A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| GloPIPs Biotin-PI(5)P | PI(5)P is a rare lipid found in the nucleus that can bind the PHD finger of the nuclear adapter protein ING2. PI(5)P is phosphorylated to PI(4,5)P2 by Type II PIP kinases. Molecular formula: C31H53N4Na3O17P2S. Mole weight: 916.75. |  |
| GlowDot | GlowDot. Uses: Cell imaging, ph sensing, fluorescence, drug delivery and etc. Group: other quantum dots. |  |
| Gloxazone | Gloxazone is an effective anaplasmacide. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Contrapar, Gloxazon, GLOXAZONE, KTS, pharmaceutical, Kethoxal bis(thiosemicarbazone), NSC82116, AIDS125723, AIDS-125723, BW 356C61, CID9571200, KC 1331, WR 9838, (1-Ethoxyethyl)glyoxal bis(thiosemicarbazone). alpha.-Ethoxyethylglyoxal dithiosemicarbazone, 3-Ethoxy-2-oxobutyraldehyde bis(thiosemicarbazone), Butyraldehyde, 3-ethoxy-2-oxo-, bis(thiosemicarbazone), 2-((Aminocarbothioyl)hydrazono)-3-ethoxybutanal thiosemicarbazone, Butyraldehyde, 3-ethoxy-2-oxo-, bis(thiosemicarbazone, hemihydrate, 2507-91-7, Hydrazinecarbothioamide, 2, {2-[1-(1-ethoxyethyl)-1,2-ethanediylidene]bis-}. Product Category: Inhibitors. Appearance: Solid. CAS No. 2507-91-7. Molecular formula: C8H16N6OS2. Mole weight: 276.38. Purity: 0.96. IUPACName: [(E)-[(1E)-1-(carbamothioylhydrazinylidene)-3-ethoxybutan-2-ylidene]amino]thiourea. Canonical SMILES: CC(C(/C=N/NC(N)=S)=N\NC(N)=S)OCC. Density: 1.41g/cm³. Product ID: ACM2507917. Alfa Chemistry ISO 9001:2015 Certified. |  |
| GLP-1 | Glucagon-like peptide-1 (GLP-1) is a potent insulin secretagogue that has multiple synergetic effects on the glucose-dependent insulin secretion pathways of the beta-cell. Synonyms: Glucagon-like peptide 1. CAS No. 89750-14-1. Molecular formula: C149H226N40O45. Mole weight: 3297.7. | |
| Glp-1(1-36)amide(human,bovine,guinea pig,mouse,rat) | Glp-1(1-36)amide(human,bovine,guinea pig,mouse,rat). Uses: Designed for use in research and industrial production. Additional or Alternative Names: GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat);Glucagon-like peptide 1 amide. Product Category: Heterocyclic Organic Compound. CAS No. 99658-04-5. Molecular formula: C184H273N51O57. Mole weight: 4111.44. Purity: 0.96. Product ID: ACM99658045. Alfa Chemistry ISO 9001:2015 Certified. | |
| GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) | GLP-1 (1-36) amide is a promising peptide hormone unlocking avenues for type 2 diabetes mellitus research. Its extraordinary resemblance to the native GLP-1 facilitates heightened glucose-dependent insulin secretion. Synonyms: Preproglucagon (92-127) amide (human, bovine, guinea pig, mouse, rat); Glucagon-like peptide 1 (1-36) amide (human, bovine, guinea pig, mouse, rat); H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2; L-histidyl-L-alpha-aspartyl-L-alpha-glutamyl-L-phenylalanyl-L-alpha-glutamyl-L-arginyl-L-histidyl-L-alanyl-L-alpha-glutamyl-glycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-alpha-glutamyl-glycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-alpha-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysyl-glycyl-L-argininamide. Grade: ≥95%. CAS No. 99658-04-5. Molecular formula: C184H273N51O57. Mole weight: 4111.44. | |
| GLP-1 (25-37), human | GLP-1 is a potent insulin secretagogue that has multiple synergetic effects on the glucose-dependent insulin secretion pathways of the beta-cell. Synonyms: Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly. Molecular formula: C70H111N19O16. Mole weight: 1474.84. | |
| GLP-1(28-36)amide acetate | GLP-1(28-36)amide acetate inhibits mitochondrial permeability transition with antioxidant, anti-diabetic and cardioprotection activities. Molecular formula: C56H89N15O11. Mole weight: 1148.40. | |
| GLP-1(32-36)amide | GLP-1(32-36)amide, a pentapeptide, derived from the C terminus of the glucoregulatory hormone GLP-1. GLP-1(32-36)amide could inhibit weight gain and modulate whole body glucose metabolism in diabetic mice [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 1417302-71-6. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P3102. |  |
| GLP-1 (7-36) Acetate | GLP-1 (7-36) is an intestinal hormone that stimulates glucose-induced β cells to secrete insulin. Synonyms: Human GLP-1-(7-36)-amide Acetate. Grade: >98%. CAS No. 1119517-19-9. Molecular formula: C149H226N40O45.xC2H4O2. Mole weight: 3394.67. | |
| GLP-1(7-36) amide | GLP-1(7-36) amide is a glucose-dependent insulinotropic peptide displaying high affinity for GLP-1 receptors expressed in rat insulinoma-derived RINm5F cells (Kd = 204 pM). GLP-1 (7-36) amide exhibits antiapoptotic effects in hippocampal neurons and reduces food intake in fasted rats following central administration. Synonyms: GLP-1; GLP-1 (7-36) amide; Insulinotropin. Grade: 98%. CAS No. 107444-51-9. Molecular formula: C149H226N40O45. Mole weight: 3297.67. | |
| GLP-1(7-36), amide | GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretion. Uses: Scientific research. Group: Peptides. Alternative Names: Glucagon-like peptide-1 (GLP-1)(7-36), amide; Human GLP-1 (7-36), amide. CAS No. 107444-51-9. Pack Sizes: 1 mg. Product ID: HY-P0054A. | |
| GLP-1(7-36), amide acetate | GLP-1(7-36), amide acetate is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells. Uses: Scientific research. Group: Peptides. Alternative Names: Glucagon-like peptide-1 (GLP-1)(7-36), amide acetate; Human GLP-1 (7-36), amide acetate. CAS No. 1119517-19-9. Pack Sizes: 500 μg; 1 mg; 5 mg; 10 mg. Product ID: HY-P0054. | |
| GLP-1 (7-36) amide (chicken, common turkey) | GLP-1 (7-36) amide (chicken, common turkey). Synonyms: Preproglucagon (118-147) amide (chicken, common turkey); H-His-Ala-Glu-Gly-Thr-Tyr-Thr-Ser-Asp-Ile-Thr-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Asn-Gly-Arg-NH2; L-histidyl-L-alanyl-L-alpha-glutamyl-glycyl-L-threonyl-L-tyrosyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-isoleucyl-L-threonyl-L-seryl-L-tyrosyl-L-leucyl-L-alpha-glutamyl-glycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-alpha-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-asparagyl-glycyl-L-argininamide; Glucagon-Like Peptide 1 (7-36) amide (chicken, common turkey). Grade: ≥95% by HPLC. CAS No. 1802078-26-7. Molecular formula: C149H224N40O47. Mole weight: 3327.66. | |
| GLP-1 (7-36) amide trifluoroacetate salt | GLP-1 (7-36) amide is an important peptide hormone that displays a strong insulinotropic effect. It binds the GLP-1 receptor (pIC50 = 8.5) in the pancreas and shows various antidiabetic effects. Synonyms: Glucagon-like Peptide 1 (7-36) amide. Mole weight: 3297.6. | |
| GLP-1 (7-36)-Lys(6-FAM) amide (human, bovine, guinea pig, mouse, rat) | GLP-1 (7-36)-Lys(6-FAM) amide (human, bovine, guinea pig, mouse, rat). Synonyms: Preproglucagon (98-127)-Lys(6-FAM)amide (human, bovine, guinea pig, mouse, rat); H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Lys(fluorescein-6-carbonyl)-NH2; Proglucagon (78-107)-Lys(6-FAM)amide (human, bovine, guinea pig, mouse, rat); Glucagon-Like Peptide 1 (7-36)-Lys(6-FAM)amide (human, bovine, guinea pig, mouse, rat). Grade: ≥95%. CAS No. 1802089-53-7. Molecular formula: C176H248N42O52. Mole weight: 3784.16. | |
| GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) | GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat). Synonyms: Preproglucagon (98-127)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat); H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Lys(biotinyl)-NH2; Proglucagon (78-107)-Lys(biotinyl)amide (human, bovine, guinea pig, mouse, rat); Glucagon-Like Peptide 1 (7-36)-Lys(biotinyl)amide (human, bovine, guinea pig, mouse, rat). Grade: ≥95%. CAS No. 1802086-70-9. Molecular formula: C165H252N44O48S. Mole weight: 3652.15. | |
| GLP-1(7-37) | GLP-1(7-37) is an intestinal insulinotropic hormone that augments glucose induced insulin secretion. Uses: Scientific research. Group: Peptides. CAS No. 106612-94-6. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg. Product ID: HY-P0055. | |
| GLP-1(7-37) | GLP-1 (7-37) is an insulinotropic peptide generated from the precursor peptide GLP-1 (1-37). It is a potent stimulator of insulin secretion at concentrations as low as 5 X 10(-11) M and has no effect on insulin secretion even at concentrations as high as 5 X 10(-7) M. It participates in the physiological regulation of insulin secretion. Uses: Glp-1 (7-37) acetate participates in the physiological regulation of insulin secretion. Synonyms: Proglucagon (78-108) (human, bovine, guinea pig, mouse, rat); Insulinotropin (human, bovine, guinea pig, mouse, rat); Glucagon-Like Peptide 1 (7-37) (human, bovine, guinea pig, mouse, rat); Preproglucagon (98-128) (human, bovine, guinea pig, mouse, rat); GLP-1 (7-37) human; Glucagon-like Peptide-1 (7-37); H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH; L-histidyl-L-alanyl-L-alpha-glutamyl-glycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-alpha-glutamyl-glycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-alpha-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysyl-glycyl-L-arginyl-glycine. Grade: 98%. CAS No. 106612-94-6. Molecular formula: C151H228N40O47. Mole weight: 3355.67. | |
| Glp-1(7-37)acetate | Glp-1(7-37)acetate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: GLP-1 (7-37) acetate;GLP-1 (7-36) amide Acetate (GMP);GLP-1 (7-37) human;GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat);Glucagon-like peptide 1 (7-37) (human). Product Category: Heterocyclic Organic Compound. CAS No. 106612-94-6. Molecular formula: C151H228N40O47. Mole weight: 3355.67. Purity: >95%. Product ID: ACM106612946. Alfa Chemistry ISO 9001:2015 Certified. Categories: GLP-1(7-37) Acetate. | |
| GLP-1(7-37) acetate | GLP-1(7-37) acetate is an intestinal insulinotropic hormone that augments glucose induced insulin secretion [1]. Uses: Scientific research. Group: Peptides. CAS No. 1450806-98-0. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-P0055A. | |
| GLP-1 (9-36) amide | GLP-1 (9-36) amide is an N-terminal truncated metabolite of glucagon-like peptide GLP-1-(7-36) formed by dipeptidyl peptidase-IV cleavage. GLP-1 (9-36) amide functions as a human GLP-1 receptor antagonist. Synonyms: Glucagon-like peptide-1 (9-36) amide; Glucagon-like peptide-1 (9 36) amide. CAS No. 161748-29-4. Molecular formula: C140H214N36O43. Mole weight: 3089.44. | |
| GLP-1(9-36)amide | GLP-1(9-36)amide is a major metabolite of glucagon-like peptide-1-(7-36) amide formed by the enzyme dipeptidyl peptidase-4 (DPP-4). GLP-1(9-36)amide acts as an antagonist to the human pancreatic GLP-1 receptor [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 161748-29-4. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P1141. | |
| GLP-1 antagonist | A glucagon-like peptide-1 (GLP-1) receptor antagonist. Synonyms: GLP-1 antagonist; GLP 1 antagonist; N-[[4,5-dimethyl-1-[(2-methylphenyl)methyl]imidazol-2-yl]methyl]-2,4-dimethoxy-N-(3-methylbutyl)benzamide. Grade: 99%. CAS No. 475466-57-0. Molecular formula: C28H37N3O3. Mole weight: 463.61. | |
| GLP-1, IGF-1 (1-3) | GLP-1, IGF-1 (1-3) is a fragment of amino acids of Glucagon-like peptide-1. Grade: 98%. Molecular formula: C12H19N3O6. Mole weight: 301.3. | |
| GLP-1 moiety from Dulaglutide | GLP-1 moiety from Dulaglutide is a fragment of Dulaglutide containing 31 amino acids, and Dulaglutide is a glucagonlike peptide 1 receptor (GLP-1) agonist. Synonyms: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Gly. Grade: ≥98%. Molecular formula: C149H221N37O49. Mole weight: 3314.62. | |
| GLP-1R agonist 2 | GLP-1R agonist 2 (compound 2) is an effective GLP-1R agonist that exerts its activating effect by forming hydrogen bonds with the Tyr42, Cys71, and Ser84 residues of GLP-1R. GLP-1R agonist 2 has the potential for research in metabolic diseases such as type 2 diabetes and obesity[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 281209-71-0. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-121835. | |
| GLP-1R agonist 4 | GLP-1R agonist 4 is a potent agonist of GLP-1R. Glucagon-like peptide-1 (GLP-1) is an intestinal hypoglycemic hormone secreted by L-cells in the lower gastrointestinal tract. GLP-1R agonist 4 has the potential for the research of diabetes (extracted from patent WO2019239319A1, compound 96) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2401894-26-4. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-144035. | |
| GLP-1R agonist DMB | GLP-1R agonist DMB is a glucagon-like peptide-1 (GLP-1) receptor agonist used potentially for the treatment of type 2 diabetes. Uses: Potential treatment of type 2 diabetes. Synonyms: N-(tert-Butyl)-6,7-dichloro-3-(methylsulfonyl)quinoxalin-2-amine. Grade: 99%. CAS No. 281209-71-0. Molecular formula: C13H15Cl2N3O2S. Mole weight: 348.25. | |
| GLP-1R Antagonist 1 | GLP-1R Antagonist 1 (compound 5d) is an orally active, CNS penetrant and non-competitive antagonist of glucagon-like peptide 1 receptor (GLP-1R), with an IC50 of 650 nM[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 488097-06-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-101116. | |
| GLP-1 receptor agonist 10 | GLP-1 receptor agonist 10 (compound 42) is an agonist of GLP Receptor. GLP-1 receptor agonist 10 inhibits food intake and reduces glucose excursion in mice. GLP-1 receptor agonist 10 can be used in the study of type 2 diabetes (T2DM) and obesity [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 3015555-46-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-153798. | |
| GLP-1 receptor agonist 12 | GLP-1 receptor agonist 12 (compound 20A) is an agonist of GLP Receptor. GLP-1 receptor agonist 12 can be used in the study of diseases such as diabetes [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2775376-50-4. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-153816. | |
| GLP-1 receptor agonist 2 | GLP-1 receptor agonist 2 is an agonist of glucagon-like peptide-1 receptor (GLP-1R). Synonyms: 1H-Benzimidazole-6-carboxylic acid, 2-[[(2S)-4-[6-[(4-chloro-2-fluorophenyl)methoxy]-2-pyridinyl]-2-methyl-1-piperazinyl]methyl]-1-[(2S)-2-oxetanylmethyl]-; 2-{[(2S)-4-{6-[(4-Chloro-2-fluorobenzyl)oxy]-2-pyridinyl}-2-methyl-1-piperazinyl]methyl}-1-[(2S)-2-oxetanylmethyl]-1H-benzimidazole-6-carboxylic acid. Grade: ≥95%. CAS No. 2230197-64-3. Molecular formula: C30H31ClFN5O4. Mole weight: 580.05. | |
| GLP-1 receptor agonist 2 | GLP-1 receptor agonist 2 is a glucagon-like peptide-1 receptor (GLP-1R) agonist. Uses: Scientific research. Group: Signaling pathways. CAS No. 2230197-64-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg. Product ID: HY-112679. | |
| GLP-1 receptor agonist 3 | GLP-1 receptor agonist 3 is a GLP-1 receptor agonist with EC50s of 1.1 and 13 nM in Clone H6 and Clone C6 cell lines assay, respectively. (Extracted from patent WO2018109607A1, Example 4A-1). Synonyms: 1H-Benzimidazole-6-carboxylic acid, 2-[[4-[6-[(4-cyano-2-fluorophenyl)methoxy]-2-pyridinyl]-1-piperidinyl]methyl]-1-[(2R)-2-oxetanylmethyl]-; 2-[(4-{6-[(4-Cyano-2-fluorobenzyl)oxy]-2-pyridinyl}-1-piperidinyl)methyl]-1-[(2R)-2-oxetanylmethyl]-1H-benzimidazole-6-carboxylic acid. Grade: ≥95%. CAS No. 2230200-09-4. Molecular formula: C31H30FN5O4. Mole weight: 555.60. | |
| GLP-1 receptor agonist 4 | GLP-1 receptor agonist 4, a glucagon-like peptide-1 receptor (GLP-1R) agonist with an EC50 of 64.5 nM, can be used in the study of diabetes treatment. (Extracted from patent WO2009111700A2, compound 87). Synonyms: (S)-3-(4'-Cyano-[1,1'-biphenyl]-4-yl)-2-((3R,8S)-3-(4-((3,4-dichlorobenzyl)oxy)phenyl)-1-methyl-2-oxo-7-((S)-1-phenylpropyl)-2,3,6,7,8,9-hexahydro-1H-[1,4]oxazino[3,2-g]isoquinoline-8-carboxamido)propanoic acid; (2S)-3-(4'-Cyano-4-biphenylyl)-2-[({(3R,8S)-3-{4-[(3,4-dichlorobenzyl)oxy]phenyl}-1-methyl-2-oxo-7-[(1S)-1-phenylpropyl]-2,3,6,7,8,9-hexahydro-1H-[1,4]oxazino[3,2-g]isoquinolin-8-yl}carbonyl)amino]propanoic acid. Grade: ≥95%. CAS No. 1187061-62-6. Molecular formula: C51H44Cl2N4O6. Mole weight: 879.82. | |
| GLP-1 receptor agonist 7 | GLP-1 receptor agonist 7 is a potent glucagon-like peptide-1 (GLP-1) agonist with potential to study GLP-1-related diseases, disorders and conditions, including diabetes mellitus. (Extracted from patent WO2021219019A1, compound 130b). Synonyms: 2-((4-((S)-3-(4-chloro-2-fluorophenyl)-2,3-dihydrobenzo[b][1,4]dioxin-5-yl)piperidin-1-yl)methyl)-3-(((S)-oxetan-2-yl)methyl)-3H-imidazo[4,5-b]pyridine-5-carboxylic acid. CAS No. 2736447-04-2. Molecular formula: C31H30ClFN4O5. Mole weight: 593.05. | |
| GLP-1 receptor agonist 7 | GLP-1 receptor agonist 7 is a potent agonist of glucagon-like peptide-1 ( GLP-1 ). GLP-1 receptor agonist 7 has the potential for the research of GLP-1-associated diseases, disorders, and conditions including diabetes mellitus (extracted from patent WO2021219019A1, compound 130b) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2736447-04-2. Pack Sizes: 5 mg; 10 mg. Product ID: HY-145412. | |
| GLP-1 receptor agonist 8 | GLP-1 receptor agonist 8, a potent GLP-1 receptor agonist, has potential in the study of diabetes, obesity and non-alcoholic fatty liver disease (NAFLD). (Extracted from patent WO2019239319A1, compound 17). Synonyms: ammonium (R)-2-((4-(2-(4-chloro-2-fluorophenyl)-2-methylbenzo[d][1,3]dioxol-4-yl)piperidin-1-yl)methyl)-1-((1-ethyl-1H-imidazol-5-yl)methyl)-1H-benzo[d]imidazole-6-carboxylate. CAS No. 2401892-86-0. Molecular formula: C34H36ClFN6O4. Mole weight: 647.14. | |
| GLP-1 receptor agonist 9 | GLP-1 receptor agonist 9 is an agonist of GLP-1 receptor. (Extracted from WO2020234726 A1, example 7). Synonyms: 1H-Benzimidazole-6-carboxylic acid, 2-[[4-[(2S)-2-(4-chloro-2-fluorophenyl)-2-methyl-1,3-benzodioxol-4-yl]-1-piperidinyl]methyl]-1-[(2S)-2-oxetanylmethyl]-. Grade: ≥95%. CAS No. 2401892-71-3. Molecular formula: C32H31ClFN3O5. Mole weight: 592.06. | |
| GLP-1 receptor agonist 9 citrate | GLP-1 receptor agonist 9 is an agonist of GLP-1 receptor. Molecular formula: C38H39ClFN3O12. Mole weight: 784.18. | |
| GLP-1R modulator C16 | GLP-1R modulator C16 is an allosteric modulator that enhances the binding of GLP-1 to GLP-1R through transmembrane site with an EC50 of 8.43±3.82 μM. Synonyms: N-{4-[(2-chloro-6-fluorobenzyl)oxy]-3-methoxybenzyl}-N-[2-(4-morpholinyl)ethyl]amine; N-{4-[(2-Chloro-6-fluorobenzyl)oxy]-3-methoxybenzyl}-2-(4-morpholinyl)ethanamine; 4-Morpholineethanamine, N-[[4-[(2-chloro-6-fluorophenyl)methoxy]-3-methoxyphenyl]methyl]-. Grade: ≥90%. CAS No. 875005-43-9. Molecular formula: C21H26ClFN2O3. Mole weight: 408.89. | |
| GLP-1R modulator C5 | GLP-1R modulator C5 is an allosteric modulator enhancing GLP-1 binding to GLP-1R via a transmembrane site (EC50 1.59 ± 0.53 ?M). Uses: Scientific research. Group: Signaling pathways. CAS No. 421578-93-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-141840. | |
| GLP-1R modulator C5 | GLP-1R modulator C5 is an allosteric modulator that enhances the binding of GLP-1 to GLP-1R through transmembrane site with an EC50 of 1.59±0.53 μM. Synonyms: 3-hydroxy-3-(2-oxo-2-phenylethyl)-1-(2-phenylethyl)-1,3-dihydro-2H-indol-2-one; 2H-Indol-2-one, 1,3-dihydro-3-hydroxy-3-(2-oxo-2-phenylethyl)-1-(2-phenylethyl)-. Grade: ≥90%. CAS No. 421578-93-0. Molecular formula: C24H21NO3. Mole weight: 371.43. | |
| GLP-1R modulator L7-028 | GLP-1R modulator L7-028 is an allosteric modulator that enhances the binding of GLP-1 to GLP-1R through transmembrane site with an EC50 of 11.01±2.73 μM. Synonyms: Benzamide, 3-(cyclopentyloxy)-N-[3-(1-piperidinylcarbonyl)phenyl]-. Grade: ≥95%. CAS No. 2648317-95-5. Molecular formula: C24H28N2O3. Mole weight: 392.49. | |
| GLP-1 TFA | GLP-1 is a potent insulin secretagogue that has multiple synergetic effects on the glucose-dependent insulin secretion pathways of the beta-cell. Synonyms: GLP-1 trifluoroacetate salt; Glucagon-like peptide 1 trifluoroacetate salt; H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2.TFA. | |
| GLP-2 (1-33) (human) | GLP-2 (human) is an endogenous peptide that acts as an intestinal epithelium-specific growth factor. It stimulates cell proliferation and inhibits apoptosis, and also modulates intestinal glucose transport, food intake, and gastric acid secretion. Synonyms: Glucagon-like peptide 2 (human); GLP-2 (human); GLP 2 (human). Grade: >98%. CAS No. 223460-79-5. Molecular formula: C165H254N44O55S. Mole weight: 3766.1. | |
| GLP-2(1-33)(human) | GLP-2(1-33) (human) is an enteroendocrine hormone which can bind to the GLP-2 receptor and stimulate the growth of intestinal epithelium. Uses: Scientific research. Group: Peptides. Alternative Names: GLP-2 (human); Glucagon-like peptide 2 (human). CAS No. 223460-79-5. Pack Sizes: 500 ?g; 1 mg; 5 mg. Product ID: HY-P1024. | |
| GLP-2 (1-34) (human) | GLP-2 (1-34) (human) is a human-derived mimic of glucagon-like peptide 2 employed in studying gastrointestinal disorders such as short bowel syndrome (SBS). Synonyms: Preproglucagon (146-179) (human); H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Arg-OH; L-histidyl-L-alanyl-L-alpha-aspartyl-glycyl-L-seryl-L-phenylalanyl-L-seryl-L-alpha-aspartyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-threonyl-L-isoleucyl-L-leucyl-L-alpha-aspartyl-L-asparagyl-L-leucyl-L-alanyl-L-alanyl-L-arginyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-asparagyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-glutaminyl-L-threonyl-L-lysyl-L-isoleucyl-L-threonyl-L-alpha-aspartyl-L-arginine. Grade: 95%. CAS No. 99120-49-7. Molecular formula: C171H266N48O56S1. Mole weight: 3922.29. | |
| GLP-2 (3-33) | GLP-2 (3-33). Synonyms: Glucagon-Like Peptide 2-(3-33); L-Aspartic acid, L-α-aspartylglycyl-L-seryl-L-phenylalanyl-L-seryl-L-α-aspartyl-L-α-glutamyl-L-methionyl-L-asparaginyl-L-threonyl-L-isoleucyl-L-leucyl-L-α-aspartyl-L-asparaginyl-L-leucyl-L-alanyl-L-alanyl-L-arginyl-L-α-aspartyl-L-phenylalanyl-L-isoleucyl-L-asparaginyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-glutaminyl-L-threonyl-L-lysyl-L-isoleucyl-L-threonyl-; H-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH; L-alpha-aspartyl-glycyl-L-seryl-L-phenylalanyl-L-seryl-L-alpha-aspartyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-threonyl-L-isoleucyl-L-leucyl-L-alpha-aspartyl-L-asparagyl-L-leucyl-L-alanyl-L-alanyl-L-arginyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-asparagyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-glutaminyl-L-threonyl-L-lysyl-L-isoleucyl-L-threonyl-L-aspartic acid. Grade: ≥95%. CAS No. 275801-62-2. Molecular formula: C156H242N40O53S. Mole weight: 3557.89. | |
| GLP-2(3-33) | GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor ( EC 50 =5.8 nM) [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 275801-62-2. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P2625. | |
| GLP-26 | GLP-26 is an HBV capsid assembly modulator (CAM) that inhibits HBV DNA replication (IC50 = 3 nM) in Hep AD38 system and reduces cccDNA by >90% at 1 μM. GLP-26 disrupts pregenomic RNA encapsulation, leading to nucleocapsid disintegration and reduced cccDNA pools. Synonyms: N-(3,4-Difluorophenyl)-1,3,5-trimethyl-4-(2-oxo-2-(prop-2-yn-1-ylamino)acetyl)-1H-pyrrole-2-carboxamide; N-(3,4-Difluorophenyl)-1,3,5-trimethyl-4-[oxo(2-propyn-1-ylamino)acetyl]-1H-pyrrole-2-carboxamide; 1H-Pyrrole-3-acetamide, 5-[[(3,4-difluorophenyl)amino]carbonyl]-1,2,4-trimethyl-α-oxo-N-2-propyn-1-yl-. Grade: ≥98%. CAS No. 2133017-36-2. Molecular formula: C19H17F2N3O3. Mole weight: 373.35. | |
| Glp-2(rat) | GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR). Uses: Designed for use in research and industrial production. Additional or Alternative Names: GLUCAGON-LIKE PEPTIDE 2 (RAT);GLUCAGON-LIKE PEPTIDE II RAT;GLP-2 (RAT);H-HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-THR-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP-OH;HADGSFSDEMNTILDNLATRDFINWLIQTKITD;PREPROGLUCAG. Product Category: Inhibitors. Appearance: Solid. CAS No. 195262-56-7. Molecular formula: C166H256N44O56S. Mole weight: 3796.14. Purity: 0.9804. Product ID: ACM195262567. Alfa Chemistry ISO 9001:2015 Certified. | |
| GLP-2 (rat) | GLP-2 (rat) is an endogenous peptide that acts as an intestinal epithelium-specific growth factor. It stimulates cell proliferation and inhibits apoptosis, and also modulates intestinal glucose transport, food intake, and gastric acid secretion. Synonyms: Preproglucagon (146-178) (rat); H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH; Glucagon-like Peptide 2 (rat); L-histidyl-L-alanyl-L-alpha-aspartyl-glycyl-L-seryl-L-phenylalanyl-L-seryl-L-alpha-aspartyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-threonyl-L-isoleucyl-L-leucyl-L-alpha-aspartyl-L-asparagyl-L-leucyl-L-alanyl-L-threonyl-L-arginyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-asparagyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-glutaminyl-L-threonyl-L-lysyl-L-isoleucyl-L-threonyl-L-aspartic acid. Grade: ≥95%. CAS No. 195262-56-7. Molecular formula: C166H256N44O56S. Mole weight: 3796.17. | |
| GLP-2(rat) | GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR) [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 195262-56-7. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P1142. | |
| GLP-2 (rat) trifluoroacetate salt | GLP-2 is a gut peptide hormone that is primarily produced by enteroendocrine L cells of the small and large intestine. GLP-2 is an antagonist of the GLP-2 receptor (GLP-2R; Ki = 60 pM). Synonyms: Glucagon-like Peptide 2. Grade: ≥95%. Molecular formula: C166H256N44O56S·xCF3COOH. Mole weight: 3796.14. | |
| GLPG0187 | GLPG0187 is a broad spectrum integrin receptor antagonist with antitumor activity; inhibits ?v?1-integrin with an IC50 of 1.3 nM[1]. GLPG0187 inhibits migrasome biogenesis without cytotoxicity[3]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1320346-97-1. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-100506. | |
| GLPG-0187 | GLPG-0187 is a small molecule integrin receptor antagonist (IRA) with nanomolar affinity for the RGD-integrin receptors αvβ1, αvβ3, αvβ5, αvβ6 and α5β1 (IC50s = 1.2-3.7 nM). Integrin receptors are expressed on the surface of tumor vessel endothelial cells and some types of cancer cells, and play a crucial role in endothelial cell adhesion and migration. This compound shows an inhibitory activity of angiogenesis, bone-resorption and tumor, which is hopefully used as an anticancer drug. Uses: An integrin receptor antagonist (ira) can be used as an anticancer drug. Synonyms: GLPG0187; GLPG 0187; GLPG-0187; UNII-43A5P87Z4T; 43A5P87Z4T; SCHEMBL2372722; CHEMBL3319236; (2S)-3-[[2,5-dimethyl-6-[4-(5,6,7,8-tetrahydro-1,8-naphthyridin-2-yl)piperidin-1-yl]pyrimidin-4-yl]amino]-2-[(4-methoxyphenyl)sulfonylamino]propanoic acid. Grade: ≥98 %. CAS No. 1320346-97-1. Molecular formula: C29H37N7O5S. Mole weight: 595.719. | |
| GLPG0492 | GLPG0492, a selective androgen receptor modulator, could be effective in decreasing muscle loss. The treatment study against Duchenne muscular dystrophy of it has alreadt been discontinued. Uses: Glpg0492 is a selective androgen receptor modulator that could be effective in decreasing muscle loss. Synonyms: DT-200; DT 200; DT200; GLPG0492; SCHEMBL2021011; CHEMBL2178100; GLPG 0492; GLPG-0492; VAJGULUVTFDTAS-GOSISDBHSA-N. Grade: 98%. CAS No. 1215085-92-9. Molecular formula: C19H14F3N3O3. Mole weight: 389.33. | |
| GLPG0492 R enantiomer | The R-enantiomer of GLPG0492 which is a selective androgen receptor modulator, could be effective in decreasing muscle loss. Uses: The r-enantiomer of glpg0492 which is a selective androgen receptor modulator that could be effective in decreasing muscle loss. Synonyms: GLPG-0492 R enantiomer; GLPG 0492 R enantiomer; GLPG0492 R enantiomer. Grade: 98%. CAS No. 1215085-93-0. Molecular formula: C19H14F3N3O3. Mole weight: 389.33. | |
| GLPG0634 analog | GLPG0634 analog (Compoun 176) is a broad spectrum JAK inhibitor with IC 50 values of <100 nM against JAK1, JAK2 and JAK3 [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1206101-20-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg. Product ID: HY-13961. | |
| GLPG0634 analogue | A potent and selective JAK1 inhibitor with IC50 values of 10, 28, 810, and 116 nM for JAK1, JAK2, JAK3, and TYK2, respectively. Synonyms: GLPG0634 analog; N-[5-[4-[(6-cyanopyridin-3-yl)methoxy]phenyl]-[1,2,4]triazolo[1,5-a]pyridin-2-yl]cyclopropanecarboxamide. Grade: >98%. CAS No. 1206101-20-3. Molecular formula: C23H18N6O2. Mole weight: 410.43. | |
| GLPG0974 | GLPG0974 is a free fatty acid receptor-2 (FFA2/GPR43) antagonist with an IC50 of 9 nM. Uses: Scientific research. Group: Signaling pathways. CAS No. 1391076-61-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-12940. | |
| GLPG 0974 | GLPG 0974 is a potent FFA2 antagonist (IC50 = 9 nM) with selectivity for FFA2 over FFA3. It was shown that GLPG 0974 inhibited acetate-induced human neutrophil migration in plasma or buffer, and also suppressed FFA2-induced expression of CD11b activation-specific epitope (AE) in human whole blood. Synonyms: GLPG0974; GLPG 0974; GLPG-0974. 4-[[[(2R)-1-(Benzo[b]thien-3-ylcarbonyl)-2-methyl-2-azetidinyl]carbonyl][(3-chlorophenyl)methyl]amino]butanoic acid. Grade: ≥98% by HPLC. CAS No. 1391076-61-1. Molecular formula: C25H25ClN2O4S. Mole weight: 485. | |
| GLPG1205 | GLPG1205 is potent, selective and orally active GPR84 (a G-protein-coupled receptor) antagonist with a favorable PK/PD profile. GLPG1205 has anti-inflammatory activity and is used for the treatment of pulmonary fibrosis[1][2]. GLPG1205 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Group: Signaling pathways. CAS No. 1445847-37-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-135303. | |
| GLPG-1690 | GLPG-1690, an imidazopyridine derivative, has been found to be a selective autotaxin inhibitor that could probably be effective as an anti-inflammatory agent and is under Phase II trial against Idiopathic pulmonary fibrosis (IPF). Synonyms: Ziritaxestat; GLPG 1690; GLPG1690; 2-((2-ethyl-6-(4-(2-(3-hydroxyazetidin-1-yl)-2-oxoethyl)piperazin-1-yl)-8-methylimidazo[1,2-a]pyridin-3-yl)(methyl)amino)-4-(4-fluorophenyl)thiazole-5-carbonitrile. Grade: >98%. CAS No. 1628260-79-6. Molecular formula: C30H33FN8O2S. Mole weight: 588.71. | |
| GLPG1837 | GLPG1837 is a potent, orally available potentiator of cystic fibrosis transmembrane conductance regulator (CFTR) with EC50 of 3 nM and 339 nM on F508del and G551D CFTR, respectively. Synonyms: ABBV-974; N-[3-(aminocarbonyl)-4,7-dihydro-5,5,7,7-tetramethyl-5H-thieno[2,3-c]pyran-2-yl]-1H-pyrazole-3-carboxamide. Grade: ≥98%. CAS No. 1654725-02-6. Molecular formula: C16H20N4O3S. Mole weight: 348.42. | |
| GLPG2938 | GLPG2938 is a potent and selective S1P2 antagonist. GLPG2938 can be used for the research of idiopathic pulmonary fibrosis[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2130996-00-6. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-139310. | |
| GLPG2938 | GLPG2938 is an antagonists of sphingosine-1-phosphate (S1P) receptor for prophylaxis and?/or treatment of diseases including fibrotic, inflammatory, autoimmune, metabolic, cardiovascular, and?/or proliferative diseases. GLPG2938 displayed S1P inhibitory activity.with EC50 value of 9.5 nM (S1P2 antagonist EC50)?. Uses: Designed for use in research and industrial production. Additional or Alternative Names: MUN96006; MUN-96006; MUN 96006; GLPG2938; GLPG-2938; GLPG 2938. Product Category: Antagonists. Appearance: Solid powder. CAS No. 2130996-00-6. Molecular formula: C20H19F6N7O2. Mole weight: 503.41. Purity: >98%. IUPACName: 1-(2-ethoxy-6-(trifluoromethyl)pyridin-4-yl)-3-((5-methyl-6-(1-methyl-3-(trifluoromethyl)-1H-pyrazol-4-yl)pyridazin-3-yl)methyl)urea. Canonical SMILES: O=C(NCC1=NN=C(C2=CN(C)N=C2C(F)(F)F)C(C)=C1)NC3=CC(OCC)=NC(C(F)(F)F)=C3. Product ID: ACM2130996006. Alfa Chemistry ISO 9001:2015 Certified. | |
| GLPG2938 | GLPG2938 is a potent and selective S1P2 antagonist that can be used for the study of idiopathic pulmonary fibrosis. It inhibits S1P-induced calcium flux in CHO cells overexpressing human S1P2 (IC50 = 8.8 nM), inhibits S1P-induced IL-8 release in HFL1 cells (IC50 = 0.6 nM) and S1P-induced contraction of human lung fibroblasts. Synonyms: 1-(2-Ethoxy-6-(trifluoromethyl)pyridin-4-yl)-3-((5-methyl-6-(1-methyl-3-(trifluoromethyl)-1H-pyrazol-4-yl)pyridazin-3-yl)methyl)urea; MUN96006; 1-[2-Ethoxy-6-(trifluoromethyl)-4-pyridinyl]-3-({5-methyl-6-[1-methyl-3-(trifluoromethyl)-1H-pyrazol-4-yl]-3-pyridazinyl}methyl)urea; Urea, N-[2-ethoxy-6-(trifluoromethyl)-4-pyridinyl]-N'-[[5-methyl-6-[1-methyl-3-(trifluoromethyl)-1H-pyrazol-4-yl]-3-pyridazinyl]methyl]-. Grade: ≥98%. CAS No. 2130996-00-6. Molecular formula: C20H19F6N7O2. Mole weight: 503.40. | |
Our database is helping our users find suppliers everyday.
