A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| Vortioxetine Impurity 73 | Vortioxetine Impurity 73. Uses: For analytical and research use. Molecular formula: C20H25ClN2S. Mole weight: 360.94. Catalog: APB10131. |  |
| Vortioxetine Impurity 74 | Vortioxetine Impurity 74. Uses: For analytical and research use. Molecular formula: C18H22N2OS. Mole weight: 314.45. Catalog: APB10130. | |
| Vortioxetine Impurity 75 | Vortioxetine Impurity 75. Uses: For analytical and research use. Molecular formula: C18H22Br2N2S. Mole weight: 458.26. Catalog: APB10132. | |
| Voruciclib | Voruciclib is an orally active and selective CDK inhibitor with Ki values of 0.626 nM-9.1 nM. Voruciclib potently blocks CDK9, the transcriptional regulator of MCL-1. Voruciclib represses expression of MCL-1 in multiple models of diffuse large B-cell lymphoma (DLBCL)[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1000023-04-0. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg; 50 mg. Product ID: HY-12422. |  |
| Voruciclib hydrochloride | Voruciclib hydrochloride is an orally active and selective CDK inhibitor with Ki values of 0.626 nM-9.1 nM. Voruciclib hydrochloride potently blocks CDK9, the transcriptional regulator of MCL-1. Voruciclib hydrochloride represses expression of MCL-1 in multiple models of diffuse large B-cell lymphoma (DLBCL)[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1000023-05-1. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-12422A. | |
| Vosilasarm | Vosilasarm (RAD140) is a potent, orally active, nonsteroidal selective androgen receptor modulator (SARM) with a Ki of 7 nM. Vosilasarm shows good selectivity over other steroid hormone nuclear receptors[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: RAD140; EP0062. CAS No. 1182367-47-0. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-14383. | |
| Vosoritide | Vosoritide is a medicine used to treat achondroplasia. Vosoritide works by binding to a receptor (target) called natriuretic peptide receptor type B (NPR-B), which reduces the activity of fibroblast growth factor receptor 3 (FGFR3). Uses: Vosoritide, a synthetic analog of the human growth hormone receptor antagonist bmp-7, has emerged as a promising candidate in drug development, particularly in the area of ??rare genetic diseases characterized by impaired skeletal growth and development. achondroplasia is the most common form of disproportionate dwarfism and is characterized by abnormal skeletal growth and development, especially. Synonyms: Voxzogo; BMN-111. Grade: ≥95%. CAS No. 1480724-61-5. Molecular formula: C176H290N56O51S3. Mole weight: 4103. |  |
| Vosoritide | Vosoritide (BMN 111) is a modified recombinant CNP (C-type natriuretic peptide) analogue, binds to NPR-B (natriuretic peptide receptor type B) and reduces the activity of FGFR3 (fibroblast growth factor receptor 3). Vosoritide can be used in achondroplasia and dwarfism research[1][2][3]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: BMN 111. CAS No. 1480724-61-5. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P3503. | |
| Vosoritide D-Asp-29 Impurity | Vosoritide D-Asp-29 Impurity. Uses: For analytical and research use. Molecular formula: C176H290N56O51S3. Mole weight: 4102.8. Catalog: APB000018. | |
| Vosoritide D-Cys-23 Impurity | Vosoritide D-Cys-23 Impurity. Uses: For analytical and research use. Molecular formula: C176H290N56O51S3. Mole weight: 4102.8. Catalog: APB000019. | |
| Vosoritide D-Cys-39 Impurity | Vosoritide D-Cys-39 Impurity. Uses: For analytical and research use. Molecular formula: C176H290N56O51S3. Mole weight: 4102.8. Catalog: APB000020. | |
| Vosoritide Des Asn-15 Impurity | Vosoritide Des Asn-15 Impurity. Uses: For analytical and research use. Molecular formula: C176H290N56O51S3. Mole weight: 4102.8. Catalog: APB000021. | |
| Vosoritide Des Glu-4 Impurity | Vosoritide Des Glu-4 Impurity. Uses: For analytical and research use. Molecular formula: C171H283N55O48S3. Mole weight: 3973.7. Catalog: APB000022. | |
| Vosoritide D-His-5 Impurity | Vosoritide D-His-5 Impurity. Uses: For analytical and research use. Molecular formula: C176H290N56O51S3. Mole weight: 4102.8. Catalog: APB000023. | |
| Vosoritide D-Ser-20 Impurity | Vosoritide D-Ser-20 Impurity. Uses: For analytical and research use. Molecular formula: C176H290N56O51S3. Mole weight: 4102.8. Catalog: APB000025. | |
| Vosoritide D-Ser-33 Impurity | Vosoritide D-Ser-33 Impurity. Uses: For analytical and research use. Molecular formula: C176H290N56O51S3. Mole weight: 4102.8. Catalog: APB000026. | |
| Vosoritide D-Tyr-11 Impurity | Vosoritide D-Tyr-11 Impurity. Uses: For analytical and research use. Molecular formula: C176H290N56O51S3. Mole weight: 4102.8. Catalog: APB000027. | |
| Vosoritide Linear Peptide (with out SS bond) | Vosoritide Linear Peptide (with out SS bond). Uses: For analytical and research use. Molecular formula: C176H292N56O51S3. Mole weight: 4104.8. Catalog: APB000028. | |
| Vosoritide Met-34 Oxidised Impurity | Vosoritide Met-34 Oxidised Impurity. Uses: For analytical and research use. Molecular formula: C176H292N56O52S3. Mole weight: 4120.8. Catalog: APB000035. | |
| Vosoritide Tri Sulphide Impurity | Vosoritide Tri Sulphide Impurity. Uses: For analytical and research use. Molecular formula: C175H288N56O51S4. Mole weight: 4120.8. Catalog: APB000036. | |
| Votoplam | Votoplam (PTC518) (Example 37) is an HTT gene regulator with an IC50 ≤ 0.1 μM. Votoplam can be used in the research of Huntington's disease[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: PTC518. CAS No. 2407849-89-0. Pack Sizes: 5 mg; 10 mg; 25 mg. Product ID: HY-156650. | |
| Voxalatamab | Voxalatamab (JNJ-63898081) is a bispecific IgG4 antibody targeting PSMA and CD3. Voxalatamab attacks PSMA-expressing tumor cells by activating T cells. Voxalatamab has anticancer activity and is being studied for the treatment of solid tumors such as prostate cancer[1][2]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: JNJ-63898081; JNJ-081. CAS No. 2411871-58-2. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P99517. | |
| Voxelotor | Voxelotor (GBT 440) is a potent inhibitor of haemoglobin S (HbS) polymerization. Voxelotor has the potential for sickle cell disease (SCD) treatment[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: GBT 440. CAS No. 1446321-46-5. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 200 mg; 500 mg. Product ID: HY-18681. | |
| Voxelotor Impurity 1 | Voxelotor Impurity 1. Uses: For analytical and research use. CAS No. 1282518-60-8. Molecular formula: C12H21BN2O2. Mole weight: 236.1. Catalog: APB1282518608. | |
| Voxilaprevir | Voxilaprevir is an inhibitor of hepatitis C virus (HCV) nonstructural (NS) protein 3/4A protease. Category: Active pharmaceutical ingredients. CAS No. 1535212-07-7. Product ID: API1535212077. Molecular formula: C40H52F4N6O9S. Mole weight: 868.93. |  |
| Voxilaprevir | Voxilaprevir (GS-9857) is a noncovalent, reversible inhibitor of HCV NS3/4A protease inhibitor (PI) with pangenotypic antiviral activity[1]. Voxilaprevir inhibits genotype 1b and 3a wild-type NS3 proteases with Ki values of 0.038 nM and 0.066 nM, respectively[1]. Voxilaprevir is an orally active direct-acting antiviral agent (DAA) and can be used for HCV infection research[2]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: GS-9857. CAS No. 1535212-07-7. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-19840. | |
| Voxtalisib | Voxtalisib (XL765) is a potent PI3K inhibitor, which has a similar activity toward class I PI3K (IC50s=39, 113, 9 and 43?nM for p110α, p110β, p110γ and p110δ, respectively), also inhibits DNA-PK (IC50=150?nM) and mTOR (IC50=157?nM). Voxtalisib (XL765) inhibits mTORC1 and mTORC2 with IC50s of 160 and 910 nM, respectively. Uses: Scientific research. Category: Signaling pathways. Alternative Names: XL765; SAR245409. CAS No. 934493-76-2. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15900. | |
| VP11 Reagent | 10ml Pack Size. Group: Analytical Reagents, Biochemicals, Diagnostic Raw Materials. Formula: KOH ,C4H9N3O2 , H2O. Prepack ID 90004975-10ml. See USA prepack pricing. |  |
| VP1 Reagent | 10ml Pack Size. Group: Analytical Reagents, Biochemicals, Diagnostic Raw Materials. Formula: CH3CH2OH ,C10H8O , H2O. Prepack ID 90005085-10ml. See USA prepack pricing. | |
| VP-22 | VP-22 peptide is from herpes simplex virus type-1. Synonyms: H-Asp-Ala-Ala-Thr-Ala-Thr-Arg-Gly-Arg-Ser-Ala-Ala-Ser-Arg-Pro-Thr-Glu-Arg-Pro-Arg-Ala-Pro-Ala-Arg-Ser-Ala-Ser-Arg-Pro-Arg-Arg-Pro-Val-Asp-OH; HSV-1 protein VP22. Grade: >98%. Molecular formula: C147H255N61O48. Mole weight: 3645.02. | |
| VP3.15 dihydrobromide | VP3.15 dihydrobromide is a highly potent, orally bioavailable, and CNS-penetrant PDE7-GSK3 dual inhibitor, with IC50 values of 1.59 μM and 0.88 μM against PDE7 and GSK3, respectively. VP3.15 dihydrobromide elevates intracellular cAMP levels, suppresses immune responses, enhances remyelination, limits excessive tau phosphorylation, and alleviates neuroinflammation and neuronal loss. VP3.15 dihydrobromide promotes oligodendrocyte precursor cell differentiation, improves in vivo remyelination, inhibits autoimmune encephalomyelitis, and mitigates germinal matrix-intraventricular hemorrhage-related brain injury, cerebral atrophy, ventricular enlargement, and cognitive impairment. VP3.15 dihydrobromide can be used in research related to multiple sclerosis and germinal matrix-intraventricular hemorrhage[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1281681-33-1. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-128879A. | |
| VPA (Valproic acid) | VPA (Valproic acid) is a fatty acid with anticonvulsant properties used in the treatment of epilepsy. It is also a histone deacetylase (HDAC) inhibitor and is under investigation for treatment of HIV and various cancers. Valproic acid (VPA) induces autophagy and mitophagy by upregulation of BNIP3 and mitochondrial biogenesis by upregulating PGC-1α. Valproic acid activates Notch-1 signaling. Group: Inhibitors. Alternative Names: 2-Propylvaleric Acid, Valproate. CAS No. 99-66-1. Pack Sizes: 25mg. Product ID: S3944. Formula: C8H16O2. Smiles: CCCC(CCC)C(=O)O. Storage Conditions: 2 years -20°C liquid. |  United States; Europe |
| VPC 01091 | VPC 01091. Group: Others. Purity: >99%. Mole weight: 339.943. Stability: 6 Months. Storage: -20°C. Avanti Polar Lipids; lipid products; bioactive lipids; fluorescent lipids; singnal transduction; cell pathways; VPC 01091; ((1R,3S)-1-amino-3-(3-octylphenyl)cyclopentyl)methanol (hydrochloride salt). Cat No: FLBZ-104. |  |
| VPC01091.4 | VPC01091.4 (VPC4) is a TRPM7 inhibitor and blocks TRPM7 current at low micromolar concentrations. VPC01091.4 can penetrate the blood-brain barrier. VPC01091.4 is an efficacious anti-inflammatory agent that arrests systemic inflammation in vivo[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: VPC4. CAS No. 945604-76-2. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-157227. | |
| VPC 01211 | VPC 01211. Group: Others. Purity: >99%. Mole weight: 383.462. Stability: 6 Months. Storage: -20°C. Avanti Polar Lipids; lipid products; bioactive lipids; fluorescent lipids; singnal transduction; cell pathways; VPC 01211; ((1R,3S)-1-ammonio-3-(4-octylphenyl)cyclopentyl)methyl hydrogen phosphate. Cat No: FLBZ-093. | |
| VPC-14228 | VPC-14228 is an inhibitor that selectively targets androgen receptor DNA binding domain (AR-DBD). VPC-14228 inhibits the interaction between AR and DNA, thereby blocking AR-mediated transcriptional activation. VPC-14228 does not rely on nuclear localization inhibition, but rather inhibits the activity of full-length AR and splice variant AR-V7 by interfering with AR binding to chromatin. And VPC-14228 has high selectivity for other nuclear receptors such as ER and PR. VPC-14228 can be used in the study of prostate cancer[1] | |
| VPC-14449 | VPC-14449 is a potent and selective inhibitor of the DNA-binding domain of the androgen receptor (AR-DBD), with IC50 of 0.34 μM for full-length human AR. VPC-14449 reduces the ability of full-length AR as well as AR variants to interact with chromatin. VPC-14449 can be used for the research of prostate cancer[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1621375-32-3. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-116501. | |
| VPC-18005 | VPC-18005 inhibits ERG-induced transcription and interacts directly with the ERG-ETS domain, and disrupts the ERG binding to DNA. VPC-18005 is a potent inhibitor of luciferase activity[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2242480-48-2. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-122234. | |
| VPC 23019 | VPC 23019, an aryl amide-containing Sphingosine 1-phosphate (S1P) analog, is a competitive antagonist at the S1P1 and S1P3 receptors (pKi= 7.86 and 5.93, respectively) and an agonist at the S1P4 and S1P5 receptors (pEC50= 6.58 and 7.07, respectively)[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 449173-19-7. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-108490. | |
| VPC 23019 | VPC 23019. Group: Biochemicals. Grades: Purified. CAS No. 449173-19-7. Pack Sizes: 10mg. US Biological Life Sciences. |  Worldwide |
| VPC 51299 | VPC 51299. Group: Others. Purity: >99%. Mole weight: 670.74. Stability: 6 Months. Storage: -20°C. Avanti Polar Lipids; lipid products; bioactive lipids; fluorescent lipids; singnal transduction; cell pathways; VPC 51299; (R,E)-(3-palmitamido-4-(4-((4-(2,2,2-trifluoroethoxy)pyriDin-2-yl)methoxy)phenyl)but-1-en-1-yl)phosphonic acid. Cat No: FLBZ-019. | |
| VPC-70619 | VPC-70619 is a potent N-Myc inhibitor. VPC-70619 blocks the binding of the N-Myc-Max heterocomplex to the DNA E-box and exhibits potent inhibitory activity against N-Myc-dependent cell lines. VPC-70619 can partially reverse paclitaxel (HY-B0015) resistance in cells by reducing MYCN expression. VPC-70619 can be used for cancer research (e.g., neuroblastoma and thyroid cancer)[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2361742-30-3. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-144878. | |
| VPC-80051 racemate | VPC-80051 racemate is a racemate of VPC-80051. VPC-80051 is a prototype inhibitor of the hnRNP A1 splicing factor[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 877969-69-2. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-126076. | |
| VP/Dimethylaminoethylmethacrylate Copolymer | VP/Dimethylaminoethylmethacrylate Copolymer. Alternative Names: 2-Propenoicacid,2-methyl-,2-(dimethylamino)ethylester,polymerwith1-ethenyl-2-pyrrolidinone. CAS No. 30581-59-0. Purity: 0.95. Product ID: CI-OT-0019. Molecular formula: C14H24N2O3. Mole weight: 268.35 g/mol. IUPAC Name: 2-(dimethylamino)ethyl 2-methylprop-2-enoate;1-ethenylpyrrolidin-2-one. Alfa Chemistry - ISO 9001:32057 Certified. |  |
| vp/eicosene copolymer | vp/eicosene copolymer. CAS No. 28211-18-9. Molecular formula: C26H49NO. Mole weight: 391.7g/mol. IUPAC Name: 1-ethenylpyrrolidin-2-one;icos-1-ene. SMILES: CCCCCCCCCCCCCCCCCCC=C.C=CN1CCCC1=O. InChI: InChI=1S/C20H40.C6H9NO/c1-3-5-7-9-11-13-15-17-19-20-18-16-14-12-10-8-6-4-2;1-2-7-5-3-4-6(7)8/h3H,1,4-20H2,2H3;2H,1,3-5H2. |  |
| VPM peptide | VPM peptide is a dithiol protease-cleavable peptide cross-linker. VPM peptide can be incorporated into the backbone of the PEG-diacrylate (PEG-DA) macromer to form PEG hydrogel[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1428885-83-9. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P3159. | |
| Vps34-IN-1 | Vps34-IN-1 is a potent and selective inhibitor of class III Vps34 PI3K. Vps34-IN-1 inhibits phosphorylation of PtdIns by recombinant insect cell expressed Vps34-Vps15 complex with an IC50 of ~25 nM. Vps34-IN-1 can suppress SGK3 activation by reducing PtdIns(3)P levels via lowering phosphorylation of T-loop and hydrophobic motifs. Vps34-IN-1 modulates autophagy[1][2][3]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1383716-33-3. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-12795. | |
| VPS34-IN1 | Vps34-IN1 is a potent and highly selective Vps34 inhibitor with IC50 of 25 nM invitro,which does not significantly inhibit the isoforms of class I as well as class II PI3Ks. Vps34-IN1 modulates autophagy. Group: Inhibitors. Alternative Names: Vps34-IN-1. CAS No. 1383716-33-3. Pack Sizes: 5mg. Product ID: S7980. Formula: C21H24ClN7O. Smiles: CC(C)(CNC1=NC=C(C(=N1)CC2CC2)C3=NC(=NC=C3)NC4=CC(=NC=C4)Cl)O. Storage Conditions: 2 years -80 in solvent. | United States; Europe |
| Vps34-IN-4 | Vps34-IN-4 (compound 19) is a potent, selective, and orally active inhibitor of VPS34. Vps34-IN-4 inhibits the autophagy in vivo. Autophagy is a dynamic process that regulates lysosomal-dependent degradation of cellular components[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1383716-46-8. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-123058. | |
| Vps34-PIK-III | Vps34-PIK-III is an orally active and selective VPS34 inhibitor (IC50=18 nM). Vps34-PIK-III effectively inhibits autophagy and can be used as a molecular tool. vps34-PIK-III is also a PI3K inhibitor that inhibits the expression of genes in liver cancer stem cells (CSCs)[1][2][3]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1383716-40-2. Pack Sizes: 10 mM * 1 mL in DMSO; 2 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-12794. | |
| VRC-01 | VRC-01 is a broadly neutralizing IgG1 monoclonal antibody that targets HIV-1 envelope glycoprotein gp120 Protein. VRC-01 blocks HIV-1 viral entry by mimicking CD4 receptor interaction with HIV-1 gp120 and neutralizes broad HIV-1 clades. VRC-01 can be used for the research of HIV-1 infection[1][2][3][4]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1412901-55-3. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-P991069. | |
| VrCRP | VrCRP is a peptide isolated from V. radiata (a bruchid-resistant mungbean). It has activity against bacteria and fungi. Synonyms: Arg-Thr-Cys-Met-Ile-Lys-Lys-Glu-Gly-Trp-Gly-Lys-Cys-Leu-Ile-Asp-Thr-Thr-Cys-Ala-His-Ser-Cys-Lys-Asn-Arg-Gly-Tyr-Ile-Gly-Gly-Asp-Cys-Lys-Gly-Met-Thr-Arg-Thr-Cys-Tyr-Cys-Leu-Val-Asn-Cys. Molecular formula: C211H347N65O63S10. Mole weight: 5123.07. | |
| VrD1 | VrD1 is an antimicrobial plant peptide isolated from Vigna radiata. It has activity against fungi. Synonyms: Arg-Thr-Cys-Met-Ile-Lys-Lys-Glu-Gly-Trp-Gly-Lys-Cys-Leu-Ile-Asp-Thr-Thr-Cys-Ala-His-Ser-Cys-Lys-Asn-Arg-Gly-Tyr-Ile-Gly-Gly-Asn-Cys-Lys-Gly-Met-Thr-Arg-Thr-Cys-Tyr-Cys-Leu-Val-Asn-Cys. | |
| VrD2 | VrD2 is an plant antimicrobial peptide isolated from Vigna radiata. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: Lys-Thr-Cys-Glu-Asn-Leu-Ala-Asn-Thr-Tyr-Arg-Gly-Pro-Cys-Phe-Thr-Thr-Gly-Ser-Cys-Asp-Asp-His-Cys-Lys-Asn-Lys-Glu-His-Leu-Arg-Ser-Gly-Arg-Cys-Arg-Asp-Asp-Phe-Arg-Cys-Trp-Cys-Thr-Arg-Asn-Cys. Molecular formula: C222H347N77O72S8. Mole weight: 5503.15. | |
| VRK1/CK1-IN-1 | VRK1/CK1-IN-1 (compound 36) is a dual VRK1 and CK1 family inhibitor, with a Ki of 37.9 nM against human VRK1, 8.3 nM against human CK1δ, and 7.8 nM against human CK1ε. VRK1/CK1-IN-1 exhibits extremely low activity against VRK2. VRK1/CK1-IN-1 can be used in studies related to p53-deficient tumors[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 3050772-20-5. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg. Product ID: HY-158975. | |
| VRK-IN-1 | VRK-IN-1 is a potent and selective inhibitor of vaccinia-related kinases 1 (VRK1), with an IC50 of 150 nM. VRK1 is human Ser/Thr protein kinases associated with increased cell division and neurological disorders[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2378855-09-3. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-126542. | |
| VRT-043198 | VRT-043198, the agent metabolite of VX-765 (Belnacasan), is a potent, selective and blood-brain barrier permeable inhibitor of interleukin-converting enzyme/caspase-1 subfamily caspases. VRT-043198 exhibits Ki values of 0.8 nM and 0.6 nM for ICE/caspase-1 and caspase-4, respectively[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 244133-31-1. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-112226. | |
| VRT-325 | VRT-325 is a CFTR modulator. VRT-325 inhibits disulfide cross-linking between cysteines in transmembrane segments 6 and 7 of CFTR and P-gp. VRT-325 promotes maturation of CFTR and P-gp processing mutants, rescues ΔF508-CFTR folding at the endoplasmic reticulum. VRT-325 binds ΔF508-CFTR nucleotide-binding domain 1, and increases mature ΔF508-CFTR cell surface expression and chloride conductance. VRT-325 can be used for the research of cystic fibrosis[1][2][3]. Uses: Scientific research. Category: Signaling pathways. CAS No. 815592-21-3. Pack Sizes: 1 mg; 5 mg. Product ID: HY-119229. | |
| VS-5584 | VS-5584 is a pan-PI3K/mTOR kinase inhibitor with IC50s of 16 nM, 68 nM, 42 nM, 25 nM, and 37 nM for PI3Kα, PI3Kβ, PI3Kδ, PI3Kγ and mTOR, respectively. VS-5584 simultaneously blocks mTORC2 as well as mTORC1. Uses: Scientific research. Category: Signaling pathways. Alternative Names: SB2343. CAS No. 1246560-33-7. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-16585. | |
| VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is the first N-terminal 1-28 residues of Exendin-4 peptide. Exendin-4 is a pure GLP-1 receptor agonist. Mole weight: 3241.7. | |
| VSN-16 | VSN-16 is a cannabinoid receptor agonist with vasodilatory activity. VSN-16 can be used for the study of multiple sclerosis[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 863713-78-4. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-122153. | |
| Vsp I | One unit of the enzyme is the amount required to hydrolyze 1 μg of Lambda DNA in 1 hour at 37°C in a total reaction volume of 50 μl. Applications: After 10-fold overdigestion with enzyme 70% of the dna fragments can be ligated.of these, 90% can be recut. in the presence of 10% peg ligation is better. Group: Restriction Enzymes. Purity: 1000U; 5000U. AT↑TAAT TAAT↓TA. Activity: 10000u.a./ml. Appearance: 10 X SE-buffer W. Storage: -20°C. Form: Liquid. Source: An E.coli strain, that carries the cloned gene VspI from Vibrio species 343. Pack: 10 mM Tris-HCl (pH 7.6); 50 mM NaCl; 0.1 mM EDTA; 1 mM DTT; 200 μg/ml BSA; 50% glycerol. Cat No: ET-1187RE. | |
| VSV-G Peptide | VSV-G Peptide, vesicular stomatitis virus G (VSV-G) protein fragment, is commonly engineered onto the N- or C- terminus of a protein of interest so that the tagged protein can be analyzed and visualized using immunochemical methods. Synonyms: H-Tyr-xiThr-Asp-xiIle-Glu-Met-Asn-Arg-Leu-Gly-Lys-OH; L-tyrosyl-(3xi)-L-threonyl-L-alpha-aspartyl-(3xi)-L-isoleucyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-arginyl-L-leucyl-glycyl-L-lysine. Molecular formula: C57H94N16O19S. Mole weight: 1339.52. | |
| VSV-G tag Peptide | VSV-G tag Peptide is a 11 amino acid peptide derived from the Vesicular Stomatitis viral glycoprotein. VSV-G tag Peptide can integrate into the cell membranes of animal cells, induce cell fusion, and significantly enhance the efficiency of DNA transfection into animal cells. VSV-G tag Peptide can be used for research on drug delivery[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 103425-05-4. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P0328. | |
| VT02956 | VT02956 is a LATS inhibitor (IC50: 0.76 nM for LATS1, 0.52 nM for LATS2). VT02956 targets the Hippo pathway. VT02956 inhibits ESR1 expression and growth of ER+ breast cancer cell lines and patient-derived tumor organoids[1]. VT02956 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Category: Signaling pathways. CAS No. 2999763-09-4. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-147165. | |
| VT103 | VT103, an analog of VT101, is an orally active and selective TEAD1 protein palmitoylation inhibitor. VT103 inhibits YAP/TAZ-TEAD promoted gene transcription, blocks TEAD auto-palmitoylation, and disrupts interaction between YAP/TAZ and TEAD. VT103 can be used for the research of cancer[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2290608-13-6. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-134955. | |
| VT104 | VT104 is a potent and orally active YAP/TAZ inhibitor. VT104 prevents palmitoylation of endogenous TEAD1 and TEAD3 proteins. VT104 can be used in research of cancer[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2417718-25-1. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 250 mg; 500 mg; 1 g. Product ID: HY-134956. | |
| VT107 | VT-107, as an analogous to VT104, is an orally active and potent pan-TEAD auto-palmitoylation inhibitor. VT-107 can be used for the research of cancer[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2417718-63-7. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-134957. | |
| VT-1598 | VT-1598 is an orally active and selective fungal inhibitor targeting CYP51. VT-1598 shows anti-fungal activity against Candida auris[1][2]. VT-1598 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Category: Signaling pathways. CAS No. 2089320-99-8. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-123777. | |
| VT3989 | VT3989 (YAP/TAZ inhibitor-3) is a potent and selective oral inhibitor of TEAD auto-palmitoylation, blocking its interaction with yes-associated protein (YAP). It exhibits antitumor activity and shows potential for treating mesothelioma and solid tumors with NF2 mutations. Group: Inhibitors. Alternative Names: YAP/TAZ inhibitor-3. CAS No. 2506273-81-8. Pack Sizes: 1mg. Product ID: E6486. Formula: C21H18F3NO3. | United States; Europe |
Our database is helping our users find suppliers everyday.
