals. Alternative Names: 7-[9-[ (4, 4, 5, 5, 5-Pentafluoropentyl) sulfenyl]nonyl]estra-1, 3, 5 (10) , 6-tetraene-3, 17 β-diol; S-Deoxo Fulvestrant Impurity E. Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences.
Worldwide
S-Deoxo-6-oxo-fulvestrant
Fulvestrant impurity E derivative. Used in the preparation of steroids precursor with hormonal activity. Group: Biochemicals. Alternative Names: (7α,17 β ) -3, 17-Dihydroxy-7-[9-[ (4, 4, 5, 5, 5-pentafluoropentyl) thio]nonyl]-estra-1, 3, 5 (10) -trien-6-one. Grades: Highly Purified. CAS No. 1107606-70-1. Pack Sizes: 2.5mg. US Biological Life Sciences.
Worldwide
S-Deoxo-6-oxo-fulvestrant
S-Deoxo-6-oxo-fulvestrant. Uses: For analytical and research use. Group: Impurity standards. Pack Sizes: 2.5MG. Catalog: APS012062. Format: Neat. Shipping: Room Temperature.
S-Desmethyl Citalopram Hydrochloride
A metabolite of Citalopram, an inhibitor of serotonin (5-HT) uptake. Used as an antidepressant. Group: Biochemicals. Alternative Names: 1S)-1-(4-Fluorophenyl)-1,3-dihydro-1-[3-(methylamino)propyl]-5-isobenzo-furancarbonitrile Hydrochloride; (S)-1-(3-Methylaminopropyl)-1-(4-fluorophenyl)-1,3-dihydroisobenzofuran-5-carbonitrile Hydrochloride. Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences.
Worldwide
S-Desmethyl-S-(2-hydroxy-2-methylpropyl) Rosuvastatin Sodium Salt
S-Desmethyl-S-(2-hydroxy-2-methylpropyl) Rosuvastatin Sodium Salt. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: (3R,5S,6E)-7-[4-(4-Fluorophenyl)-2-[[(2-hydroxy-2-methylpropyl)sulfonyl]methylamino]-6-(1-methylethyl)-5-pyrimidinyl]-3,5-dihydroxy-6-heptenoic Acid Sodium Salt (1:1), Rosuvastatin Calcium Imp. A (EP) as Sodium Salt. CAS No. 1714147-50-8. Pack Sizes: 10MG. IUPAC Name: sodium;(E,3R,5S)-7-[4-(4-fluorophenyl)-2-[(2-hydroxy-2-methylpropyl)sulfonyl-methylamino]-6-propan-2-ylpyrimidin-5-yl]-3,5-dihydroxyhept-6-enoate. Molecular formula: C25H33FN3O7S.Na. Mole weight: 561.60. Catalog: APS1714147508. SMILES: [Na+].CC(C)c1nc(nc(c2ccc(F)cc2)c1\C=C\[C@@H](O)C[C@@H](O)CC(=O)[O-])N(C)S(=O)(=O)CC(C)(C)O. Format: Neat. Shipping: Room Temperature.
S-Desmethyl-S-(2-hydroxy-2-methylpropyl) Rosuvastatin tert-Butyl Ester. Uses: For analytical and research use. Group: Impurity standards. Pack Sizes: 10MG. Catalog: APS012063. Format: Neat. Shipping: Room Temperature.
SDF-1alpha (CXCL12) from mouse
recombinant, expressed in E. coli, ?99% (SDS-PAGE), ?99% (HPLC). Group: Fluorescence/luminescence spectroscopy.
SDF-1 alpha from rat
recombinant, expressed in E. coli, ?98% (SDS-PAGE), ?98% (HPLC), suitable for cell culture. Group: Fluorescence/luminescence spectroscopy.
SDF-1α (human)
SDF-1α (human) is a synthetic peptide containing a 1:50 ratio of BSA (low levels of endotoxins) and is a multifunctional cytokine signaling through CXCR4. SDF-1α is involved in many pathological conditions such as rheumatoid arthritis, pulmonary fibrosis, metastasis and leukemia cell progression. Internalization of SDF-1α dependence of CXCR4 HIV coreceptor contributes to inhibition of HIV replication. Synonyms: Stromal Cell-Derived Factor-1α (human); H-Lys-Pro-Val-Ser-Leu-Ser-Tyr-Arg-Cys-Pro-Cys-Arg-Phe-Phe-Glu-Ser-His-Val-Ala-Arg-Ala-Asn-Val-Lys-His-Leu-Lys-Ile-Leu-Asn-Thr-Pro-Asn-Cys-Ala-Leu-Gln-Ile-Val-Ala-Arg-Leu-Lys-Asn-Asn-Asn-Arg-Gln-Val-Cys-Ile-Asp-Pro-Lys-Leu-Lys-Trp-Ile-Gln-Glu-Tyr-Leu-Glu-Lys-Ala-Leu-Asn-Lys-OH (Disulfide bridge: Cys9-Cys34, Cys11-Cys50). Grade: ≥95%. CAS No. 1268129-65-2. Molecular formula: C356H578N106O93S4. Mole weight: 7959.43.
SDF-1 ALPHA human
Animal-component free, recombinant, expressed in E. coli, ?98% (SDS-PAGE), ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy.
SDF-1beta (CXCL12) from mouse
recombinant, expressed in E. coli, ?98% (SDS-PAGE), ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy.
SDF-1 beta from rat
recombinant, expressed in E. coli, ?95% (SDS-PAGE), ?95% (HPLC), suitable for cell culture. Group: Fluorescence/luminescence spectroscopy.
SDF-1 BETA human
Animal-component free, recombinant, expressed in E. coli, ?98% (SDS-PAGE), ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy.
SDG
SDG. Group: Biochemicals. CAS No. 158932-33-3. Pack Sizes: 5mg. US Biological Life Sciences.
Worldwide
SDGRG
SDGRG has been used as a control peptide which does not affect integrin function, in various studies. Synonyms: S-D-G-R-G; H-SER-ASP-GLY-ARG-GLY-OH. Grade: >95%. CAS No. 108608-63-5. Molecular formula: C17H30N8O9. Mole weight: 490.5.
S-Diclofenac
S-Diclofenac is a hybrid molecule of an H 2 S donor and the NSAID diclofenac. S-Diclofenac spares the gastric mucosa of injury despite markedly suppressing prostaglandin synthesis [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: ACS 15; ATB-337. CAS No. 912758-00-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15035.
S- (Di methyl carbamoyl methyl ) O,O-Dimethyl Ester Phosphorodithioic Acid-d6. Group: Biochemicals. Alternative Names: O,O-dimethyl Ester Phosphorodithioic Acid S-Ester with 2-Mercapto-N,N-dimethylacetamide-d6. Grades: Highly Purified. Pack Sizes: 5mg. Molecular Formula: C6H8D6NO3PS2, Molecular Weight: 249.32. US Biological Life Sciences.
Worldwide
S-Diphenylmethyl-L-cysteine
The S-diphenylmethyl group is one of the most effective S-protecting groups for cysteine. Synonyms: L-Cys(Dpm)-OH; (R)-2-Amino-3-(Benzhydrylthio)Propanoic Acid. Grade: ≥ 99% (TLC). CAS No. 5191-80-0. Molecular formula: C16H17NO2S. Mole weight: 287.38.
S-Diphenylmethyl-L-cysteine
S-Diphenylmethyl-L-cysteine. Group: Biochemicals. Alternative Names: L-Cys(Dpm)-OH. Grades: Highly Purified. CAS No. 5191-80-0. Pack Sizes: 500mg, 1g. US Biological Life Sciences.
Worldwide
S-Diphenylmethyl-L-cysteine 99+% (TLC)
S-Diphenylmethyl-L-cysteine 99+% (TLC). Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 250mg, 1g. US Biological Life Sciences.
Worldwide
sDLL-1 human
recombinant, expressed in HEK 293 cells, ?95% (SDS-PAGE), ?95% (HPLC), suitable for cell culture. Group: Fluorescence/luminescence spectroscopy.
sDLL-4 human
recombinant, expressed in HEK 293 cells, ?95% (SDS-PAGE), ?95% (HPLC), suitable for cell culture. Group: Fluorescence/luminescence spectroscopy.
SDM25N hydrochloride
SDM25N hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 342884-71-3. Pack Sizes: 10mg, 50mg. US Biological Life Sciences.
Worldwide
SDMA
SDMA (Symmetric dimethylarginine) is an endogenous inhibitor of nitric oxide ( NO ) synthase activity. SDMA, a novel kidney biomarker, permits earlier diagnosis of kidney disease than traditional creatinine testing. Uses: Scientific research. Group: Natural products. Alternative Names: Symmetric dimethylarginine; NG,NG'-Dimethyl-L-arginine. CAS No. 30344-00-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-101410.
SDS (Sodium dodecyl sulfate)
500g Pack Size. Group: Detergents. Formula: C12H25NaO4S. CAS No. 151-21-3. Prepack ID 15171947-500g. Molecular Weight 288.38. See USA prepack pricing.
SDS (Sodium dodecyl sulfate)
1kg Pack Size. Group: Detergents. Formula: C12H25NaO4S. CAS No. 151-21-3. Prepack ID 15171947-1kg. Molecular Weight 288.38. See USA prepack pricing.
SDS (Sodium dodecyl sulfate) Ultrapure
500g Pack Size. Group: Biochemicals, Detergents, Reagents. Formula: C12H26O4S.Na. CAS No. 151-21-3. Prepack ID 10325163-500g. Molecular Weight 288.38. See USA prepack pricing.
SDS (Sodium dodecyl sulfate) Ultrapure
100g Pack Size. Group: Biochemicals, Detergents, Reagents. Formula: C12H26O4S.Na. CAS No. 151-21-3. Prepack ID 10325163-100g. Molecular Weight 288.38. See USA prepack pricing.
SDU-071
SDU-071 is a potent and orally active inhibitor of BRD4-p53 inhibitor. SDU-071 inhibits MDA-MB-231 cells proliferation with an IC50 of 10.5 ?M. SDU-071 induces cell cycle arrest and apoptosis[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 3036109-10-8. Pack Sizes: 5 mg; 10 mg; 25 mg. Product ID: HY-162352.
SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a 32-amino acid peptide. Synonyms: Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser. Grade: >98%. Molecular formula: C151H236N40O50S. Mole weight: 3443.84.
SDZ 205-557 hydrochloride
SDZ 205-557 hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 1197334-02-3. Pack Sizes: 10mg, 50mg. US Biological Life Sciences.
SE 563. Group: Biochemicals. Alternative Names: (4S)-6-Chloro-4-(2-cyclopropylethynyl)-1,4-dihydro-1-[(4-methoxyphenyl)methyl]-4-(trifluoromethyl)-2H-3,1-benzoxazin-2-one; (4S)-6-Chloro-4-(cyclopropylethynyl)-1,4-dihydro-1-[(4-methoxyphenyl)methyl]-4-(trifluoromethyl)-2H-3,1-benzoxazin-2-one; (S)-6-Chloro-4-(cyclopropylethynyl)-1,4-dihydro-1-[(4-methoxyphenyl)methyl]-4-(trifluoromethyl)-2H-3,1-benzoxazin-2-one. Grades: Highly Purified. CAS No. 174819-21-7. Pack Sizes: 10mg. Molecular Formula: C22H17ClF3NO3, Molecular Weight: 435.82. US Biological Life Sciences.
Worldwide
SE-7552
SE-7552, a 2-(difluoromethyl)-1,3,4-oxadiazole (DFMO) derivative, is an orally active, highly selective, non-hydroxamate HDAC6 inhibitor with an IC50 of 33 nM. SE-7552 is greater than 850-fold selectivity versus all other known HDAC isozymes. SE-7552 is capable of blocking multiple myeloma growth in vivo. SE-7552 acts as an anti-obesity agent in diet-induced obese mice[1][2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2243575-79-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-161305.
SEA0400 is a novel and selective inhibitor of the Na+-Ca2+ exchanger (NCX), inhibiting Na+-dependent Ca2+ uptake in cultured neurons, astrocytes, and microglia with IC50s of from 5 to 33 nM. Uses: Scientific research. Group: Signaling pathways. CAS No. 223104-29-8. Pack Sizes: 10 mM * 1 mL; 2 mg; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-15515.
Sea buckthorn extract
Sea buckthorn extract. Uses: Designed for use in research and industrial production. Product Category: Material of health food. Appearance: Yellowish green or yellowish brown powder. CAS No. 90106-68-6. Product ID: ACM90106686. Alfa Chemistry ISO 9001:2015 Certified.
Sea buckthorn powder takes sea buckthorn as raw material, adopts spray drying technology, low temperature physical grinding technology, instant grinding, to obtain edible high quality avocado powder. Product ID: CDF4-0230. Category: Flavour. Product Keywords: Flavor Enhancers; Sea buckthorn Powder; CDF4-0230; Flavour;. Grade: Food Grade. Color: Aurantium powder. Physical State: powder. Storage: Room Temperature. Applications: Sea buckthorn powder has good fluidity, good taste, easy to dissolve, easy to preserve, widely used in health nutrition, infant food, solid drinks.
Seabuckthorn Powder
Seabuckthorn powder is a kind of pure natural active components extracted from seabuckthorn seeds with high nutrition and economic value. The nutrient component of seabuckthorn fruit juice powder is plentiful which including multiple kinds of vitamin, fatty acid, microelement, flavone compounds and many kinds of amino acid needed by human bodies. Group: Others. Seabuckthorn Powder; Hippophae rhamnoides L. Cat No: EXTC-084.
Sea Buckthorn Powder
Sea buckthorn Powder is fresh squeezed juice, made by spray drying. Seabuckthorn contains all the nutrients. Sea buckthorn is rich in protein, 20 kinds of amino acids it contains, including eight kinds of essential amino acids. Its VC content is called "king of fruits", the content of vitamin E is 30 times yarn soybean oil, vitamin B1 is 2 times strawberries; others also contains vitamin B2, vitamin P, folic acid, and trace elements and leaves amides unsaturated fatty acids. Group: Others. Sea Buckthorn Powder. Cat No: EXTC-145.
Sea Clean 2
5lt Pack Size. Group: Analytical Reagents. Prepack ID 90023807-5lt. See USA prepack pricing.
Sea Clean 2 (25lt)
25lt Pack Size. Group: Analytical Reagents. Prepack ID 90023808-25lt. See USA prepack pricing.
Sea cucumber peptide is a product of wild sea cucumber as raw material and processed by enzymatic hydrolysis technology. Sea cucumber peptide contains rich polypeptide, sea cucumber polysaccharide and other components. Product ID: CDF4-0247. Category: Protein peptide. Product Keywords: Protein Peptides; Sea cucumber peptide; CDF4-0247; Protein peptide;. Applications: It is widely used in food, cosmetics and medicine.